PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A0429ACO2Aconitate hydratase, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836EHAALEPR0.1 (delta mass [ppm])2    
16948836EHAALEPR1 (delta mass [ppm])2    
18501002KDINQEVYNFLATAGAKY 1    
18501002KEGWPLDIRV 2    
18501002KFKLEAPDADELPRS 2    
18501002KFKLEAPDADELPRS 3    
18501002KFNPETDFLTGKDGKK 2    
18501002KFNPETDFLTGKDGKKF 2    
18501002KIVYGHLDDPANQEIERG 2    
18501002KIVYGHLDDPANQEIERG 3    
18501002KKFKLEAPDADELPRS 3    
18501002KKQGLLPLTFADPSDYNKI 3    
18501002KKQGLLPLTFADPSDYNKI 2    
18501002KKQGLLPLTFADPSDYNKIHPVDKL 3    
18501002KQGLLPLTFADPSDYNKI 2    
18501002KSQFTITPGSEQIRA 2    
18501002KTYLRLRPDRVAMQDATAQMAMLQFISSGLPKV 3    
18501002KVAM*SHFEPSEYIRY 2    
18501002KVAM*SHFEPSEYIRY 3    
18501002KVAMSHFEPSEYIRY 3    
18501002KVAMSHFEPSEYIRY 2    
18501002RAKDINQEVYNFLATAGAKY 2    
18501002RAKDINQEVYNFLATAGAKY 3    
18501002RDGYAQILRD 2    
18501002RDVGGIVLANACGPCIGQWDRK 2    
18501002RNAVTQEFGPVPDTARY 2    
18501002RNDANPETHAFVTSPEIVTALAIAGTLKF 3    
18501002RNDANPETHAFVTSPEIVTALAIAGTLKF 2    
18501002RSDFDPGQDTYQHPPKDSSGQRV 3    
18501002RVAM*QDATAQM*AM*LQFISSGLPKV 2    
18501002RVAM*QDATAQMAM*LQFISSGLPKV 2    
18501002RVAMQDATAQM*AMLQFISSGLPKV 2    
18501002RVAMQDATAQMAM*LQFISSGLPKV 3    
18501002RVAMQDATAQMAM*LQFISSGLPKV 2    
18501002RVAMQDATAQMAMLQFISSGLPKV 3    
18501002RVAMQDATAQMAMLQFISSGLPKV 2    
18501002RVGLIGSCTNSSYEDMGRS 2    
18501002RWVVIGDENYGEGSSRE 2    
18501002RWVVIGDENYGEGSSREHAALEPRH 3    
16684767RDLGGIVLANACGPCIGQWDRK 2    
16684767RLNRPLTLSEKI 2    
18361515K.DINQEVYNFLATAGAK.Y877.65 (observed)2    
18361515K.DINQEVYNFLATAGAK.Y877.65 (observed)2    
18361515K.FKLEAPDADELPR.S750.66 (observed)2    
18361515K.KQGLLPLTFADPADYNK.I945.98 (observed)2    
18361515K.KQGLLPLTFADPADYNK.I945.98 (observed)2    
18361515R.NDANPETHAFVTSPEIVTALAIAGTLK.F1391.44 (observed)2    
18361515R.NDANPETHAFVTSPEIVTALAIAGTLK.F927.72 (observed)3    
18361515R.NDANPETHAFVTSPEIVTALAIAGTLK.F1391.44 (observed)2    
18361515R.NDANPETHAFVTSPEIVTALAIAGTLK.F927.72 (observed)3    
18361515R.VGLIGSCTNSSYEDMGR.S924.2 (observed)2    
18361515R.WVVIGDENYGEGSSR.E833.88 (observed)2    
18361515R.WVVIGDENYGEGSSR.E833.88 (observed)2    
18614015(K)ANSVRNAVTQEFGPVPDTAR(Y)      peptide count: 1
18614015(K)ANSVRNAVTQEFGPVPDTAR(Y)      peptide count: 6
18614015(K)CTTDHISAAGPWLK(F)      peptide count: 65
18614015(K)DFAPGKPLK(C)      peptide count: 150
18614015(K)DINQEVYNFLATAGAK(Y)      peptide count: 354
18614015(K)DLEDLQILIK(V)      peptide count: 125
18614015(K)EGWPLDIR(V)      peptide count: 59
18614015(K)FKLEAPDADELPR(S)      peptide count: 185
18614015(K)FNPETDFLTGK(D)      peptide count: 63
