PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
17902193AAPLSLCALTAVDQSVLLLKPEAK       
16901338AFQPFFVELTMPYSVIR2  1Met(ox)MS2 score: 70 
16948836AFQPFFVELTMPYSVIR2.4 (delta mass [ppm])2    
16901338AIGYLNTGYQR0.82 (delta mass [ppm])2   MS2 score: 40 
16901338AIGYLNTGYQR2   MS2 score: 45 
16709260AIGYLNTGYQR-0.760380133 (delta mass [ppm])2   MS2 score: 40 
16948836AIGYLNTGYQR0.7 (delta mass [ppm])2    
17902193AINYLISGYQR       
17902193ALLAYAFALAGNK       
16901338ALLAYAFALAGNQDK2   MS2 score: 70 
16948836ALLAYAFALAGNQDK0.6 (delta mass [ppm])2    
17902193ALSFYQPR       
16948836APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVK3.9 (delta mass [ppm])4    
16901338ATVLNYLPK2   MS2 score: 41 
16709260ATVLNYLPK-0.603388905 (delta mass [ppm])2   MS2 score: 47 
16948836ATVLNYLPK0.6 (delta mass [ppm])2    
16948836AVDQSVLLMKPDAELSASSVYNLLPEK0 (delta mass [ppm])3    
16948836DMYSFLEDMGLK1.3 (delta mass [ppm])2    
16948836DMYSFLEDMGLK0.5 (delta mass [ppm])2    
16901338DTVIKPLLVEPEGLEK3   MS2 score: 33 
16709260DTVIKPLLVEPEGLEK-1.134905411 (delta mass [ppm])2   MS2 score: 44 
16948836DTVIKPLLVEPEGLEK0.6 (delta mass [ppm])3    
17902193EEGTGIELTGIGSCEIANALSKLK       
16901338ETTFNSLLCPSGGEVSEELSLK3   MS2 score: 30 
16948836ETTFNSLLCPSGGEVSEELSLK0.3 (delta mass [ppm])2    
16901338FEVQVTVPK-0.29 (delta mass [ppm])2   MS2 score: 52 
16901338FEVQVTVPK2   MS2 score: 46 
16709260FEVQVTVPK-0.854070825 (delta mass [ppm])2   MS2 score: 48 
16948836FEVQVTVPK0.3 (delta mass [ppm])2    
16709260FQVDNNNR-0.623593463 (delta mass [ppm])2   MS2 score: 30 
16948836FQVDNNNR0.4 (delta mass [ppm])2    
16709260FSGQLNSHGCFYQQVK-0.940557755 (delta mass [ppm])3   MS2 score: 37 
16948836GEAFTLK0.7 (delta mass [ppm])2    
16948836GGVEDEVTLSAYITIALLEIPLTVTHPVVR1.4 (delta mass [ppm])3    
16901338GHFSISIPVK2   MS2 score: 31 
16901338GHFSISIPVKSDIAPVAR0.53 (delta mass [ppm])3   MS2 score: 33 
17902193HSLGDNDAHSIFQSVGINIFTNSK       
16709260HYDGSYSTFGER-0.475454889 (delta mass [ppm])2   MS2 score: 34 
16901338IAQWQSFQLEGGLK2   MS2 score: 76 
16709260IAQWQSFQLEGGLK1.322454605 (delta mass [ppm])2   MS2 score: 65 
16948836IAQWQSFQLEGGLK0.9 (delta mass [ppm])2    
18501002KLTEVPALVHKDTVVKS 2    
17902193KTVSWAVTPK       
18501002KVNTNYRPGLPFSGQVLLVDEKG 3    
16901338LHTEAQIQEEGTVVELTGR-1.09 (delta mass [ppm])3   MS2 score: 58 
16901338LHTEAQIQEEGTVVELTGR3   MS2 score: 56 
16901338LLIYAVLPTGDVIGDSAK0.32 (delta mass [ppm])2   MS2 score: 36 
16901338LLIYAVLPTGDVIGDSAK2   MS2 score: 61 
16709260LLIYAVLPTGDVIGDSAK1.819927566 (delta mass [ppm])2   MS2 score: 56 
16948836LLIYAVLPTGDVIGDSAK1.3 (delta mass [ppm])2    
16948836LLIYAVLPTGDVIGDSAK0.5 (delta mass [ppm])2    
16901338LLLQQVSLPELPGEYSMK2  1Met(ox)MS2 score: 35 
16709260LLLQQVSLPELPGEYSMK1.650611122 (delta mass [ppm])2   MS2 score: 39 
16948836LLLQQVSLPELPGEYSMK3.8 (delta mass [ppm])2    
16948836LLLQQVSLPELPGEYSMK2.2 (delta mass [ppm])2    
16901338LPPNVVEESAR0.48 (delta mass [ppm])2   MS2 score: 59 
16901338LPPNVVEESAR2   MS2 score: 64 
16709260LPPNVVEESAR0.5100711 (delta mass [ppm])2   MS2 score: 60 
16901338LSFYYLIMAK2  1Met(ox)MS2 score: 52 
17902193LSPQSIYNLLPGK       
17902193LTEVPALVHKDTVVK       
16901338LVHVEEPHTETVR3   MS2 score: 26 
16709260LVHVEEPHTETVR0.08415358 (delta mass [ppm])2   MS2 score: 45 
16901338MVSGFIPLKPTVK2  1Met(ox)MS2 score: 28 
16709260MVSGFIPLKPTVK-0.066392574 (delta mass [ppm])2   MS2 score: 32 
16948836NALFCLESAWK0 (delta mass [ppm])2    
16901338NEDSLVFVQTDK2   MS2 score: 44 
16709260NEDSLVFVQTDK0.419754291 (delta mass [ppm])2   MS2 score: 73 
16901338NQGNTWLTAFVLK2.67 (delta mass [ppm])2   MS2 score: 60 
16901338NQGNTWLTAFVLK2   MS2 score: 64 
16709260NQGNTWLTAFVLK3.849641673 (delta mass [ppm])2   MS2 score: 78 
16948836NQGNTWLTAFVLK0.3 (delta mass [ppm])2    
16901338QFSFPLSSEPFQGSYK2   MS2 score: 56 
16709260QFSFPLSSEPFQGSYK0.156396034 (delta mass [ppm])2   MS2 score: 64 
16948836QFSFPLSSEPFQGSYK2.2 (delta mass [ppm])2    
16948836QFSFPLSSEPFQGSYK3.2 (delta mass [ppm])2    
16901338QGIPFFGQVR2   MS2 score: 48 
16709260QGIPFFGQVR0.601247587 (delta mass [ppm])2   MS2 score: 40 
16948836QGIPFFGQVR0.4 (delta mass [ppm])2    
16901338QQNAQGGFSSTQDTVVALHALSK1.27 (delta mass [ppm])3   MS2 score: 50 
16901338QQNAQGGFSSTQDTVVALHALSK3   MS2 score: 30 
16709260QQNAQGGFSSTQDTVVALHALSK-1.261845453 (delta mass [ppm])3   MS2 score: 54 
16901338QTVSWAVTPK2   MS2 score: 56 
16948836QTVSWAVTPK0.4 (delta mass [ppm])2    
16901338SASNMAIVDVK-0.28 (delta mass [ppm])2  1Met(ox)MS2 score: 67 
16901338SASNMAIVDVK2   MS2 score: 64 
16709260SASNMAIVDVK1.084180568 (delta mass [ppm])2   MS2 score: 75 
16948836SASNMAIVDVK0.4 (delta mass [ppm])2    
16901338SIYKPGQTVK-1.67 (delta mass [ppm])2   MS2 score: 24 
17902193SKAINYLISGYQR       
16948836SLFTDLEAENDVLHCVAFAVPK1.3 (delta mass [ppm])3    
16948836SLFTDLEAENDVLHCVAFAVPK2 (delta mass [ppm])3    
16709260SLNEEAVKK-0.506615436 (delta mass [ppm])2   MS2 score: 37 
16901338SSGSLLNNAIK-0.06 (delta mass [ppm])2   MS2 score: 49 
16901338SSGSLLNNAIK2   MS2 score: 59 
16709260SSGSLLNNAIK-1.382189844 (delta mass [ppm])2   MS2 score: 39 
16948836SSGSLLNNAIK0.2 (delta mass [ppm])2    
16901338SSSNEEVMFLTVQVK2  1Met(ox)MS2 score: 53 
16901338TAQEGDHGSHVYTK3   MS2 score: 28 
16709260TAQEGDHGSHVYTK1.006089799 (delta mass [ppm])2   MS2 score: 66 
16901338TEHPFTVEEFVLPK3   MS2 score: 55 
16709260TEHPFTVEEFVLPK0.313425106 (delta mass [ppm])2   MS2 score: 29 
16948836TEHPFTVEEFVLPK0.5 (delta mass [ppm])3    
16948836TEHPFTVEEFVLPK1.2 (delta mass [ppm])2    
16901338TGTHGLLVK-0.61 (delta mass [ppm])2   MS2 score: 23 
16901338TGTHGLLVK2   MS2 score: 35 
16709260TGTHGLLVK-0.271811077 (delta mass [ppm])2   MS2 score: 30 
16709260VDLSFSPSQSLPASHAHLR0.222651479 (delta mass [ppm])3   MS2 score: 35 
16901338VGFYESDVMGR0.41 (delta mass [ppm])2   MS2 score: 71 
16901338VGFYESDVMGR2   MS2 score: 70 
16709260VGFYESDVMGR-0.315438576 (delta mass [ppm])2   MS2 score: 71 
16948836VGFYESDVMGR3 (delta mass [ppm])2    
17902193VKALSFYQPR       
17902193VNTNYRPGLPFSGQVLLVDEK       
16948836VSNQTLSLFFTVLQDVPVR0.6 (delta mass [ppm])3    
16901338VSVQLEASPAFLAVPVEK2   MS2 score: 60 
16709260VSVQLEASPAFLAVPVEK1.395084311 (delta mass [ppm])2   MS2 score: 70 
16948836VSVQLEASPAFLAVPVEK2.9 (delta mass [ppm])2    
16948836VSVQLEASPAFLAVPVEK0.2 (delta mass [ppm])2    
16901338VTAAPQSVCALR-0.70 (delta mass [ppm])2   MS2 score: 57 
16901338VTAAPQSVCALR2   MS2 score: 49 
16709260VTAAPQSVCALR-0.037745773 (delta mass [ppm])2   MS2 score: 36 
16948836VTAAPQSVCALR0.1 (delta mass [ppm])2    
16901338VVSMDENFHPLNELIPLVYIQDPK0.94 (delta mass [ppm])3  1Met(ox)MS2 score: 23 
16901338VVSMDENFHPLNELIPLVYIQDPK4  1Met(ox)MS2 score: 26 
16948836VVSMDENFHPLNELIPLVYIQDPK0.1 (delta mass [ppm])3    
16948836VVSMDENFHPLNELIPLVYIQDPK0.8 (delta mass [ppm])3    
16901338YDVENCLANK2   MS2 score: 23 
16709260YGAATFTR-0.716145642 (delta mass [ppm])2   MS2 score: 34 
16948836YGAATFTR1.3 (delta mass [ppm])2    
16948836YNILPEKEEFPFALGVQTLPQTCDEPK1.1 (delta mass [ppm])3    
16684767ASVSGKPQYM*VLVPSLLHTETTEKG 2    
16684767ASVSGKPQYM*VLVPSLLHTETTEKG 2    
16684767ASVSGKPQYMVLVPSLLHTETTEKG 2    
16684767ASVSGKPQYMVLVPSLLHTETTEKG 2    
16684767CGEQNM*VLFAPNIYVLDYLN#ETQQLTPEIKS 3    
16684767DAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRH 3    
16684767DYLN#ETQQLTPEIKS 2    
16684767EAENDVLHCVAFAVPKS 1    
16684767EAENDVLHCVAFAVPKS 1    
16684767EFAIAEYNAPCSKG 1    
16684767EQNMVLFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767FAIAEYNAPCSKG 1    
16684767FAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767GCGEQNMVLFAPNIYVLDYLN#ETQQLTPEIKS 3    
16684767GEQNM*VLFAPNIYVLDYLN#ETQQLTPEIKS 3    
16684767GKPQYMVLVPSLLHTETTEKG 2    
16684767GKPQYMVLVPSLLHTETTEKG 2    
16684767KAAQVTIQSSGTFSSKF 1    
16684767KAAQVTIQSSGTFSSKF 1    
16684767KAGAFCLSEDAGLGISSTASLRA 2    
