PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A1846ADAM10, KUZ, MADMADAM 10 precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260AIDTIYQTTDFSGIR-0.727714833 (delta mass [ppm])2   MS2 score: 61 
16709260EAVIAQISSHVK-1.219637139 (delta mass [ppm])2   MS2 score: 52 
16709260FPNIGVEK0.465491934 (delta mass [ppm])2   MS2 score: 29 
18501002KAIDTIYQTTDFSGIRN 2    
18501002KKM*APSTCASTGSLQWSKQ 2    
18501002KNLGQKENGNYIMYARA 3    
18501002KNLGQKENGNYIMYARA 2    
16709260LVDADGPLAR0.577250946 (delta mass [ppm])2   MS2 score: 33 
18501002RRRPPQPIQQPPRQ 3    
16709260SLNTGIITVQNYGSHVPPK-0.540989458 (delta mass [ppm])3   MS2 score: 29 
16684767LGQKENGNYIMYARATSGDKLNNNKFSLCSIRN3551.9285 (observed)3   peptide count: 1
18361515K.VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR.F1104.54 (observed)3    
18361515R.FEGFIQTR.G499.14 (observed)2    
18361515R.GGTFYVEPAER.Y613.9 (observed)2    
18361515R.HYEGLSYNVDSLHQK.H895.43 (observed)2    
18361515R.TLPFHSVIYHEDDINYPHK.Y1163.52 (observed)2    
18361515R.TLPFHSVIYHEDDINYPHK.Y1162.62 (observed)2    
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523DTSLFSDEFKVETSNK2   
18578523FEGFIQTR2   
18578523HYEGLSYNVDSLHQK2   
18578523HYEGLSYNVDSLHQK2   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK3   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK3   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK3   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK2   
18578523TLPFHSVIYHEDDINYPHK3   
18578523TLPFHSVIYHEDDINYPHK3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VLDYDTSHIYTGHIYGEEGSFSHGSVIDGR3   
18578523VSHITFAHEVGHNFGSPHDSGTECTPGESK3   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDK2   
18578523YGLEECTCASSDGKDDKELCHVCCMK3   
18578523YGPQGGCADHSVFER2   

Compile date 12-23-2014© PADB initiative