18614015(K)FNPETDFLTGKDGK(K)      peptide count: 8
18614015(K)FNPETDFLTGKDGKK(F)      peptide count: 10
18614015(K)GEKNTIVTSYNR(N)      peptide count: 3
18614015(K)GKCTTDHISAAGPWLK(F)      peptide count: 3
18614015(K)HPNGTQETILLNHTFNETQIEWFR(A)      peptide count: 77
18614015(K)HPNGTQETILLNHTFNETQIEWFR(A)      peptide count: 317
18614015(K)IHPVDK(L)      peptide count: 129
18614015(K)IHPVDKLTIQGLK(D)      peptide count: 41
18614015(K)IHPVDKLTIQGLKDFAPGKPLK(C)      peptide count: 10
18614015(K)IVYGHLDDPANQEIER(G)      peptide count: 275
18614015(K)KFKLEAPDADELPR(S)      peptide count: 7
18614015(K)KGEKNTIVTSYNR(N)      peptide count: 22
18614015(K)KQGLLPLTFADPSDYNK(I)      peptide count: 24
18614015(K)KYLSK(V)      peptide count: 3
18614015(K)LEAPDADELPR(S)      peptide count: 79
18614015(K)LTGSLSGWTSPK(D)      peptide count: 94
18614015(K)LTGSLSGWTSPKDVILK(V)      peptide count: 2
18614015(K)LTIQGLK(D)      peptide count: 39
18614015(K)LTIQGLK(D)      peptide count: 4
18614015(K)LTIQGLKDFAPGKPLK(C)      peptide count: 42
18614015(K)NINIVR(K)      peptide count: 204
18614015(K)NTIVTSYNR(N)      peptide count: 192
18614015(K)NTIVTSYNRNFTGR(N)      peptide count: 8
18614015(K)QALAHGLK(C)      peptide count: 169
18614015(K)QGLLPLTFADPSDYNK(I)      peptide count: 210
18614015(K)QGLLPLTFADPSDYNKIHPVDK(L)      peptide count: 11
18614015(K)RLNRPLTLSEK(I)      peptide count: 51
18614015(K)SQFTITPGSEQIR(A)      peptide count: 106
18614015(K)VAGILTVK(G)      peptide count: 70
18614015(K)VAMSHFEPSEYIR(Y)      peptide count: 192
18614015(K)VAMSHFEPSEYIRYDLLEK(N)      peptide count: 1
18614015(K)VAVPSTIHCDHLIEAQVGGEK(D)      peptide count: 174
18614015(K)VAVPSTIHCDHLIEAQVGGEKDLR(R)      peptide count: 2
18614015(K)WDGKDLEDLQILIK(V)      peptide count: 42
18614015(K)YLSKTGR(T)      peptide count: 6
18614015(R)AGSALNR(M)      peptide count: 32
18614015(R)AIITKSFAR(I)      peptide count: 3
18614015(R)AKDINQEVYNFLATAGAK(Y)      peptide count: 181
18614015(R)ATIERDGYAQILR(D)      peptide count: 19
18614015(R)DGYAQILR(D)      peptide count: 156
18614015(R)DVGGIVLANACGPCIGQWDR(K)      peptide count: 105
18614015(R)DVGGIVLANACGPCIGQWDRK(D)      peptide count: 13
18614015(R)EHAALEPR(H)      peptide count: 290
18614015(R)GHLDNISNNLLIGAINIENGK(A)      peptide count: 706
18614015(R)GHLDNISNNLLIGAINIENGK(A)      peptide count: 95
18614015(R)GHLDNISNNLLIGAINIENGKANSVR(N)      peptide count: 23
18614015(R)GHLDNISNNLLIGAINIENGKANSVR(N)      peptide count: 38
18614015(R)GKTYLR(L)      peptide count: 18
18614015(R)IHETNLK(K)      peptide count: 182
18614015(R)IHETNLKK(Q)      peptide count: 202
18614015(R)KRLNRPLTLSEK(I)      peptide count: 1
18614015(R)KYLSK(L)      peptide count: 2