16684767KAGAFCLSEDAGLGISSTASLRA 2    
16684767KAIGYLNTGYQRQ 1    
16684767KAIGYLNTGYQRQ 1    
16684767KALLAYAFALAGNQDKR 1    
16684767KALLAYAFALAGNQDKR 1    
16684767KALLAYAFALAGNQDKRK 1    
16684767KALLAYAFALAGNQDKRK 1    
16684767KATVLNYLPKC 2    
16684767KATVLNYLPKC 2    
16684767KDLTGFPGPLNDQDDEDCINRH 2    
16684767KDLTGFPGPLNDQDNEDCINRH 3    
16684767KDM*YSFLEDM*GLKA 1    
16684767KDM*YSFLEDM*GLKA 1    
16684767KDM*YSFLEDMGLKA 2    
16684767KDM*YSFLEDMGLKA 2    
16684767KDMYSFLEDMGLKA 1    
16684767KDMYSFLEDMGLKA 1    
16684767KDNSVHWERPQKPKA 1    
16684767KDNSVHWERPQKPKA 1    
16684767KDTVIKPLLVEPEGLEKE 1    
16684767KDTVIKPLLVEPEGLEKE 1    
16684767KDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKL 3    
16684767KDTVIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKL 3    
16684767KEQAPHCICANGRQ 1    
16684767KEQAPHCICANGRQ 1    
16684767KETTFNSLLCPSGGEVSEELSLKL 2    
16684767KETTFNSLLCPSGGEVSEELSLKL 2    
16684767KETTFNSLLCPSGGEVSEELSLKLPPNVVEESARA 3    
16684767KETTFNSLLCPSGGEVSEELSLKLPPNVVEESARA 3    
16684767KFEVQVTVPKI 2    
16684767KFEVQVTVPKI 2    
16684767KFQVDNNNRL 1    
16684767KFQVDNNNRL 1    
16684767KFRVVSM*DENFHPLNELIPLVYIQDPKG 3    
16684767KFRVVSMDENFHPLNELIPLVYIQDPKG 3    
16684767KFSGQLNSHGCFYQQVKT 1    
16684767KFSGQLNSHGCFYQQVKT 1    
16684767KGHFSISIPVKS 1    
16684767KGHFSISIPVKS 1    
16684767KGHFSISIPVKSDIAPVARL 2    
16684767KGHFSISIPVKSDIAPVARL 2    
16684767KGPTQEFKKR 1    
16684767KGPTQEFKKR 1    
16684767KGVPIPNKVIFIRG 2    
16684767KGVPIPNKVIFIRG 2    
16684767KHYDGSYSTFGERY 1    
16684767KHYDGSYSTFGERY 1    
16684767KKLSFYYLIMAKG 1    
16684767KKLSFYYLIMAKG 1    
16684767KLHTEAQIQEEGTVVELTGRQ 2    
16684767KLHTEAQIQEEGTVVELTGRQ 2    
16684767KLPPNVVEESARA 1    
16684767KLPPNVVEESARA 1    
16684767KM*VSGFIPLKPTVKM 1    
16684767KM*VSGFIPLKPTVKM 1    
16684767KMCPQLQQYEM*HGPEGLRV 2    
16684767KMCPQLQQYEM*HGPEGLRV 2    
16684767KMCPQLQQYEMHGPEGLRV 2    
16684767KMCPQLQQYEMHGPEGLRV 2    
16684767KMVSGFIPLKPTVKM 1    
16684767KMVSGFIPLKPTVKM 1    
16684767KNEDSLVFVQTDKS 1    
16684767KNEDSLVFVQTDKS 1    
16684767KQFSFPLSSEPFQGSYKV 1    
16684767KQFSFPLSSEPFQGSYKV 1    
16684767KQQNAQGGFSSTQDTVVALHALSKY 2    
16684767KQQNAQGGFSSTQDTVVALHALSKY 2    
16684767KSGGRTEHPFTVEEFVLPKF 2    
16684767KSGGRTEHPFTVEEFVLPKF 2    
16684767KSIYKPGQTVKF 1    
16684767KSIYKPGQTVKF 1    
16684767KSLGNVN#FTVSAEALESQELCGTEVPSVPEHGRK 2    
16684767KSLGNVN#FTVSAEALESQELCGTEVPSVPEHGRK 2    
16684767KSLGNVN#FTVSAEALESQELCGTEVPSVPEHGRKD 3    
16684767KSLGNVN#FTVSAEALESQELCGTEVPSVPEHGRKD 3    
16684767KSLNEEAVKKD 2    
16684767KSLNEEAVKKD 2    
16684767KSSSNEEVM*FLTVQVKG 1    
16684767KSSSNEEVM*FLTVQVKG 1    
16684767KSSSNEEVMFLTVQVKG 1    
16684767KSSSNEEVMFLTVQVKG 1    
16684767KTAQEGDHGSHVYTKA 1    
16684767KTAQEGDHGSHVYTKA 1    
16684767KVDLSFSPSQSLPASHAHLRV 2    
16684767KVDLSFSPSQSLPASHAHLRV 2    
16684767KVSN#QTLSLFFTVLQDVPVRD 2    
16684767KVSN#QTLSLFFTVLQDVPVRD 2    
16684767KVSN#QTLSLFFTVLQDVPVRDLKPAIVKV 3    
16684767KVSN#QTLSLFFTVLQDVPVRDLKPAIVKV 3    
16684767KVTGEGCVYLQTSLKY 1    
16684767KVTGEGCVYLQTSLKY 1    
16684767KVYDYYETDEFAIAEYNAPCSKG 2    
16684767KVYDYYETDEFAIAEYNAPCSKGL 2    
16684767KYDVENCLANKV 1    
16684767KYDVENCLANKV 1    
16684767KYDVENCLANKVDLSFSPSQSLPASHAHLRV 2    
16684767KYDVENCLANKVDLSFSPSQSLPASHAHLRV 2    
16684767KYNILPEKEEFPFALGVQTLPQTCDEPKA 2    
16684767KYNILPEKEEFPFALGVQTLPQTCDEPKA 2    
16684767KYSDASDCHGEDSQAFCEKF 2    
16684767KYSDASDCHGEDSQAFCEKF 2    
16684767LDYLN#ETQQLTPEIKS 2    
16684767LEAENDVLHCVAFAVPKS 2    
16684767LEAENDVLHCVAFAVPKS 2    
16684767LFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767MVLFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767NIYVLDYLN#ETQQLTPEIKS 2    
16684767NM*VLFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767NMVLFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767QNLLQMPYGCGEQNMVLFAPNIYVLDYLN#ETQQLTPEIKS 3    
16684767RAFQPFFVELTM*PYSVIRG 2    
16684767RAFQPFFVELTM*PYSVIRG 2    
16684767RAFQPFFVELTMPYSVIRG 2    
16684767RAFQPFFVELTMPYSVIRG 2    
16684767RAVDQSVLLM*KPDAELSASSVYNLLPEKD 2    
16684767RAVDQSVLLM*KPDAELSASSVYNLLPEKD 2    
16684767RAVDQSVLLMKPDAELSASSVYNLLPEKD 2    
16684767RAVDQSVLLMKPDAELSASSVYNLLPEKD 2    
16684767RGNEANYYSN#ATTDEHGLVQFSIN#TTNVM*GTSLTVRV 3    
16684767RGNEANYYSN#ATTDEHGLVQFSIN#TTNVM*GTSLTVRV 3    
16684767RHNVYINGITYTPVSSTNEKD 2    
16684767RHNVYINGITYTPVSSTNEKD 2    
16684767RHNVYINGITYTPVSSTNEKDM*YSFLEDMGLKA 3    
16684767RHNVYINGITYTPVSSTNEKDM*YSFLEDMGLKA 3    
16684767RHNVYINGITYTPVSSTNEKDMYSFLEDM*GLKA 3    
16684767RHNVYINGITYTPVSSTNEKDMYSFLEDM*GLKA 3    
16684767RHNVYINGITYTPVSSTNEKDMYSFLEDMGLKA 2    
16684767RHNVYINGITYTPVSSTNEKDMYSFLEDMGLKA 2    
16684767RIAQWQSFQLEGGLKQ 1    
16684767RIAQWQSFQLEGGLKQ 1    
16684767RKDTVIKPLLVEPEGLEKE 1    
16684767RKDTVIKPLLVEPEGLEKE 1    
16684767RKYSDASDCHGEDSQAFCEKF 2    
16684767RKYSDASDCHGEDSQAFCEKF 2    
16684767RLLIYAVLPTGDVIGDSAKY 1    
16684767RLLIYAVLPTGDVIGDSAKY 1    
16684767RLLIYAVLPTGDVIGDSAKYDVENCLANKV 2    
16684767RLLIYAVLPTGDVIGDSAKYDVENCLANKV 2    
16684767RLLLQQVSLPELPGEYSM*KV 2    
16684767RLLLQQVSLPELPGEYSM*KV 2    
16684767RLLLQQVSLPELPGEYSMKV 2    
16684767RLLLQQVSLPELPGEYSMKV 2    
16684767RLVHVEEPHTETVRK 1    
16684767RLVHVEEPHTETVRK 1    
16684767RLVHVEEPHTETVRKY 1    
16684767RLVHVEEPHTETVRKY 1    
16684767RNALFCLESAWKT 1    
16684767RNALFCLESAWKT 1    
16684767RNQGNTWLTAFVLKT 1    
16684767RNQGNTWLTAFVLKT 1    
16684767RQGIPFFGQVRL 1    
16684767RQGIPFFGQVRL 1    
16684767RSASNMAIVDVKM 1    
16684767RSASNMAIVDVKM 1    
16684767RSLFTDLEAENDVLHCVAFA 2    
16684767RSLFTDLEAENDVLHCVAFA 2    
16684767RSLFTDLEAENDVLHCVAFAVPKS 2    
16684767RSLFTDLEAENDVLHCVAFAVPKS 2    
16684767RSSGSLLNNAIKG 1    
16684767RSSGSLLNNAIKG 1    
16684767RTEHPFTVEEFVLPKF 1    
16684767RTEHPFTVEEFVLPKF 1    
16684767RTEVSSNHVLIYLDKV 1    
16684767RTEVSSNHVLIYLDKV 1    
16684767RTGTHGLLVKQ 1    
16684767RTGTHGLLVKQ 1    
16684767RTGTHGLLVKQEDMKG 2    
16684767RTGTHGLLVKQEDMKG 2    
16684767RTTVMVKN 1    
16684767RTTVMVKN 1    
16684767RVGFYESDVM*GRG 2    
16684767RVGFYESDVM*GRG 2    
16684767RVGFYESDVMGRG 1    
16684767RVGFYESDVMGRG 1    
16684767RVSVQLEASPAFLAVPVEKE 1    
16684767RVSVQLEASPAFLAVPVEKE 1    
16684767RVSVQLEASPAFLAVPVEKEQAPHCICANGRQ 2    
16684767RVSVQLEASPAFLAVPVEKEQAPHCICANGRQ 2    
16684767RVTAAPQSVCALRA 1    
16684767RVTAAPQSVCALRA 1    
16684767RVVSM*DENFHPLNELIPLVYIQDPKG 2    
16684767RVVSMDENFHPLNELIPLVYIQDPKG 2    
16684767VLFAPNIYVLDYLN#ETQQLTPEIKS 2    
16684767YLN#ETQQLTPEIKS 2    
16684767YVLDYLN#ETQQLTPEIKS 1    
16684767YVLLAYLTAQPAPTSEDLTSATNIVKW 2    
16684767YVLLAYLTAQPAPTSEDLTSATNIVKW 2    
18361515A.SVSGKPQYMVLVPSLLHTETTEK.G1272.67 (observed)2    
18361515A.SVSGKPQYMVLVPSLLHTETTEK.G848.52 (observed)3    
18361515A.SVSGKPQYMVLVPSLLHTETTEK.G1273.35 (observed)2    
18361515I.ALLEIPLTVTHPVVR.N829.87 (observed)2    
18361515K.AIGYLNTGYQR.Q628.37 (observed)2    
18361515K.ALLAYAFALAGNQDK.R784.05 (observed)2    
18361515K.ALLAYAFALAGNQDK.R784.24 (observed)2    
18361515K.ALLAYAFALAGNQDKR.K862.27 (observed)2    
18361515K.ATVLNYLPK.C509.79 (observed)2    
18361515K.ATVLNYLPK.C2   peptide delta score: 42 
18361515K.ATVLNYLPK.C2   peptide delta score: 42 
18361515K.DLTGFPGPLNDQDDEDCINR.H1145.84 (observed)2    
18361515K.DLTGFPGPLNDQDDEDCINR.H1146.58 (observed)2    
18361515K.DMYSFLEDMGLK.A725.33 (observed)2    
18361515K.DNSVHWERPQKPK.A810.73 (observed)2    
18361515K.DNSVHWERPQKPK.A810.68 (observed)2    
18361515K.DTVIKPLLVEPEGLEK.E891.24 (observed)2    
18361515K.ETTFNSLLCPSGGEVSEELSLK.L1199.39 (observed)2    
18361515K.FEVQVTVPK.I523.44 (observed)2    
18361515K.FEVQVTVPK.I523.45 (observed)2    
18361515K.FQVDNNNR.L503.44 (observed)2    
18361515K.GHFSISIPVK.S1084.62 (observed)1    
18361515K.GHFSISIPVK.S542.88 (observed)2    
