PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A0460ABL2, ABLL, ARGTyrosine-protein kinase ABL2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)KAAPGPMPSSGKPGRPVMPPPQVPLPTSSISPAK(M)      peptide count: 1
18614015(K)VPVLISPTLK(H)      peptide count: 2
18614015(R)ANDMLPKKSEEGAAPARERPK(A)      peptide count: 1
18614015(R)DLAARNCLVGENHVVK(V)      peptide count: 1

Compile date 12-23-2014© PADB initiative