18614015(R)LNRPLTLSEK(I)      peptide count: 255
18614015(R)LQLLEPFDK(W)      peptide count: 44
18614015(R)LQLLEPFDKWDGK(D)      peptide count: 84
18614015(R)LQLLEPFDKWDGKDLEDLQILIK(V)      peptide count: 243
18614015(R)LQLLEPFDKWDGKDLEDLQILIKVK(G)      peptide count: 1
18614015(R)LRPDR(V)      peptide count: 14
18614015(R)NAVTQEFGPVPDTAR(Y)      peptide count: 232
18614015(R)NDANPETHAFVTSPEIVTALAIAGTLK(F)      peptide count: 244
18614015(R)NDANPETHAFVTSPEIVTALAIAGTLK(F)      peptide count: 88
18614015(R)NFTGRNDANPETHAFVTSPEIVTALAIAGTLK(F)      peptide count: 11
18614015(R)NFTGRNDANPETHAFVTSPEIVTALAIAGTLK(F)      peptide count: 11
18614015(R)SAAVAKQALAHGLK(C)      peptide count: 1
18614015(R)SDFDPGQDTYQHPPK(D)      peptide count: 190
18614015(R)SDFDPGQDTYQHPPKDSSGQR(V)      peptide count: 33
18614015(R)SDFDPGQDTYQHPPKDSSGQRVDVSPTSQR(L)      peptide count: 1
18614015(R)TDIANLAEEFK(D)      peptide count: 41
18614015(R)VAMQDATAQMAMLQFISSGLPK(V)      peptide count: 146
18614015(R)VAMQDATAQMAMLQFISSGLPK(V)      peptide count: 26
18614015(R)VDVSPTSQR(L)      peptide count: 303
18614015(R)VGLIGSCTNSSYEDMGR(S)      peptide count: 117
18614015(R)WVVIGDENYGEGSSR(E)      peptide count: 267
18614015(R)WVVIGDENYGEGSSREHAALEPR(H)      peptide count: 1
18614015(R)YDLLEK(N)      peptide count: 71
18614015(R)YDLLEKNINIVR(K)      peptide count: 2
15253431CTTDHISAAGPWLK 3   Pept_E (Sonar search): 2.90E-04 
15253431DGYAQILR 2   Pept_E (Sonar search): 1.60E-02 
15253431DINQEVYNFLATAGAK 2   Pept_E (Sonar search): 1.30E-03 
15253431DINQEVYNFLATAGAK 3   Pept_E (Sonar search): 3.00E-03 
15253431DLEDLQILIK 2   Pept_E (Sonar search): 8.00E-02 
15253431DLGGIVLANACGPCIGQWDR 2   Pept_E (Sonar search): 7.00E-02 
15253431DLGGIVLANACGPCIGQWDR 3   Pept_E (Sonar search): 1.10E-02 
15253431DSSGQHVDVSPTSQR 2   Pept_E (Sonar search): 6.50E-07 
15253431DSSGQHVDVSPTSQR 3   Pept_E (Sonar search): 3.10E-06 
15253431EDIANLADEFK 2   Pept_E (Sonar search): 1.30E-03 
15253431EGWPLDIR 2   Pept_E (Sonar search): 1.30E-01 
15253431EHAALEPRHLGGRAIITK 2    
15253431FNPETDYLTGTDGK 2   Pept_E (Sonar search): 3.30E-03 
15253431FNPETDYLTGTDGKK 3   Pept_E (Sonar search): 9.00E-02 
15253431GHLDNISNNLLIGAINIENGK 3   Pept_E (Sonar search): 1.70E-05 
15253431HPNGTQETILLNHTFNETQIEWFR 3    
15253431IVYGHLDDPASQEIER 2   Pept_E (Sonar search): 2.80E-03 
15253431IVYGHLDDPASQEIER 3   Pept_E (Sonar search): 5.20E-05 
15253431KQGLLPLTFADPADYNK 3   Pept_E (Sonar search): 4.50E-03 
15253431LEAPDADELPK 2   Pept_E (Sonar search): 2.70E-02 
15253431LEAPDADELPKGEFDPGQDTYQHPPK 3   Pept_E (Sonar search): 1.90E-01 
15253431LQLLEPFDK 2   Pept_E (Sonar search): 3.00E-01 
15253431LTGSLSGWSSPK 2   Pept_E (Sonar search): 4.70E-03 