18361515K.HYDGSYSTFGER.Y1418.6 (observed)1    
18361515K.HYDGSYSTFGER.Y709.7 (observed)2    
18361515K.LPPNVVEESAR.A605.32 (observed)2    
18361515K.LPPNVVEESAR.A2   peptide delta score: 61.88 
18361515K.LPPNVVEESAR.A2   peptide delta score: 61.88 
18361515K.MCPQLQQYEMHGPEGLR.V1037.5 (observed)2    
18361515K.MVSGFIPLKPTVK.M709 (observed)2    
18361515K.MVSGFIPLKPTVK.M708.38 (observed)2    
18361515K.NEDSLVFVQTDK.S698.18 (observed)2    
18361515K.QFSFPLSSEPFQGSYK.V924.45 (observed)2    
18361515K.QQNAQGGFSSTQDTVVALHALSK.Y1193.26 (observed)2    
18361515K.SIYKPGQTVK.F1120.64 (observed)1    
18361515K.TAQEGDHGSHVYTK.A764.85 (observed)2    
18361515K.VDLSFSPSQSLPASHAH.L890.33 (observed)2    
18361515K.VDLSFSPSQSLPASHAHLR.V1024.61 (observed)2    
18361515K.VDLSFSPSQSLPASHAHLR.V683.55 (observed)3    
18361515K.VDLSFSPSQSLPASHAHLR.V1024.69 (observed)2    
18361515K.VSNQTLSLFFTVLQDVPVR.D721.4 (observed)3    
18361515K.YDVENCLANK.V613.45 (observed)2    
18361515K.YNILPEKEEFPFALGVQTLPQTCDEPK.A1582.29 (observed)2    
18361515K.YNILPEKEEFPFALGVQTLPQTCDEPK.A1054.87 (observed)3    
18361515K.YSDASDCHGEDSQAFCEK.F1053.69 (observed)2    
18361515N.SHGCFYQQVK.T627.1 (observed)2    
18361515R.AFQPFFVELTMPYSVIR.G1023.53 (observed)2    
18361515R.AFQPFFVELTMPYSVIR.G1022.54 (observed)2    
18361515R.HNVYINGITYTPVSSTNEK.D1068.93 (observed)2    
18361515R.HNVYINGITYTPVSSTNEK.D713.03 (observed)3    
18361515R.IAQWQSFQLEGGLK.Q802.81 (observed)2    
18361515R.IAQWQSFQLEGGLK.Q803.21 (observed)2    
18361515R.KDTVIKPLLVEPEGLEK.E636.84 (observed)3    
18361515R.LLIYAVLPTGDVIGDSAK.Y923.36 (observed)2    
18361515R.LLIYAVLPTGDVIGDSAK.Y922.68 (observed)2    
18361515R.LLLQQVSLPELPGEYSMK.V1024.06 (observed)2    
18361515R.LVHVEEPHTETVR.K774.04 (observed)2    
18361515R.NALFCLESAWK.T670.4 (observed)2    
18361515R.NQGNTWLTAFVLK.T745.9 (observed)2    
18361515R.QTVSWAVTPK.S559.01 (observed)2    
18361515R.SLFTDLEAENDVLHCVAFAVPK.S1238.12 (observed)2    
18361515R.SLFTDLEAENDVLHCVAFAVPK.S825.8 (observed)3    
18361515R.SLFTDLEAENDVLHCVAFAVPK.S1239.07 (observed)2    
18361515R.SPCYGYQWVSEEHEEAHHTAYLVFSPSK.S1113.35 (observed)3    
18361515R.SSGSLLNNAIK.G552.21 (observed)2    
18361515R.SSGSLLNNAIK.G552.27 (observed)2    
18361515R.TEHPFTVEEFVLPK.F836.63 (observed)2    
18361515R.TEHPFTVEEFVLPK.F558.33 (observed)3    
18361515R.TEHPFTVEEFVLPK.F837.62 (observed)2    
18361515R.TEVSSNHVLIYLDK.V809.11 (observed)2    
18361515R.TEVSSNHVLIYLDK.V808.86 (observed)2    
18361515R.TGTHGLLVK.Q463.1 (observed)2    
18361515R.TGTHGLLVK.Q927.55 (observed)1    
18361515R.VGFYESDVMGR.G630.99 (observed)2    
18361515R.VSVQLEASPAFLAVPVEK.E942.09 (observed)2    
18361515R.VTAAPQSVCALR.A636.54 (observed)2    
18361515R.VTAAPQSVCALR.A1274.67 (observed)1    
18361515R.VTAAPQSVCALR.A636.82 (observed)2    
18361515R.YGAATFTR.T443.81 (observed)2    
18361515R.YGAATFTR.T443.82 (observed)2    
18361515Y.AVLPTGDVIGDSAK.Y1342.25 (observed)1    
18361515Y.MVLVPSLLHTETTEK.G849.92 (observed)2    
18361515K.ATVLNYLPK.C509.84 (observed)2   peptide delta score: 33.85 
18361515K.ATVLNYLPK.C509.84 (observed)2   peptide delta score: 33.85 
18361515K.DTVIKPLLVEPEGLEK.E594.12 (observed)3   peptide delta score: 35.89 
18361515K.DTVIKPLLVEPEGLEK.E594.12 (observed)3   peptide delta score: 35.89 
18361515K.GHFSISIPVK.S542.91 (observed)2   peptide delta score: 44.48 
18361515K.GHFSISIPVK.S542.91 (observed)2   peptide delta score: 44.48 
18361515K.GHFSISIPVKSDIAPVAR.L474.35 (observed)4   peptide delta score: 58.8 
18361515K.GHFSISIPVKSDIAPVAR.L474.35 (observed)4   peptide delta score: 58.8 
18361515K.VDLSFSPSQSLPASHAHLR.V513.11 (observed)4   peptide delta score: 48.94 
18361515K.VDLSFSPSQSLPASHAHLR.V513.11 (observed)4   peptide delta score: 48.94 
18361515K.YGAATFTR.T443.8 (observed)2   peptide delta score: 52.46 
18361515K.YGAATFTR.T443.8 (observed)2   peptide delta score: 52.46 
18361515R.DLKPAIVK.V442.37 (observed)2   peptide delta score: 25.27 
18361515R.DLKPAIVK.V442.37 (observed)2   peptide delta score: 25.27 
18361515R.NQGNTWLTAFVLK.T746.54 (observed)2   peptide delta score: 79.75 
18361515R.NQGNTWLTAFVLK.T746.54 (observed)2   peptide delta score: 79.75 
18361515R.QGIPFFGQVR.L574.92 (observed)2   peptide delta score: 33.88 
18361515R.QGIPFFGQVR.L574.92 (observed)2   peptide delta score: 33.88 
18361515R.QTVSWAVTPK.S558.84 (observed)2   peptide delta score: 32.56 
18361515R.QTVSWAVTPK.S558.84 (observed)2   peptide delta score: 32.56 
18361515R.TEHPFTVEEFVLPK.F558.39 (observed)3   peptide delta score: 41.41 
18361515R.TEHPFTVEEFVLPK.F558.39 (observed)3   peptide delta score: 41.41 
18361515R.VTAAPQSVCALR.A657.91 (observed)2  NIPCAM (C)peptide delta score: 49.33 
18361515R.VTAAPQSVCALR.A657.91 (observed)2  NIPCAM (C)peptide delta score: 49.33 
18614015(K)AAPLSLCALTAVDQSVLLLKPEAK(L)      peptide count: 12
18614015(K)ADSHFR(H)      peptide count: 1
18614015(K)AESPVFVQTDKPIYKPGQIVK(F)      peptide count: 5
18614015(K)AINYLISGYQR(Q)      peptide count: 4
18614015(K)ALSCLESSWK(T)      peptide count: 1
18614015(K)ALSFYQPR(A)      peptide count: 1
18614015(K)APFALQVNTLPLNFDK(A)      peptide count: 2
18614015(K)EYVLPK(F)      peptide count: 3
18614015(K)FEVIIK(M)      peptide count: 1
18614015(K)GSGSGCVYLQTSLK(Y)      peptide count: 1
18614015(K)IEVEAK(I)      peptide count: 2
18614015(K)IKEEGTGIELTGIGSCEIANALSK(L)      peptide count: 3
18614015(K)KIEHSFEVK(E)      peptide count: 7
18614015(K)LQDQPNIQR(T)      peptide count: 2
18614015(K)LSPQSIYNLLPGK(T)      peptide count: 3
18614015(K)LTEVPALVHK(D)      peptide count: 1
18614015(K)NLKPAPIK(V)      peptide count: 2
18614015(K)RSELLESLNK(D)      peptide count: 1
18614015(K)SFAQAR(A)      peptide count: 2
18614015(K)SVIVEPEGIEK(E)      peptide count: 2
18614015(K)TTLVTIQSTGSFSQK(F)      peptide count: 1
18614015(K)TVQGAFFGVPVYK(D)      peptide count: 1
18614015(K)TVSWAVTPK(S)      peptide count: 2
18614015(K)VFQLR(Q)      peptide count: 1
18614015(K)VLIVEPEGIK(Q)      peptide count: 2
18614015(K)VLIVEPEGIKQEHTFSSLFCASDAEISEK(L)      peptide count: 2
18614015(K)VNTNYRPGLPFSGQVLLVDEK(G)      peptide count: 2
18614015(K)VPDTITEWK(A)      peptide count: 3
18614015(K)YFPETWIWDLVPLDVSGDGELAVK(V)      peptide count: 1
18614015(K)YGAATFTR(S)      peptide count: 2
18614015(R)APSAEVEMTAYVLLAYLTSESSRPTR(D)      peptide count: 1
18614015(R)DLSSSDLSTASK(I)      peptide count: 5
18614015(R)EGNTWLTAFVLK(S)      peptide count: 2
18614015(R)GEAFTLK(A)      peptide count: 3
18614015(R)GSIFNLGSHVLSLEQGNMK(G)      peptide count: 1
18614015(R)IFQWQNIHLAGGLHQLSFPLSVEPALGIYK(V)      peptide count: 1
18614015(R)KTVSWAVTPK(S)      peptide count: 1
18614015(R)KYFPETWIWDLVPLDVSGDGELAVK(V)      peptide count: 4
18614015(R)LEHVSR(T)      peptide count: 3
18614015(R)LLLQEVR(L)      peptide count: 2
18614015(R)LPDLPGNYVTK(G)      peptide count: 1
18614015(R)NLQPAIVK(V)      peptide count: 2
18614015(R)YNMHLEK(Q)      peptide count: 1
21616181AFLSVMASPQSLCGLR1869.95598 (observed)   N-Term(iTRAQ4plex), C13(Methylthio)peptide count: 27
21616181AFLSVMASPQSLCGLR1885.94609 (observed)   N-Term(iTRAQ4plex), M6(Oxidation), C13(Methylthio)peptide count: 35
21616181AFLSVMASPQSLCGLR1869.95452 (observed)   N-Term(iTRAQ4plex), C13(Methylthio)peptide count: 25
21616181AFLSVMASPQSLCGLR1885.95049 (observed)   N-Term(iTRAQ4plex), M6(Oxidation), C13(Methylthio)peptide count: 50
21616181AITYLNTGYQR1444.75652 (observed)   N-Term(iTRAQ4plex), N6(Deamidated)peptide count: 77
21616181AITYLNTGYQR1443.77019 (observed)   N-Term(iTRAQ4plex)peptide count: 87
21616181ALLAYAFALAGNQDTK1955.09014 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 50
21616181ALLAYAFALAGNQDTK1955.0894 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 58
21616181ASVTVLGDILGSAMQNTQDLLK2562.40848 (observed)   N-Term(iTRAQ4plex), K22(iTRAQ4plex)peptide count: 46
