PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A201AACTL6A, BAF53, BAF53AActin-like protein 6A

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
21616181VDFPTAIGVVLER1559.8958 (observed)   N-Term(iTRAQ4plex)MS2 score: 36peptide count: 1
21616181VDFPTAIGVVLER1559.89617 (observed)   N-Term(iTRAQ4plex)MS2 score: 38peptide count: 3
23308193ELFQEMNIELVPPYMIASK     MS2 score: 134.00peptide count: 9
23308193ENMEAISPLK     MS2 score: 134.00peptide count: 9
23308193IPEGLFDPSNVK     MS2 score: 134.00peptide count: 9
23308193LIANNTTVER     MS2 score: 134.00peptide count: 9
23308193QGGPTYYIDTNALR     MS2 score: 134.00peptide count: 9
23308193SEASLHPVLMSEAPWNTR     MS2 score: 134.00peptide count: 9
23308193STGLILDSGATHTTAIPVHDGYVLQQGIVK     MS2 score: 134.00peptide count: 9
23308193TAVLTAFANGR     MS2 score: 134.00peptide count: 9
23308193VDFPTAIGMVVER     MS2 score: 134.00peptide count: 9

Compile date 12-23-2014© PADB initiative