15253431NAVTQEFGPVPDTAR 2   Pept_E (Sonar search): 9.70E-04 
15253431NAVTQEFGPVPDTAR 3   Pept_E (Sonar search): 1.80E-04 
15253431NDANPETHAFVTSPEIVTALAIAGTLK 3   Pept_E (Sonar search): 2.90E-05 
15253431NDANPETHAFVTSPEIVTALAIAGTLK 3   Pept_E (Sonar search): 3.00E-04 
15253431NDANPETHAFVTSPEIVTALAIAGTLK 3    
15253431NTIVTSYNR 2   Pept_E (Sonar search): 3.80E-01 
15253431QGLLPLTFADPADYNK 2   Pept_E (Sonar search): 2.40E-02 
15253431QGLLPLTFADPADYNK 3   Pept_E (Sonar search): 4.30E-03 
15253431SQFTITPGSEQIR 2   Pept_E (Sonar search): 5.20E-03 
15253431SQFTITPGSEQIR 3   Pept_E (Sonar search): 1.50E-01 
15253431VAGILTVK 2   Pept_E (Sonar search): 1.10E-01 
15253431VAM*QDATAQM*AM*LQFISSGLSK 3   Pept_E (Sonar search): 8.40E-01 
15253431VAMQDATAQMAMLQFISSGLSK 3   Pept_E (Sonar search): 6.80E-04 
15253431VAVPSTIHCDHLIEAQVGGEK 3   Pept_E (Sonar search): 5.40E-03 
15253431VGLIGSCTNSSYEDM*GR 2   Pept_E (Sonar search): 1.60E-01 
15253431VGLIGSCTNSSYEDM*GR 3   Pept_E (Sonar search): 4.30E-01 
15253431VGLIGSCTNSSYEDMGR 2   Pept_E (Sonar search): 6.80E-03 
15253431VGLIGSCTNSSYEDMGR 3   Pept_E (Sonar search): 1.90E-02 
15253431WVVIGDENYGEGSSR 2   Pept_E (Sonar search): 5.20E-04 
21616181DINQEVYNFLATAGAK2042.08884 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)MS2 score: 40peptide count: 1
21616181DINQEVYNFLATAGAK2042.08792 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex) peptide count: 1
21616181NAVTQEFGPVPDTAR1745.89543 (observed)   N-Term(iTRAQ4plex)peptide count: 7
21616181NAVTQEFGPVPDTAR1745.89385 (observed)   N-Term(iTRAQ4plex)peptide count: 10
21616181QGLLPLTFADPSDYNK2067.11112 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 2
21616181SQFTITPGSEQIR1607.85112 (observed)   N-Term(iTRAQ4plex)peptide count: 9
21616181SQFTITPGSEQIR1607.85076 (observed)   N-Term(iTRAQ4plex)peptide count: 6
21616181VGLIGSCTNSSYEDMGR1978.88066 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 5
21616181VGLIGSCTNSSYEDMGR1978.87822 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 6
21616181WVVIGDENYGEGSSR1811.86821 (observed)   N-Term(iTRAQ4plex)peptide count: 15
21616181WVVIGDENYGEGSSR1811.86907 (observed)   N-Term(iTRAQ4plex)peptide count: 14
21127740AKDINQEVYNFLATAGAK651.67 (observed)31.11E+0636.04 (HPLC [min or %B]) MS2 score: 26.69
21127740DGYAQILR468.25 (observed)21.77E+0619.03 (HPLC [min or %B]) MS2 score: 43.87
21127740DGYAQILR468.25 (observed)24.71E+0527.35 (HPLC [min or %B]) MS2 score: 38.96
21127740DGYAQILR468.25 (observed)21.04E+0623.32 (HPLC [min or %B]) MS2 score: 31.74
21127740DINQEVYNFLATAGAK585.3 (observed)35.29E+0538.84 (HPLC [min or %B]) MS2 score: 33.9
21127740DINQEVYNFLATAGAK877.44 (observed)23.06E+0538.85 (HPLC [min or %B]) MS2 score: 67.29