21616181ASVTVLGDILGSAMQNTQDLLK2563.3956 (observed)   N-Term(iTRAQ4plex), N16(Deamidated), K22(iTRAQ4plex)peptide count: 16
21616181ASVTVLGDILGSAMQNTQDLLK2578.40641 (observed)   N-Term(iTRAQ4plex), M14(Oxidation), K22(iTRAQ4plex)peptide count: 29
21616181ASVTVLGDILGSAMQNTQDLLK2578.40549 (observed)   N-Term(iTRAQ4plex), M14(Oxidation), K22(iTRAQ4plex)peptide count: 30
21616181ATVLNYLQTCIR1584.84184 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 68
21616181ATVLNYLQTCIR1584.84062 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 75
21616181CEQTLAVQAHYILNDEAVLER2605.29929 (observed)   N-Term(iTRAQ4plex), C1(Methylthio)peptide count: 4
21616181DLTGFPK1065.61113 (observed)   N-Term(iTRAQ4plex), K7(iTRAQ4plex)peptide count: 4
21616181DSNVCYGFR1250.54155 (observed)   N-Term(iTRAQ4plex), C5(Methylthio)peptide count: 36
21616181DSNVCYGFR1250.5418 (observed)   N-Term(iTRAQ4plex), C5(Methylthio)peptide count: 27
21616181EDLTAAMLIVK1507.86675 (observed)   N-Term(iTRAQ4plex), M7(Oxidation), K11(iTRAQ4plex)peptide count: 39
21616181EDLTAAMLIVK1491.87493 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 56
21616181EDLTAAMLIVK1507.86748 (observed)   N-Term(iTRAQ4plex), M7(Oxidation), K11(iTRAQ4plex)peptide count: 32
21616181EDLTAAMLIVK1491.87444 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 32
21616181EFPFALVVQTLPGTCEDLK2441.27007 (observed)   N-Term(iTRAQ4plex), C15(Methylthio), K19(iTRAQ4plex)peptide count: 10
21616181EFPFALVVQTLPGTCEDLK2441.27396 (observed)   N-Term(iTRAQ4plex), C15(Methylthio), K19(iTRAQ4plex)peptide count: 14
21616181ELVFYYLMMAK1695.91301 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 7
21616181ELVFYYLMMAK1695.91338 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 6
21616181ELVFYYLMMAK1711.90647 (observed)   N-Term(iTRAQ4plex), M9(Oxidation), K11(iTRAQ4plex)peptide count: 13
21616181ELVFYYLMMAK1727.90348 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), M9(Oxidation), K11(iTRAQ4plex)peptide count: 4
21616181ELVFYYLMMAK1711.90947 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), K11(iTRAQ4plex)peptide count: 16
21616181FQVNNDNQLLLQR1746.92986 (observed)   N-Term(iTRAQ4plex), N4(Deamidated)peptide count: 141
21616181FQVNNDNQLLLQR1746.929 (observed)   N-Term(iTRAQ4plex), N4(Deamidated)peptide count: 95
21616181FQVNNDNQLLLQR1746.93059 (observed)   N-Term(iTRAQ4plex), N4(Deamidated)peptide count: 153
21616181FQVNNDNQLLLQR1746.93047 (observed)   N-Term(iTRAQ4plex), N4(Deamidated)peptide count: 115
21616181FSINTDDIMGTSLTVR1913.97795 (observed)   N-Term(iTRAQ4plex)peptide count: 119
21616181FSINTDDIMGTSLTVR1929.9727 (observed)   N-Term(iTRAQ4plex), M9(Oxidation)peptide count: 91
21616181FSINTDDIMGTSLTVR1913.97966 (observed)   N-Term(iTRAQ4plex)peptide count: 146
21616181FSINTDDIMGTSLTVR1929.97405 (observed)   N-Term(iTRAQ4plex), M9(Oxidation)peptide count: 93
21616181FSQQLDGR1094.57141 (observed)   N-Term(iTRAQ4plex)peptide count: 24
21616181FSQQLDGR1094.57019 (observed)   N-Term(iTRAQ4plex)peptide count: 13
21616181GCFSQLVK1215.64165 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), K8(iTRAQ4plex)peptide count: 6
21616181GVNQQEEDTNGCLK1869.85674 (observed)   N-Term(iTRAQ4plex), N10(Deamidated), C12(Methylthio), K14(iTRAQ4plex)peptide count: 24
21616181GVNQQEEDTNGCLK1869.86394 (observed)   N-Term(iTRAQ4plex), N10(Deamidated), C12(Methylthio), K14(iTRAQ4plex)peptide count: 3
21616181IAQWQNFR1206.65422 (observed)   N-Term(iTRAQ4plex)peptide count: 11
21616181IAQWQNFR1206.65044 (observed)   N-Term(iTRAQ4plex)MS2 score: 52peptide count: 5
21616181IQEEGTGVEETGK1664.85845 (observed)   N-Term(iTRAQ4plex), K13(iTRAQ4plex)peptide count: 3
21616181IQEEGTGVEETGK1664.86394 (observed)   N-Term(iTRAQ4plex), K13(iTRAQ4plex)peptide count: 7
21616181LPSDVVEESAR1345.70854 (observed)   N-Term(iTRAQ4plex)peptide count: 70
21616181LPSDVVEESAR1345.70989 (observed)   N-Term(iTRAQ4plex)peptide count: 79
21616181LVLYTILPNGEVVGDTVK2218.29595 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 181
21616181LVLYTILPNGEVVGDTVK2218.30423 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 189
21616181NALFCLDTAWK1615.82952 (observed)   N-Term(iTRAQ4plex), C5(Methylthio), K11(iTRAQ4plex)peptide count: 33
21616181NALFCLDTAWK1615.82549 (observed)   N-Term(iTRAQ4plex), C5(Methylthio), K11(iTRAQ4plex)peptide count: 25
21616181NEVPVVPER1182.6624 (observed)   N-Term(iTRAQ4plex)peptide count: 57
21616181NEVPVVPER1182.66098 (observed)   N-Term(iTRAQ4plex)peptide count: 21
21616181QEYEMQLDVNAK1755.88547 (observed)   N-Term(iTRAQ4plex), K12(iTRAQ4plex)MS2 score: 41peptide count: 1
21616181QGIPFVGQVLLVDGR1742.01323 (observed)   N-Term(iTRAQ4plex)peptide count: 138
21616181QGIPFVGQVLLVDGR1742.01335 (observed)   N-Term(iTRAQ4plex)peptide count: 142
21616181QGIPFVGQVLLVDGR1743.99346 (observed)   N-Term(iTRAQ4plex), Q1(Deamidated), Q8(Deamidated)peptide count: 2
21616181QLSFPLSSEPTQGSYK2057.08281 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 53
21616181QLSFPLSSEPTQGSYK2057.08476 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 52
21616181VAGEGCVYLQTSLK1801.94756 (observed)   N-Term(iTRAQ4plex), C6(Methylthio), K14(iTRAQ4plex)peptide count: 27
21616181VAGEGCVYLQTSLK1801.95024 (observed)   N-Term(iTRAQ4plex), C6(Methylthio), K14(iTRAQ4plex)peptide count: 5
21616181VFTNLNIR1120.66113 (observed)   N-Term(iTRAQ4plex)peptide count: 14
21616181VFTNLNIR1120.66301 (observed)   N-Term(iTRAQ4plex)MS2 score: 52peptide count: 10
21616181VGVQLEASPDFLATPEEK2218.18706 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 99
21616181VGVQLEASPDFLATPEEK2218.18779 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 80
21616181VSMESVR951.50682 (observed)   N-Term(iTRAQ4plex)MS2 score: 43peptide count: 2
21616181VSMESVR951.50554 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181VSNQMLTLFFMVQQDIPVR2410.28904 (observed)   N-Term(iTRAQ4plex)peptide count: 2
21616181VSNQMLTLFFMVQQDIPVR2442.27042 (observed)   N-Term(iTRAQ4plex), M5(Oxidation), M11(Oxidation)peptide count: 3
21616181VTLPTVPGDYTAK1649.93901 (observed)   N-Term(iTRAQ4plex), K13(iTRAQ4plex)peptide count: 107
21616181VTLPTVPGDYTAK1649.93559 (observed)   N-Term(iTRAQ4plex), K13(iTRAQ4plex)peptide count: 57
21616181VVSLDENFHPLNELIPLLYIQDSK3084.69431 (observed)   N-Term(iTRAQ4plex), K24(iTRAQ4plex)peptide count: 3
21616181VVSLDENFHPLNELIPLLYIQDSK3084.68808 (observed)   N-Term(iTRAQ4plex), K24(iTRAQ4plex)XCorr (Sequest): 4.16peptide count: 1
21616181WLTEENVEAWHTANAVFSPSR2588.27689 (observed)   N-Term(iTRAQ4plex)peptide count: 7
21616181WLTEENVEAWHTANAVFSPSR2588.27304 (observed)   N-Term(iTRAQ4plex)peptide count: 25
21616181YGAATFTR1030.54248 (observed)   N-Term(iTRAQ4plex)peptide count: 23
21616181YGAATFTR1030.54529 (observed)   N-Term(iTRAQ4plex)MS2 score: 43peptide count: 9
21616181YSAPCSAGYGNA1494.66106 (observed)   N-Term(iTRAQ4plex), Y1(iTRAQ4plex), C5(Methylthio)peptide count: 4
21616181YSAPCSAGYGNA1350.56072 (observed)   N-Term(iTRAQ4plex), C5(Methylthio)MS2 score: 84peptide count: 5
21616181YSAPCSAGYGNA1350.55913 (observed)   N-Term(iTRAQ4plex), C5(Methylthio)MS2 score: 68peptide count: 11
21616181YSAPCSAGYGNA1494.6563 (observed)   N-Term(iTRAQ4plex), Y1(iTRAQ4plex), C5(Methylthio)peptide count: 3
21616181YSNPSSCFGEESLAFCEK2378.00371 (observed)   N-Term(iTRAQ4plex), C7(Methylthio), C16(Methylthio), K18(iTRAQ4plex)peptide count: 17
21616181YSNPSSCFGEESLAFCEK2378.00664 (observed)   N-Term(iTRAQ4plex), C7(Methylthio), C16(Methylthio), K18(iTRAQ4plex)peptide count: 15
21127740ATVLNYLPK509.8 (observed)21.11E+0533.51 (HPLC [min or %B]) MS2 score: 38.84
21127740ATVLNYLPK509.8 (observed)25.20E+0633.73 (HPLC [min or %B]) MS2 score: 42.32
21127740ATVLNYLPK509.8 (observed)23.80E+0525.24 (HPLC [min or %B]) MS2 score: 27.24
21127740ATVLNYLPK509.8 (observed)22.55E+0632.97 (HPLC [min or %B]) MS2 score: 27.74
21127740ATVLNYLPK509.8 (observed)23.47E+0533.09 (HPLC [min or %B]) MS2 score: 42.35
21127740ATVLNYLPK509.8 (observed)22.29E+0533.39 (HPLC [min or %B]) MS2 score: 38.26
21127740ATVLNYLPK509.8 (observed)21.92E+0533.68 (HPLC [min or %B]) MS2 score: 41.8
21127740ATVLNYLPK509.8 (observed)21.31E+0525.71 (HPLC [min or %B]) MS2 score: 26.38
21127740ATVLNYLPK509.8 (observed)27.41E+0534.15 (HPLC [min or %B]) MS2 score: 42.33
21127740ATVLNYLPK509.8 (observed)29.37E+0533.59 (HPLC [min or %B]) MS2 score: 34.89
21127740ATVLNYLPK509.8 (observed)23.68E+0533.95 (HPLC [min or %B]) MS2 score: 41.48
21127740AIGYLNTGYQR628.32 (observed)22.71E+0618.48 (HPLC [min or %B]) MS2 score: 54.75
21127740AIGYLNTGYQR628.32 (observed)26.29E+0626.09 (HPLC [min or %B]) MS2 score: 48.66
21127740AIGYLNTGYQR628.33 (observed)22.41E+0518.65 (HPLC [min or %B]) MS2 score: 49.99
21127740AIGYLNTGYQR628.33 (observed)26.80E+0526.79 (HPLC [min or %B]) MS2 score: 36.1
21127740AIGYLNTGYQR628.33 (observed)22.68E+0626.49 (HPLC [min or %B]) MS2 score: 38.85
21127740AIGYLNTGYQR628.32 (observed)28.23E+0516.75 (HPLC [min or %B]) MS2 score: 28.15
21127740AIGYLNTGYQR628.33 (observed)28.94E+0517.78 (HPLC [min or %B]) MS2 score: 39.29
21127740ALLAYAFALAGNQDK783.42 (observed)21.97E+0633.78 (HPLC [min or %B]) MS2 score: 73.69
21127740ALLAYAFALAGNQDK522.62 (observed)31.27E+0633.82 (HPLC [min or %B]) MS2 score: 41.47
21127740ALLAYAFALAGNQDK783.42 (observed)23.37E+0533.91 (HPLC [min or %B]) MS2 score: 58.65
21127740ALLAYAFALAGNQDK522.61 (observed)31.00E+0634.07 (HPLC [min or %B]) MS2 score: 37.88
21127740ALLAYAFALAGNQDK783.42 (observed)21.78E+0537.97 (HPLC [min or %B]) MS2 score: 44.39
21127740ALLAYAFALAGNQDK783.42 (observed)23.22E+0534.23 (HPLC [min or %B]) MS2 score: 67.08
21127740ALLAYAFALAGNQDK522.62 (observed)32.80E+0534.28 (HPLC [min or %B]) MS2 score: 25.63
21127740ALLAYAFALAGNQDK783.42 (observed)21.40E+0537.69 (HPLC [min or %B]) MS2 score: 40.06
21127740ALLAYAFALAGNQDK783.42 (observed)22.71E+0537.68 (HPLC [min or %B]) MS2 score: 63.54
21127740ALLAYAFALAGNQDK783.42 (observed)23.71E+0538.43 (HPLC [min or %B]) MS2 score: 69.25
21127740ALLAYAFALAGNQDK522.62 (observed)31.63E+0538.5 (HPLC [min or %B]) MS2 score: 33.46
21127740ATVLNYLPK509.8 (observed)27.79E+0534.47 (HPLC [min or %B]) MS2 score: 21.89
21127740ATVLNYLPK509.8 (observed)21.19E+0533.74 (HPLC [min or %B]) MS2 score: 25.92
21127740ATVLNYLPK509.8 (observed)21.53E+0533.87 (HPLC [min or %B]) MS2 score: 25.69
21127740ATVLNYLPK509.8 (observed)27.04E+0534.23 (HPLC [min or %B]) MS2 score: 21.02
21127740ATVLNYLPK509.8 (observed)21.32E+0533.93 (HPLC [min or %B]) MS2 score: 34.09
21127740ATVLNYLPK509.8 (observed)22.77E+0624.83 (HPLC [min or %B]) MS2 score: 35.06
21127740ATVLNYLPK509.8 (observed)27.82E+0525.01 (HPLC [min or %B]) MS2 score: 42.97
21127740ATVLNYLPK509.8 (observed)21.16E+0525 (HPLC [min or %B]) MS2 score: 22.1
21127740DTVIKPLLVEPEGLEK890.51 (observed)26.13E+0526.27 (HPLC [min or %B]) MS2 score: 48.63
21127740DTVIKPLLVEPEGLEK890.51 (observed)21.98E+0633.31 (HPLC [min or %B]) MS2 score: 45.6
21127740DTVIKPLLVEPEGLEK594.01 (observed)33.84E+0526.64 (HPLC [min or %B]) MS2 score: 35.16
21127740DTVIKPLLVEPEGLEK890.51 (observed)26.84E+0529.83 (HPLC [min or %B]) MS2 score: 23.58
21127740DTVIKPLLVEPEGLEK594.01 (observed)31.63E+0529.51 (HPLC [min or %B]) MS2 score: 17.7
21127740DTVIKPLLVEPEGLEK594.01 (observed)33.53E+0529.48 (HPLC [min or %B]) MS2 score: 41.58
21127740FEVQVTVPK523.8 (observed)25.70E+0521.48 (HPLC [min or %B]) MS2 score: 34.99
21127740FEVQVTVPK523.8 (observed)25.11E+0625.88 (HPLC [min or %B]) MS2 score: 37.34
21127740FEVQVTVPK523.8 (observed)23.44E+0526.05 (HPLC [min or %B]) MS2 score: 41.97
21127740FEVQVTVPK523.8 (observed)25.27E+0525.94 (HPLC [min or %B]) MS2 score: 37.05
21127740FEVQVTVPK523.8 (observed)29.03E+0521.47 (HPLC [min or %B]) MS2 score: 26.35
21127740GHFSISIPVK542.81 (observed)24.84E+0622 (HPLC [min or %B]) MS2 score: 30.33
21127740GHFSISIPVK362.21 (observed)35.37E+0522.05 (HPLC [min or %B]) MS2 score: 32.4
21127740GHFSISIPVK542.81 (observed)22.10E+0622.55 (HPLC [min or %B]) MS2 score: 39.76
21127740GHFSISIPVK542.81 (observed)23.95E+0629.28 (HPLC [min or %B]) MS2 score: 34.16
21127740GHFSISIPVK542.81 (observed)22.67E+0522.8 (HPLC [min or %B]) MS2 score: 24.48
21127740GHFSISIPVK542.81 (observed)22.04E+0522.36 (HPLC [min or %B]) MS2 score: 28.95
21127740GHFSISIPVK542.81 (observed)26.84E+0525.52 (HPLC [min or %B]) MS2 score: 26.81
21127740GHFSISIPVK542.81 (observed)22.58E+0630.43 (HPLC [min or %B]) MS2 score: 29.31
21127740GHFSISIPVK542.81 (observed)25.14E+0522.38 (HPLC [min or %B]) MS2 score: 31.79
21127740HYDGSYSTFGER709.8 (observed)21.42E+0614.01 (HPLC [min or %B]) MS2 score: 61.51
21127740HYDGSYSTFGER709.8 (observed)21.92E+0720.61 (HPLC [min or %B]) MS2 score: 38.89
21127740HYDGSYSTFGER709.8 (observed)21.51E+0621.22 (HPLC [min or %B]) MS2 score: 35.68
21127740IAQWQSFQLEGGLK802.93 (observed)23.10E+0628.5 (HPLC [min or %B]) MS2 score: 56.02
21127740IAQWQSFQLEGGLK802.93 (observed)23.74E+0628.65 (HPLC [min or %B]) MS2 score: 64.51
21127740IAQWQSFQLEGGLK802.93 (observed)24.72E+0528.66 (HPLC [min or %B]) MS2 score: 57.27
21127740IAQWQSFQLEGGLK802.93 (observed)21.18E+0628.89 (HPLC [min or %B]) MS2 score: 67.5
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)24.33E+0535.12 (HPLC [min or %B]) MS2 score: 49.81
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)22.06E+0534.96 (HPLC [min or %B]) MS2 score: 27.63
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)25.48E+0543.05 (HPLC [min or %B]) MS2 score: 44.29
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)21.66E+0535.05 (HPLC [min or %B]) MS2 score: 27.12
21127740LPPNVVEESAR605.83 (observed)21.80E+0522.35 (HPLC [min or %B]) MS2 score: 29.31
21127740LPPNVVEESAR605.82 (observed)29.75E+0615.08 (HPLC [min or %B]) MS2 score: 78.18
21127740LPPNVVEESAR605.82 (observed)28.77E+0516.14 (HPLC [min or %B]) MS2 score: 46.21
21127740LPPNVVEESAR605.82 (observed)25.23E+0722.44 (HPLC [min or %B]) MS2 score: 67.16
21127740LPPNVVEESAR605.83 (observed)23.55E+0522.02 (HPLC [min or %B]) MS2 score: 29.27
21127740LPPNVVEESAR605.82 (observed)26.92E+0514.89 (HPLC [min or %B]) MS2 score: 70.33
21127740LPPNVVEESAR605.82 (observed)23.34E+0522.51 (HPLC [min or %B]) MS2 score: 35.67
21127740LSFYYLIMAK632.83 (observed)22.48E+0533.49 (HPLC [min or %B])Oxidation (M)MS2 score: 42.3
21127740LSFYYLIMAK632.83 (observed)24.72E+0641.5 (HPLC [min or %B])Oxidation (M)MS2 score: 60.27
21127740LSFYYLIMAK632.84 (observed)22.30E+0533.75 (HPLC [min or %B])Oxidation (M)MS2 score: 28.64
21127740LSFYYLIMAK632.83 (observed)24.43E+0542.23 (HPLC [min or %B])Oxidation (M)MS2 score: 48.86
21127740LSFYYLIMAK632.84 (observed)26.66E+0532.38 (HPLC [min or %B])Oxidation (M)MS2 score: 42.79
21127740LSFYYLIMAK624.84 (observed)28.86E+0535.73 (HPLC [min or %B]) MS2 score: 38.53
21127740LSFYYLIMAK632.83 (observed)26.52E+0432.63 (HPLC [min or %B])Oxidation (M)MS2 score: 59.28
21127740NALFCLESAWK669.83 (observed)21.17E+0731.96 (HPLC [min or %B]) MS2 score: 45.51
21127740NALFCLESAWK670.32 (observed)29.84E+0535.55 (HPLC [min or %B])Deamidation (NQ)MS2 score: 35.19
21127740NALFCLESAWK669.83 (observed)26.89E+0631.95 (HPLC [min or %B]) MS2 score: 44.48
21127740NALFCLESAWK669.83 (observed)22.91E+0531.96 (HPLC [min or %B]) MS2 score: 34.54
21127740NALFCLESAWK669.83 (observed)26.04E+0532.18 (HPLC [min or %B]) MS2 score: 40.03
21127740NALFCLESAWK669.83 (observed)25.16E+0536.96 (HPLC [min or %B]) MS2 score: 57.72
21127740NALFCLESAWK669.83 (observed)29.81E+0536.74 (HPLC [min or %B]) MS2 score: 26.08
21127740NEDSLVFVQTDK697.84 (observed)22.80E+0621.11 (HPLC [min or %B]) MS2 score: 72.55
21127740NEDSLVFVQTDK697.84 (observed)29.18E+0629.13 (HPLC [min or %B]) MS2 score: 49.81
21127740NEDSLVFVQTDK697.84 (observed)24.65E+0521.38 (HPLC [min or %B]) MS2 score: 63.86
21127740NEDSLVFVQTDK697.84 (observed)22.18E+0630.03 (HPLC [min or %B]) MS2 score: 69.87