21127740EGWPLDIR493.26 (observed)25.97E+0531.69 (HPLC [min or %B]) MS2 score: 35.89
21127740EGWPLDIR493.26 (observed)21.12E+0635.84 (HPLC [min or %B]) MS2 score: 29.04
21127740NAVTQEFGPVPDTAR801.4 (observed)22.60E+0624.95 (HPLC [min or %B]) MS2 score: 56.32
21127740NAVTQEFGPVPDTAR801.4 (observed)25.13E+0521.13 (HPLC [min or %B]) MS2 score: 74.03
21127740QGLLPLTFADPADYNK881.96 (observed)29.06E+0537.99 (HPLC [min or %B]) MS2 score: 34.13
21127740QGLLPLTFADPADYNK881.95 (observed)23.52E+0542.08 (HPLC [min or %B]) MS2 score: 43.99
21127740SQFTITPGSEQIR732.38 (observed)21.06E+0620.35 (HPLC [min or %B]) MS2 score: 41.09
21127740SQFTITPGSEQIR732.38 (observed)21.26E+0627.85 (HPLC [min or %B]) MS2 score: 41.79
21127740SQFTITPGSEQIR732.38 (observed)24.92E+0523.75 (HPLC [min or %B]) MS2 score: 32.16
21127740SQFTITPGSEQIR732.38 (observed)21.11E+0624.27 (HPLC [min or %B]) MS2 score: 45.35
18563753AJDINQEVUNFLATAGAJ4    
18563753AJDINQEVUNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ3    
18563753AJDINQEVYNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ3    
18563753AJDINQEVYNFLATAGAJ4    
18563753AJDINQEVYNFLATAGAJ3    
18563753AJDINQEVYNFLATAGAJ4    
23308193AKDINQEVYNFLATAGAK     MS2 score: 240.00peptide count: 17
18563753CTTDHISAAGPWLJ3    
18563753CTTDHISAAGPWLJ3    
18563753CTTDHISAAGPWLJ3    
18563753DFAPGJPLJCVIK3    
18563753DFAPGJPLNCIIJ3    
18563753DFAPGJPLNCIIJ3    
18563753DFAPGJPLNCIIJ3    
18563753DFAPGJPLNCIIJ3    
18563753DFAPGJPLNCIIJ3    
18563753DFAPGJPLNCIIJ3    
23308193DGYAQILR     MS2 score: 240.00peptide count: 17
18563753DGYAQILR2    
18563753DGYAQILR2    
18563753DGYAQILR2    
18563753DGYAQILR2    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ2    
18563753DINQEVYNFLATAGAJ2    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ2    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ2    
18563753DINQEVYNFLATAGAJ3    
18563753DINQEVYNFLATAGAJ3    
23308193DINQEVYNFLATAGAK     MS2 score: 240.00peptide count: 17
18563753DLEDLQILIJ3    
18563753DLEDLQILIJ3    
23308193DSSGQHVDVSPTSQR     MS2 score: 240.00peptide count: 17
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDR3    
18563753DVGGIVLANACGPCIGQWDRJ4    
18563753DVGGIVLANACGPCIGQWDRJ4    
23308193EDIANLADEFK     MS2 score: 240.00peptide count: 17
23308193EGWPLDIR     MS2 score: 240.00peptide count: 17
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753EGWPLDIR2    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR4    
18563753FJLEAPDADELPR4    
18563753FJLEAPDADELPR2    
18563753FJLEAPDADELPR2    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FJLEAPDADELPR3    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ2    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ2    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ2    