21127740NEDSLVFVQTDK697.84 (observed)21.64E+0619.96 (HPLC [min or %B]) MS2 score: 52.84
21127740NEDSLVFVQTDK697.84 (observed)28.39E+0520.21 (HPLC [min or %B]) MS2 score: 55.28
21127740NEDSLVFVQTDK697.84 (observed)22.19E+0625.44 (HPLC [min or %B]) MS2 score: 41.39
21127740NQGNTWLTAFVLK746.4 (observed)22.92E+0635.48 (HPLC [min or %B]) MS2 score: 74.22
21127740NQGNTWLTAFVLK497.94 (observed)36.32E+0535.69 (HPLC [min or %B]) MS2 score: 37.33
21127740NQGNTWLTAFVLK746.4 (observed)29.74E+0535.54 (HPLC [min or %B]) MS2 score: 67.96
21127740NQGNTWLTAFVLK746.4 (observed)22.62E+0639.6 (HPLC [min or %B]) MS2 score: 63.9
21127740NQGNTWLTAFVLK497.93 (observed)33.44E+0539.79 (HPLC [min or %B]) MS2 score: 24.52
21127740NQGNTWLTAFVLK746.89 (observed)23.35E+0542.63 (HPLC [min or %B])Deamidation (NQ)MS2 score: 52.27
21127740NQGNTWLTAFVLK746.4 (observed)26.84E+0644.79 (HPLC [min or %B]) MS2 score: 74.59
21127740QFSFPLSSEPFQGSYK916.43 (observed)24.92E+0536.99 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 34.87
21127740QGIPFFGQVR566.3 (observed)22.53E+0634.54 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 44.35
21127740QGIPFFGQVR574.81 (observed)21.01E+0628.79 (HPLC [min or %B]) MS2 score: 30.99
21127740QGIPFFGQVR566.3 (observed)27.43E+0534.79 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 27.83
21127740QTVSWAVTPK558.8 (observed)23.35E+0618.43 (HPLC [min or %B]) MS2 score: 32.41
21127740QTVSWAVTPK558.8 (observed)24.24E+0726.45 (HPLC [min or %B]) MS2 score: 54.65
21127740QTVSWAVTPK558.81 (observed)23.57E+0518.68 (HPLC [min or %B]) MS2 score: 36.85
21127740QTVSWAVTPK558.81 (observed)21.08E+0627.13 (HPLC [min or %B]) MS2 score: 40.98
21127740SASNMAIVDVK575.79 (observed)27.83E+0412.43 (HPLC [min or %B])Oxidation (M)MS2 score: 27.64
21127740SASNMAIVDVK575.79 (observed)22.83E+0514.62 (HPLC [min or %B])Oxidation (M)MS2 score: 36.64
21127740SASNMAIVDVK575.79 (observed)26.94E+0515.65 (HPLC [min or %B])Oxidation (M)MS2 score: 37.49
21127740SASNMAIVDVK575.79 (observed)21.17E+0612.01 (HPLC [min or %B])Oxidation (M)MS2 score: 37.04
21127740SDIAPVAR414.73 (observed)21.29E+078.57 (HPLC [min or %B]) MS2 score: 39.57
21127740SDIAPVAR414.73 (observed)24.34E+0716.28 (HPLC [min or %B]) MS2 score: 29.07
21127740SIYKPGQTVK560.82 (observed)25.03E+069.37 (HPLC [min or %B]) MS2 score: 30.86
21127740SIYKPGQTVK560.82 (observed)23.32E+0715.76 (HPLC [min or %B]) MS2 score: 23.57
21127740SSGSLLNNAIK552.31 (observed)25.69E+0516.62 (HPLC [min or %B]) MS2 score: 32.85
21127740SSGSLLNNAIK552.31 (observed)22.74E+0617.64 (HPLC [min or %B]) MS2 score: 39.74
21127740SSGSLLNNAIK552.31 (observed)25.53E+0517.03 (HPLC [min or %B]) MS2 score: 39.03
21127740SSGSLLNNAIK552.3 (observed)26.93E+0618.1 (HPLC [min or %B]) MS2 score: 41.64
21127740SSGSLLNNAIK552.3 (observed)21.22E+0618.32 (HPLC [min or %B]) MS2 score: 25.38
21127740SSGSLLNNAIK552.31 (observed)24.69E+0526.66 (HPLC [min or %B]) MS2 score: 39.01
21127740TEHPFTVEEFVLPK558.29 (observed)31.11E+0629.66 (HPLC [min or %B]) MS2 score: 33.06
21127740TEHPFTVEEFVLPK558.29 (observed)34.98E+0529.64 (HPLC [min or %B]) MS2 score: 37.89
21127740TEHPFTVEEFVLPK836.93 (observed)27.09E+0529.69 (HPLC [min or %B]) MS2 score: 54.41
21127740TEHPFTVEEFVLPK836.93 (observed)24.38E+0636.97 (HPLC [min or %B]) MS2 score: 34.14
21127740TEHPFTVEEFVLPK836.94 (observed)23.92E+0628.9 (HPLC [min or %B]) MS2 score: 26.27
21127740TEHPFTVEEFVLPK558.29 (observed)32.11E+0729.07 (HPLC [min or %B]) MS2 score: 37.45
21127740TEHPFTVEEFVLPK558.29 (observed)32.93E+0529.04 (HPLC [min or %B]) MS2 score: 44.89
21127740TEHPFTVEEFVLPK558.29 (observed)37.22E+0532.83 (HPLC [min or %B]) MS2 score: 40.02
21127740TEVSSNHVLIYLDK809.43 (observed)23.72E+0522.75 (HPLC [min or %B]) MS2 score: 77.23
21127740TEVSSNHVLIYLDK809.42 (observed)21.46E+0729.75 (HPLC [min or %B]) MS2 score: 75.62
21127740TEVSSNHVLIYLDK809.43 (observed)21.48E+0523.19 (HPLC [min or %B]) MS2 score: 41.82
21127740TGTHGLLVK463.28 (observed)27.26E+059.93 (HPLC [min or %B]) MS2 score: 24.32
21127740VGFYESDVMGR638.28 (observed)21.30E+0724.57 (HPLC [min or %B])Oxidation (M)MS2 score: 58.69
21127740VSVQLEASPAFLAVPVEK942.53 (observed)24.41E+0531.32 (HPLC [min or %B]) MS2 score: 60.25
21127740VSVQLEASPAFLAVPVEK942.53 (observed)23.33E+0531.91 (HPLC [min or %B]) MS2 score: 36.28
21127740VSVQLEASPAFLAVPVEK942.53 (observed)24.41E+0531.8 (HPLC [min or %B]) MS2 score: 53.79
21127740VSVQLEASPAFLAVPVEK942.53 (observed)21.79E+0639.97 (HPLC [min or %B]) MS2 score: 50
21127740VSVQLEASPAFLAVPVEK942.53 (observed)27.45E+0538.98 (HPLC [min or %B]) MS2 score: 36.16
21127740VSVQLEASPAFLAVPVEK942.53 (observed)21.98E+0534.83 (HPLC [min or %B]) MS2 score: 35.6
21127740VSVQLEASPAFLAVPVEK942.52 (observed)21.39E+0634.67 (HPLC [min or %B]) MS2 score: 50.54
21127740VSVQLEASPAFLAVPVEK942.52 (observed)21.88E+0634.44 (HPLC [min or %B]) MS2 score: 66.1
21127740VSVQLEASPAFLAVPVEK942.53 (observed)22.55E+0634.4 (HPLC [min or %B]) MS2 score: 38.36
21127740VSVQLEASPAFLAVPVEK942.53 (observed)21.73E+0631.63 (HPLC [min or %B]) MS2 score: 44.43
21127740VTAAPQSVCALR636.84 (observed)23.39E+0515.08 (HPLC [min or %B]) MS2 score: 69.89
21127740VTAAPQSVCALR636.84 (observed)21.77E+0615.14 (HPLC [min or %B]) MS2 score: 64.64
21127740VTAAPQSVCALR636.84 (observed)22.84E+0722.11 (HPLC [min or %B]) MS2 score: 43.9
21127740VTAAPQSVCALR636.84 (observed)22.27E+0515.05 (HPLC [min or %B]) MS2 score: 67.56
21127740VTAAPQSVCALR636.84 (observed)25.30E+0515.26 (HPLC [min or %B]) MS2 score: 40.37
21127740VTAAPQSVCALR636.84 (observed)21.56E+0622.56 (HPLC [min or %B]) MS2 score: 35.88
21127740VTAAPQSVCALR636.84 (observed)26.40E+0518.68 (HPLC [min or %B]) MS2 score: 45
21127740VTAAPQSVCALR636.84 (observed)21.21E+0510.41 (HPLC [min or %B]) MS2 score: 30.37
21127740VTAAPQSVCALR636.84 (observed)21.77E+0512.98 (HPLC [min or %B]) MS2 score: 32.01
21127740VTAAPQSVCALR636.84 (observed)24.00E+0514.04 (HPLC [min or %B]) MS2 score: 27.56
21127740VTAAPQSVCALR636.84 (observed)25.77E+0515.07 (HPLC [min or %B]) MS2 score: 37.33
21127740VTAAPQSVCALR636.84 (observed)22.37E+0516.62 (HPLC [min or %B]) MS2 score: 25.83
21127740VTAAPQSVCALR636.84 (observed)26.70E+0517.67 (HPLC [min or %B]) MS2 score: 43.2
21127740VTAAPQSVCALR636.84 (observed)27.27E+0618.69 (HPLC [min or %B]) MS2 score: 64.24
21127740VTAAPQSVCALR636.84 (observed)22.21E+0515.02 (HPLC [min or %B]) MS2 score: 34.61
21127740VTAAPQSVCALR636.84 (observed)22.08E+0516.04 (HPLC [min or %B]) MS2 score: 31.75
21127740VTAAPQSVCALR636.84 (observed)23.81E+0519.58 (HPLC [min or %B]) MS2 score: 55.37
21127740VTAAPQSVCALR636.84 (observed)23.68E+0519.52 (HPLC [min or %B]) MS2 score: 49.64
21127740VTAAPQSVCALR636.84 (observed)27.32E+0519.35 (HPLC [min or %B]) MS2 score: 28.75
21127740VTAAPQSVCALR636.84 (observed)22.91E+0519.04 (HPLC [min or %B]) MS2 score: 37.76
21127740VTGEGCVYLQTSLK777.9 (observed)23.39E+0524.02 (HPLC [min or %B]) MS2 score: 26.78
21127740VTGEGCVYLQTSLK777.89 (observed)26.28E+0523.4 (HPLC [min or %B]) MS2 score: 63
21127740VTGEGCVYLQTSLK777.89 (observed)23.33E+0624.36 (HPLC [min or %B]) MS2 score: 87.94
21127740VTGEGCVYLQTSLK777.9 (observed)26.88E+0548.73 (HPLC [min or %B]) MS2 score: 73.77
21127740VTGEGCVYLQTSLK777.9 (observed)22.45E+0620.55 (HPLC [min or %B]) MS2 score: 66.98
21127740VTGEGCVYLQTSLK777.9 (observed)28.26E+0520.81 (HPLC [min or %B]) MS2 score: 53.04
21127740YDVENCLANK613.28 (observed)22.73E+0616.11 (HPLC [min or %B]) MS2 score: 57.18
21127740YDVENCLANK613.28 (observed)21.65E+0723.02 (HPLC [min or %B]) MS2 score: 47.63
21127740YDVENCLANK613.28 (observed)22.87E+0516.11 (HPLC [min or %B]) MS2 score: 45.47
21127740YDVENCLANK613.28 (observed)21.93E+0515.2 (HPLC [min or %B]) MS2 score: 25.56
21127740YDVENCLANK613.28 (observed)21.37E+0515.65 (HPLC [min or %B]) MS2 score: 25.58
21127740YGAATFTR443.72 (observed)28.64E+0512.71 (HPLC [min or %B]) MS2 score: 41.67
21127740YGAATFTR443.72 (observed)25.24E+0512.7 (HPLC [min or %B]) MS2 score: 37.2
21127740YGAATFTR443.72 (observed)22.35E+0620.6 (HPLC [min or %B]) MS2 score: 42.86
21127740YNILPEK438.75 (observed)21.85E+0617.24 (HPLC [min or %B]) MS2 score: 28.53
21127740YNILPEK438.74 (observed)26.04E+0625.01 (HPLC [min or %B]) MS2 score: 35.74
21127740YNILPEK438.75 (observed)21.85E+0617.24 (HPLC [min or %B]) MS2 score: 28.53
21127740YNILPEK438.74 (observed)26.04E+0625.01 (HPLC [min or %B]) MS2 score: 35.74
21127740AAQVTIQSSGTFSSK756.39 (observed)22.05E+0513.65 (HPLC [min or %B]) MS2 score: 68.05
21127740AAQVTIQSSGTFSSK756.39 (observed)22.25E+0519.7 (HPLC [min or %B]) MS2 score: 80.55
21127740AGAFCLSEDAGLGISSTASLR695.01 (observed)34.21E+0548.67 (HPLC [min or %B]) MS2 score: 40.56
21127740AIGYLNTGYQR628.32 (observed)23.81E+0520.64 (HPLC [min or %B]) MS2 score: 29.66
21127740AIGYLNTGYQR628.32 (observed)23.13E+0621.67 (HPLC [min or %B]) MS2 score: 46.42
21127740AIGYLNTGYQR628.32 (observed)22.19E+0522.02 (HPLC [min or %B]) MS2 score: 35.59
21127740AIGYLNTGYQR628.32 (observed)24.06E+0626.79 (HPLC [min or %B]) MS2 score: 42.58
21127740AIGYLNTGYQR628.32 (observed)21.58E+0522.31 (HPLC [min or %B]) MS2 score: 46.56
21127740AIGYLNTGYQR628.33 (observed)27.10E+0522.77 (HPLC [min or %B]) MS2 score: 45.15
21127740ALLAYAFALAGNQDK783.42 (observed)23.79E+0535.01 (HPLC [min or %B]) MS2 score: 72.56
21127740ALLAYAFALAGNQDK783.42 (observed)21.84E+0637.78 (HPLC [min or %B]) MS2 score: 73.28
21127740ALLAYAFALAGNQDK783.42 (observed)25.37E+0534.09 (HPLC [min or %B]) MS2 score: 59.09
21127740ATVLNYLPK509.8 (observed)21.22E+0629.99 (HPLC [min or %B]) MS2 score: 38.91
21127740ATVLNYLPK509.8 (observed)24.65E+0525.17 (HPLC [min or %B]) MS2 score: 27.02
21127740ATVLNYLPK509.8 (observed)23.25E+0529.8 (HPLC [min or %B]) MS2 score: 23.46
21127740ATVLNYLPK509.8 (observed)22.88E+0529.51 (HPLC [min or %B]) MS2 score: 25.67
21127740AYIFIDEAHITQALIWLSQR797.09 (observed)32.81E+0548.14 (HPLC [min or %B])Deamidation (NQ)MS2 score: 37.4
21127740AYIFIDEAHITQALIWLSQR796.76 (observed)34.87E+0546.38 (HPLC [min or %B]) MS2 score: 38.6
21127740AYIFIDEAHITQALIWLSQR797.09 (observed)37.70E+0550.28 (HPLC [min or %B])Deamidation (NQ)MS2 score: 47.82
21127740DLKPAIVK442.28 (observed)23.99E+0511.45 (HPLC [min or %B]) MS2 score: 22.27
21127740DLKPAIVK442.28 (observed)21.45E+0611.35 (HPLC [min or %B]) MS2 score: 27.82
21127740DLTGFPGPLNDQDNEDCINR1146.49 (observed)27.47E+0634.94 (HPLC [min or %B])2 Deamidation (NQ)MS2 score: 63.05
21127740DMYSFLEDMGLK724.82 (observed)22.74E+0539.89 (HPLC [min or %B]) MS2 score: 37.33
21127740DMYSFLEDMGLK740.82 (observed)21.88E+0629.59 (HPLC [min or %B])2 Oxidation (M)MS2 score: 60.66
21127740DMYSFLEDMGLK724.82 (observed)22.74E+0539.89 (HPLC [min or %B]) MS2 score: 37.33
21127740DMYSFLEDMGLK740.82 (observed)21.88E+0629.59 (HPLC [min or %B])2 Oxidation (M)MS2 score: 60.66
21127740DTVIKPLLVEPEGLEK594.01 (observed)31.65E+0629.27 (HPLC [min or %B]) MS2 score: 41.9
21127740DTVIKPLLVEPEGLEK594.01 (observed)32.49E+0526.64 (HPLC [min or %B]) MS2 score: 32.74
21127740DTVIKPLLVEPEGLEK594.01 (observed)37.86E+0526.51 (HPLC [min or %B]) MS2 score: 17.79
21127740DTVIKPLLVEPEGLEK594.01 (observed)34.37E+0526.53 (HPLC [min or %B]) MS2 score: 46.31
21127740DTVIKPLLVEPEGLEK594.01 (observed)33.80E+0526.44 (HPLC [min or %B]) MS2 score: 25.31
21127740ETTFNSLLCPSGGEVSEELSLK1199.58 (observed)23.90E+0635.79 (HPLC [min or %B])Deamidation (NQ)MS2 score: 80.53
21127740FEVQVTVPK523.8 (observed)25.32E+0522.13 (HPLC [min or %B]) MS2 score: 44.53
21127740FEVQVTVPK523.8 (observed)23.93E+0625.81 (HPLC [min or %B]) MS2 score: 30.66
21127740FEVQVTVPK523.8 (observed)22.05E+0521.53 (HPLC [min or %B]) MS2 score: 28.56
21127740FEVQVTVPK523.8 (observed)21.63E+0624.68 (HPLC [min or %B]) MS2 score: 31.27
21127740FEVQVTVPK523.8 (observed)22.27E+0624.67 (HPLC [min or %B]) MS2 score: 30.09
21127740FEVQVTVPK523.8 (observed)21.66E+0521.41 (HPLC [min or %B]) MS2 score: 41.4
21127740FEVQVTVPK523.8 (observed)23.55E+0521.78 (HPLC [min or %B]) MS2 score: 31.05
21127740FEVQVTVPK523.8 (observed)29.17E+0425.32 (HPLC [min or %B]) MS2 score: 30.18
21127740FEVQVTVPK523.8 (observed)21.46E+0521.13 (HPLC [min or %B]) MS2 score: 26.88
21127740GEAFTLK383.21 (observed)21.13E+0615.14 (HPLC [min or %B]) MS2 score: 25.61
21127740GEAFTLK383.21 (observed)23.34E+0619.33 (HPLC [min or %B]) MS2 score: 25.52
21127740GEAFTLK383.21 (observed)21.13E+0615.14 (HPLC [min or %B]) MS2 score: 25.61
21127740GEAFTLK383.21 (observed)23.34E+0619.33 (HPLC [min or %B]) MS2 score: 25.52
21127740GHFSISIPVK542.81 (observed)21.51E+0630.37 (HPLC [min or %B]) MS2 score: 26.14
21127740GHFSISIPVK362.21 (observed)31.39E+0630.45 (HPLC [min or %B]) MS2 score: 25.2
21127740GHFSISIPVK362.21 (observed)31.65E+0522.38 (HPLC [min or %B]) MS2 score: 30.41
21127740GHFSISIPVK362.21 (observed)32.02E+0626.39 (HPLC [min or %B]) MS2 score: 24.51
21127740GHFSISIPVK542.81 (observed)21.79E+0626.4 (HPLC [min or %B]) MS2 score: 29.55
21127740GHFSISIPVK362.21 (observed)32.93E+0525.64 (HPLC [min or %B]) MS2 score: 27.17
21127740GHFSISIPVK542.81 (observed)25.61E+0526.73 (HPLC [min or %B]) MS2 score: 27.87
21127740GHFSISIPVK362.21 (observed)36.23E+0426.01 (HPLC [min or %B]) MS2 score: 29.49
21127740GHFSISIPVK362.21 (observed)38.14E+0422.21 (HPLC [min or %B]) MS2 score: 26.79
21127740HNVYINGITYTPVSSTNEK1070.02 (observed)21.12E+0623.75 (HPLC [min or %B])2 Deamidation (NQ)MS2 score: 68.47
21127740HNVYINGITYTPVSSTNEK1070.02 (observed)21.12E+0623.75 (HPLC [min or %B])2 Deamidation (NQ)MS2 score: 68.47
21127740HYDGSYSTFGER709.8 (observed)22.04E+0515.89 (HPLC [min or %B]) MS2 score: 21.28
21127740IAQWQSFQLEGGLK802.93 (observed)27.37E+0528.86 (HPLC [min or %B]) MS2 score: 51.67
21127740IAQWQSFQLEGGLK802.93 (observed)23.92E+0633.2 (HPLC [min or %B]) MS2 score: 56.87
21127740IAQWQSFQLEGGLK802.93 (observed)29.57E+0533.04 (HPLC [min or %B]) MS2 score: 50.65
21127740IAQWQSFQLEGGLK802.92 (observed)23.35E+0529.39 (HPLC [min or %B]) MS2 score: 55.16
21127740IAQWQSFQLEGGLK802.92 (observed)21.71E+0632.17 (HPLC [min or %B]) MS2 score: 48.25
21127740IAQWQSFQLEGGLK802.93 (observed)24.77E+0528.73 (HPLC [min or %B]) MS2 score: 48.99
UNPUBLISHED_1K.AIGYLNTGYQR.Q    MS2 score: 13   
UNPUBLISHED_1K.EVLKSLNEEAVK.K    MS2 score: 12   
UNPUBLISHED_1K.FQVDNNNR.L    MS2 score: 2   
UNPUBLISHED_1K.HYDGSYSTFGER.Y    MS2 score: 4   
UNPUBLISHED_1K.SDIAPVAR.L    MS2 score: 28   
UNPUBLISHED_1K.YDVENCLANK.V    MS2 score: 0   
UNPUBLISHED_1K.YGAATFTR.T    MS2 score: 21   
21127740KDTVIKPLLVEPEGLEK636.71 (observed)31.22E+0622.74 (HPLC [min or %B]) MS2 score: 26.4
21127740LHTEAQIQEEGTVVELTGR704.36 (observed)31.92E+0625.13 (HPLC [min or %B])Deamidation (NQ)MS2 score: 42.35
21127740LHTEAQIQEEGTVVELTGR704.03 (observed)37.63E+0548.62 (HPLC [min or %B]) MS2 score: 31.56
21127740LHTEAQIQEEGTVVELTGR704.03 (observed)31.09E+0722.11 (HPLC [min or %B]) MS2 score: 84.74
21127740LLIYAVLPTGDVIGDSAK615.68 (observed)31.57E+0535.01 (HPLC [min or %B]) MS2 score: 24.05
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)23.99E+0534.59 (HPLC [min or %B]) MS2 score: 22.35
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)23.39E+0534.7 (HPLC [min or %B]) MS2 score: 41.14
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)21.15E+0635.08 (HPLC [min or %B]) MS2 score: 58.13
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)21.01E+0537.87 (HPLC [min or %B]) MS2 score: 29.95
21127740LLIYAVLPTGDVIGDSAK923.02 (observed)23.99E+0638.69 (HPLC [min or %B]) MS2 score: 57.17
21127740LLLQQVSLPELPGEYSMK687.7 (observed)36.49E+0533.88 (HPLC [min or %B])Oxidation (M)MS2 score: 28.48
21127740LLLQQVSLPELPGEYSMK1031.05 (observed)23.48E+0537.41 (HPLC [min or %B])Oxidation (M)MS2 score: 47
21127740LLLQQVSLPELPGEYSMK1031.05 (observed)26.88E+0533.8 (HPLC [min or %B])Oxidation (M)MS2 score: 43.12