18563753FNPETDFLTGJ3    
18563753FNPETDFLTGJ2    
18563753FNPETDFLTGJDGJ3    
18563753FNPETDFLTGJDGJ3    
18563753FNPETDFLTGJDGJ3    
18563753FNPETDFLTGJDGJ3    
23308193FNPETDYLTGTDGKK     MS2 score: 240.00peptide count: 17
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJ3    
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJ3    
18563753GHLDNISNNLLIGAINIENGJ3    
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJ3    
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJ4    
18563753GHLDNISNNLLIGAINIENGJANSVR5    
23308193GHLDNISNNLLIGAINIENGK     MS2 score: 240.00peptide count: 17
18563753GJCTTDHISAAGPWLJ4    
18563753GJCTTDHISAAGPWLJ4    
18563753GJCTTDHISAAGPWLJ4    
18563753GJCTTDHISAAGPWLJ4    
18563753GJCTTDHISAAGPWLJ4    
18563753IHPVDJLTIQGLJ3    
18563753IHPVDJLTIQGLJ3    
18563753IHPVDJLTIQGLJ3    
18563753IVUGHLDDPANQEIER3    
18563753IVUGHLDDPANQEIER4    
18563753IVUGHLDDPANQEIER4    
18563753IVUGHLDDPANQEIER3    
18563753IVUGHLDDPANQEIER3    
18563753IVUGHLDDPANQEIER4    
18563753IVUGHLDDPANQEIER4    
18563753IVUGHLDDPANQEIER4    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
18563753IVYGHLDDPANQEIER3    
23308193IVYGHLDDPASQEIER     MS2 score: 240.00peptide count: 17
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ4    
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ4    
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ4    
18563753JQGLLPLTFADPSDYNJ3    
18563753JQGLLPLTFADPSDYNJ4    
18563753JQGLLPLTFADPSDYNJ3    
23308193LEAPDADELPK     MS2 score: 240.00peptide count: 17
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LEAPDADELPR2    
18563753LNRPLTLSEJ2    
18563753LNRPLTLSEJ3    
18563753LQLLEPFDJ2    
18563753LQLLEPFDJ2    
18563753LQLLEPFDJ2    
18563753LQLLEPFDJ3    
18563753LQLLEPFDJWDGJ3    
18563753LQLLEPFDJWDGJ3    
18563753LQLLEPFDJWDGJ3    
18563753LQLLEPFDJWDGJ3    
18563753LQLLEPFDJWDGJ3    
18563753LQLLEPFDJWDGJ4    
23308193LQLLEPFDK     MS2 score: 240.00peptide count: 17
23308193LTGSLSGWSSPK     MS2 score: 240.00peptide count: 17
18563753LTGTLSGWTSPJ3    
18563753LTGTLSGWTSPJDVILJ3    
18563753LTGTLSGWTSPJDVILJ4    
18563753LTIQGLJ2    
18563753LTIQGLJ2    
18563753LTIQGLJ2    
23308193NAVTQEFGPVPDTAR     MS2 score: 240.00peptide count: 17
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR2    
18563753NAVTQEFGPVPDTAR2    
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR2    
18563753NAVTQEFGPVPDTAR2    
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR3    
18563753NAVTQEFGPVPDTAR2    
18563753NAVTQEFGPVPDTAR3    