21127740LLLQQVSLPELPGEYSMK1023.55 (observed)25.76E+0538.46 (HPLC [min or %B])Deamidation (NQ)MS2 score: 27.32
21127740LPPNVVEESAR605.82 (observed)21.16E+0617.59 (HPLC [min or %B]) MS2 score: 63.24
21127740LPPNVVEESAR605.82 (observed)26.99E+0618.6 (HPLC [min or %B]) MS2 score: 63.85
21127740LPPNVVEESAR605.83 (observed)23.80E+0514.87 (HPLC [min or %B]) MS2 score: 24.79
21127740LPPNVVEESAR605.82 (observed)22.60E+0522.81 (HPLC [min or %B]) MS2 score: 57.98
21127740LPPNVVEESAR605.83 (observed)27.76E+0519.25 (HPLC [min or %B]) MS2 score: 45.22
21127740LPYSVVR417.25 (observed)21.24E+0620.95 (HPLC [min or %B]) MS2 score: 31.34
21127740LPYSVVR417.25 (observed)21.31E+0616.52 (HPLC [min or %B]) MS2 score: 34.55
21127740LPYSVVR417.25 (observed)21.74E+0516.11 (HPLC [min or %B]) MS2 score: 22.46
21127740LPYSVVR417.25 (observed)21.72E+0620.4 (HPLC [min or %B]) MS2 score: 31.41
21127740LPYSVVR417.25 (observed)22.66E+0618.95 (HPLC [min or %B]) MS2 score: 22.84
21127740LSFYYLIMAK632.83 (observed)28.60E+0432.68 (HPLC [min or %B])Oxidation (M)MS2 score: 33.72
21127740LSFYYLIMAK624.84 (observed)21.46E+0535.95 (HPLC [min or %B]) MS2 score: 36.88
21127740LSFYYLIMAK632.84 (observed)23.04E+0532.84 (HPLC [min or %B])Oxidation (M)MS2 score: 59.7
21127740LSFYYLIMAK632.84 (observed)29.81E+0437.42 (HPLC [min or %B])Oxidation (M)MS2 score: 32.79
21127740LSFYYLIMAK632.83 (observed)25.39E+0536.21 (HPLC [min or %B])Oxidation (M)MS2 score: 36.72
21127740MVSGFIPLKPTVK716.92 (observed)21.18E+0621.42 (HPLC [min or %B])Oxidation (M)MS2 score: 42.81
21127740MVSGFIPLKPTVK716.91 (observed)25.91E+0521.34 (HPLC [min or %B])Oxidation (M)MS2 score: 40.72
21127740MVSGFIPLKPTVK716.91 (observed)21.72E+0624.75 (HPLC [min or %B])Oxidation (M)MS2 score: 60.72
21127740NALFCLESAWK669.83 (observed)29.48E+0532.48 (HPLC [min or %B]) MS2 score: 35.65
21127740NALFCLESAWK669.83 (observed)25.49E+0635.83 (HPLC [min or %B]) MS2 score: 46.98
21127740NALFCLESAWK670.32 (observed)29.77E+0539.81 (HPLC [min or %B])Deamidation (NQ)MS2 score: 32.72
21127740NALFCLESAWK669.83 (observed)29.46E+0533.35 (HPLC [min or %B]) MS2 score: 30.5
21127740NEDSLVFVQTDK697.84 (observed)21.74E+0625.63 (HPLC [min or %B]) MS2 score: 41.95
21127740NEDSLVFVQTDK697.84 (observed)22.51E+0624.37 (HPLC [min or %B]) MS2 score: 69.81
21127740NEDSLVFVQTDK697.84 (observed)22.24E+0624.44 (HPLC [min or %B]) MS2 score: 61.47
21127740NEDSLVFVQTDK697.84 (observed)23.35E+0525.82 (HPLC [min or %B]) MS2 score: 63.3
21127740NEDSLVFVQTDK697.84 (observed)22.78E+0629.98 (HPLC [min or %B]) MS2 score: 82.52
21127740NQGNTWLTAFVLK746.4 (observed)26.16E+0536.85 (HPLC [min or %B]) MS2 score: 61.09
21127740NQGNTWLTAFVLK746.4 (observed)26.48E+0540.37 (HPLC [min or %B]) MS2 score: 56.37
21127740NQGNTWLTAFVLK746.4 (observed)23.47E+0536.06 (HPLC [min or %B]) MS2 score: 45.2
21127740NQGNTWLTAFVLK746.4 (observed)22.32E+0535.78 (HPLC [min or %B]) MS2 score: 45.29
21127740QFSFPLSSEPFQGSYK924.94 (observed)27.39E+0540.08 (HPLC [min or %B]) MS2 score: 29.9
21127740QFSFPLSSEPFQGSYK924.94 (observed)24.18E+0531.22 (HPLC [min or %B]) MS2 score: 39.11
21127740QGIPFFGQVR574.81 (observed)23.96E+0632.74 (HPLC [min or %B]) MS2 score: 30.9
21127740QGIPFFGQVR566.3 (observed)22.50E+0639.1 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 54.52
21127740QGIPFFGQVR566.3 (observed)22.77E+0534.83 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 26.76
21127740QQNAQGGFSSTQDTVVALHALSK796.73 (observed)31.69E+0728.33 (HPLC [min or %B])Deamidation (NQ)MS2 score: 55.37
21127740QTVSWAVTPK558.8 (observed)23.56E+0627.12 (HPLC [min or %B]) MS2 score: 39.2
UNPUBLISHED_1R.NQGNTWLTAFVLK.T    MS2 score: 24   
UNPUBLISHED_1R.NQGNTWLTAFVLK.T    MS2 score: 21   
UNPUBLISHED_1R.QSSEITRTITK.L    MS2 score: 2   
UNPUBLISHED_1R.QTVSWAVTPK.S    MS2 score: 2   
UNPUBLISHED_1R.TEHPFTVEEFVLPK.F    MS2 score: 1   
UNPUBLISHED_1R.VGFYESDVMGR.G    MS2 score: 5   
21127740SASNMAIVDVK575.79 (observed)21.07E+0611.98 (HPLC [min or %B])Oxidation (M)MS2 score: 45.09
21127740SLFTDLEAENDVLHCVAFAVPK826.08 (observed)31.30E+0747.28 (HPLC [min or %B])Deamidation (NQ)MS2 score: 62.72
21127740SSGSLLNNAIK552.31 (observed)22.63E+0517.68 (HPLC [min or %B]) MS2 score: 27.33
21127740SSGSLLNNAIK552.3 (observed)25.39E+0626.78 (HPLC [min or %B]) MS2 score: 37.46
21127740SSGSLLNNAIK552.3 (observed)22.65E+0621.42 (HPLC [min or %B]) MS2 score: 39.24
21127740SSGSLLNNAIK552.3 (observed)21.02E+0516.69 (HPLC [min or %B]) MS2 score: 27.19
21127740SSSNEEVMFLTVQVK857.42 (observed)21.89E+0625.74 (HPLC [min or %B])Oxidation (M)MS2 score: 60.56
21127740SSSNEEVMFLTVQVK857.42 (observed)23.92E+0629.34 (HPLC [min or %B])Oxidation (M)MS2 score: 57.66
21127740TEHPFTVEEFVLPK836.93 (observed)23.06E+0632.5 (HPLC [min or %B]) MS2 score: 49.47
21127740TEHPFTVEEFVLPK558.29 (observed)34.27E+0529.18 (HPLC [min or %B]) MS2 score: 40
21127740TEHPFTVEEFVLPK558.29 (observed)31.02E+0629.26 (HPLC [min or %B]) MS2 score: 41.76
21127740TEHPFTVEEFVLPK558.29 (observed)37.20E+0533.36 (HPLC [min or %B]) MS2 score: 51.69
21127740TEHPFTVEEFVLPK558.29 (observed)33.93E+0637.87 (HPLC [min or %B]) MS2 score: 42
21127740TEHPFTVEEFVLPK558.29 (observed)32.98E+0529.28 (HPLC [min or %B]) MS2 score: 32.8
21127740TEVSSNHVLIYLDK809.43 (observed)23.76E+0522.44 (HPLC [min or %B]) MS2 score: 50.97
21127740TEVSSNHVLIYLDK809.43 (observed)21.13E+0630.75 (HPLC [min or %B]) MS2 score: 55.69
21127740TEVSSNHVLIYLDK809.43 (observed)21.27E+0522.32 (HPLC [min or %B]) MS2 score: 40.24
21127740TEVSSNHVLIYLDK809.42 (observed)22.59E+0625.65 (HPLC [min or %B]) MS2 score: 70.23
21127740TGTHGLLVK463.28 (observed)21.18E+0610.33 (HPLC [min or %B]) MS2 score: 25.84
21127740VDLSFSPSQSLPASHAHLR684.02 (observed)37.17E+0529.32 (HPLC [min or %B])Deamidation (NQ)MS2 score: 47.92
21127740VDLSFSPSQSLPASHAHLR684.02 (observed)32.01E+0624.73 (HPLC [min or %B])Deamidation (NQ)MS2 score: 45.93
21127740VGFYESDVMGR638.29 (observed)24.29E+0517.39 (HPLC [min or %B])Oxidation (M)MS2 score: 36.07
21127740VGFYESDVMGR638.29 (observed)23.87E+0519.61 (HPLC [min or %B])Oxidation (M)MS2 score: 33.14
21127740VSVQLEASPAFLAVPVEK942.53 (observed)21.86E+0531.74 (HPLC [min or %B]) MS2 score: 30.08
21127740VSVQLEASPAFLAVPVEK942.53 (observed)27.69E+0531.47 (HPLC [min or %B]) MS2 score: 48.92
21127740VSVQLEASPAFLAVPVEK942.53 (observed)24.27E+0531.62 (HPLC [min or %B]) MS2 score: 28.02
21127740VSVQLEASPAFLAVPVEK942.53 (observed)28.37E+0531.91 (HPLC [min or %B]) MS2 score: 46.73
21127740VSVQLEASPAFLAVPVEK942.53 (observed)28.06E+0535.5 (HPLC [min or %B]) MS2 score: 77.6
21127740VSVQLEASPAFLAVPVEK942.53 (observed)21.81E+0531.92 (HPLC [min or %B]) MS2 score: 39.33
21127740VTAAPQSVCALR636.84 (observed)21.52E+0515.71 (HPLC [min or %B]) MS2 score: 29.6
21127740VTAAPQSVCALR636.84 (observed)23.16E+0522.8 (HPLC [min or %B]) MS2 score: 54.19
21127740VTGEGCVYLQTSLK777.9 (observed)22.47E+0520.83 (HPLC [min or %B]) MS2 score: 61.73
21127740VVSMDENFHPLNELIPLVYIQDPK943.15 (observed)32.41E+0640.44 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 70.4
21127740VYDYYETDEFAIAEYNAPCSK1275.04 (observed)25.72E+0532.54 (HPLC [min or %B])Deamidation (NQ)MS2 score: 48.04
21127740YDVENCLANK613.28 (observed)25.13E+0518.05 (HPLC [min or %B]) MS2 score: 34.4
21127740YDVENCLANK613.28 (observed)22.80E+0619.06 (HPLC [min or %B]) MS2 score: 58.96
21127740YDVENCLANK613.28 (observed)28.69E+0416.21 (HPLC [min or %B]) MS2 score: 31.68
21127740YNILPEK438.74 (observed)25.96E+0525.73 (HPLC [min or %B]) MS2 score: 26.15
21127740YNILPEK438.74 (observed)25.96E+0525.73 (HPLC [min or %B]) MS2 score: 26.15
21127740YNILPEKEEFPFALGVQTLPQTCDEPK1055.52 (observed)31.44E+0637.14 (HPLC [min or %B])Deamidation (NQ)MS2 score: 59.06
21127740YSDASDCHGEDSQAFCEK702.6 (observed)34.41E+0617.25 (HPLC [min or %B]) MS2 score: 43.59
23376485LVHVEEPHTETVR515.943 (observed)   ::::::::::::::

Compile date 12-23-2014© PADB initiative