18563753NINIVR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
18563753NTIVTSYNR2    
23308193QGLLPLTFADPADYNK     MS2 score: 240.00peptide count: 17
18563753QGLLPLTFADPSDYNJ3    
18563753QGLLPLTFADPSDYNJ3    
18563753QGLLPLTFADPSDYNJ3    
18563753QGLLPLTFADPSDYNJ3    
18563753QGLLPLTFADPSDYNJ2    
18563753SDFDPGQDTUQHPPJ4    
18563753SDFDPGQDTUQHPPJ4    
18563753SDFDPGQDTUQHPPJ4    
18563753SDFDPGQDTUQHPPJDSSGQR5    
18563753SDFDPGQDTUQHPPJDSSGQR5    
18563753SDFDPGQDTUQHPPJDSSGQR5    
18563753SDFDPGQDTYQHPPJ3    
18563753SDFDPGQDTYQHPPJ3    
18563753SDFDPGQDTYQHPPJ3    
18563753SDFDPGQDTYQHPPJ3    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR3    
18563753SDFDPGQDTYQHPPJDSSGQR4    
18563753SDFDPGQDTYQHPPJDSSGQR4    
23308193SQFTITPGSEQIR     MS2 score: 240.00peptide count: 17
18563753SQFTITPGSEQIR3    
18563753SQFTITPGSEQIR3    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR3    
18563753SQFTITPGSEQIR3    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR2    
18563753SQFTITPGSEQIR3    
18563753SQFTITPGSEQIR2    
18563753VAGILTVJ2    
18563753VAGILTVJ2    
18563753VAGILTVJ2    
23308193VAMQDATAQMAMLQFISSGLSK     MS2 score: 240.00peptide count: 17
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR2    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR2    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR2    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR2    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAMSHFEPSEYIR3    
18563753VAVPSTIHCDHLIEAQLGGEJ3    
18563753VAVPSTIHCDHLIEAQLGGEJ4    
18563753VAVPSTIHCDHLIEAQLGGEJ5    
18563753VAVPSTIHCDHLIEAQLGGEJ4    
18563753VAVPSTIHCDHLIEAQLGGEJ5    
18563753VAVPSTIHCDHLIEAQLGGEJ4    
18563753VAVPSTIHCDHLIEAQLGGEJ5    
18563753VAVPSTIHCDHLIEAQLGGEJ5    
18563753VAVPSTIHCDHLIEAQLGGEJ4    
18563753VAVPSTIHCDHLIEAQLGGEJ4    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR4    
18563753VAVPSTIHCDHLIEAQLGGEJDLR4    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR5    
18563753VAVPSTIHCDHLIEAQLGGEJDLR4    
18563753VDVSPTSQR2    
18563753VGLIGSCTNSSYEDMGR3    
18563753VGLIGSCTNSSYEDMGR3    
18563753VGLIGSCTNSSYEDMGR2    
18563753VGLIGSCTNSSYEDMGR3    
18563753VGLIGSCTNSSYEDMGR3    
18563753VGLIGSCTNSSYEDMGR2    
18563753VGLIGSCTNSSYEDMGR2    
18563753VGLIGSCTNSSYEDMGR3    
18563753VGLIGSCTNSSYEDMGR3    
23308193WDGKDLEDLQILIK     MS2 score: 240.00peptide count: 17
18563753WVVIGDENUGEGSSREHAALEPR5    
18563753WVVIGDENYGEGSSR3    
18563753WVVIGDENYGEGSSR3    
18563753WVVIGDENYGEGSSR2    
18563753WVVIGDENYGEGSSR2    
18563753YDLLEJ2    
18563753YDLLEJ2    
18563753YDLLEJ2    
18563753YDLLEJ2    
18563753YDLLEJ2    
18563753YDLLEJ2    

Compile date 12-23-2014© PADB initiative