PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A0235ACTR2, ARP2Actin-like protein 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836CGYAGSNFPEHIFPALVGR2.1 (delta mass [ppm])3    
16901338CGYAGSNFPEHIFPALVGRPIIR3   MS2 score: 21 
16901338DLMVGDEASELR2  1Met(ox)MS2 score: 54 
16901338GYAFNHSADFETVR0.14 (delta mass [ppm])3   MS2 score: 26 
16901338GYAFNHSADFETVR3   MS2 score: 24 
16901338HLWDYTFGPEK2   MS2 score: 53 
16948836HLWDYTFGPEK2.1 (delta mass [ppm])2    
16901338ILLTEPPMNPTK2   MS2 score: 43 
16948836ILLTEPPMNPTK3.3 (delta mass [ppm])2    
16507876K.LCYVGYNIEQEQK.L1822.8 (expected)2    
15020595K.VVVCDNGTGFVK.C       
18501002KHLWDYTFGPEKL 2    
18501002KVGNIEIKDLMVGDEASELRS 3    
16901338LCYVGYNIEQEQK2   MS2 score: 69 
16901338VGNIEIKDLMVGDEASELR1.84 (delta mass [ppm])3  1Met(ox)MS2 score: 50 
16684767KCGYAGSNFPEHIFPALVGRPIIRS 2    
16684767KDLM*VGDEASELRS 2    
16684767KDLMVGDEASELRS 2    
16684767KILLTEPPMNPTKN 2    
16684767KLCYVGYNIEQEQKL 2    
16684767KVGNIEIKDLMVGDEASELRS 2    
16684767RFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRS 3    
16684767RKVVVCDNGTGFVKC 2    
16684767RRKHMVFLGGAVLADIMKDKD 2    
16684767RVLKGDVEKL 2    
18614015(K)DLMVGDEASELR(S)      peptide count: 1
18614015(K)DLMVGDEASELRSMLEVNYPMENGIVRNWDDMK(H)      peptide count: 1
18614015(K)LCYVGYNIEQEQK(L)      peptide count: 1
18614015(K)LLLLR(G)      peptide count: 1
18614015(K)LLLLRGYAFNHSADFETVRMIK(E)      peptide count: 4
18614015(K)LNIDTRNCK(I)      peptide count: 1
18614015(K)LNIDTRNCKILLTEPPMNPTK(N)      peptide count: 1
18614015(R)FEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTR(S)      peptide count: 1
18614015(R)IIKVGGER(F)      peptide count: 1
18614015(R)LDLAGR(D)      peptide count: 40
18614015(R)RLDIAGR(D)      peptide count: 2
18614015(R)VLKGDVEK(L)      peptide count: 1
18614015(R)YLIKLLLLR(G)      peptide count: 1
21616181DLMVGDEASELR1478.73125 (observed)   N-Term(iTRAQ4plex)peptide count: 36
21616181DLMVGDEASELR1494.72319 (observed)   N-Term(iTRAQ4plex), M3(Oxidation)peptide count: 14
21616181DLMVGDEASELR1478.73137 (observed)   N-Term(iTRAQ4plex)peptide count: 21
21616181DLMVGDEASELR1494.72283 (observed)   N-Term(iTRAQ4plex), M3(Oxidation)peptide count: 6
18578523HMVFLGGAVLADIMK2   
21616181IDIAGR788.47521 (observed)   N-Term(iTRAQ4plex)MS2 score: 39peptide count: 3
21616181IIILR771.56224 (observed)   N-Term(iTRAQ4plex) peptide count: 8
21616181ILLTEPPMNPTK1641.95183 (observed)   N-Term(iTRAQ4plex), K12(iTRAQ4plex)peptide count: 7
21616181ILLTEPPMNPTK1657.94475 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), K12(iTRAQ4plex)peptide count: 4
21616181ILLTEPPMNPTK1641.94902 (observed)   N-Term(iTRAQ4plex), K12(iTRAQ4plex)peptide count: 15
21616181ILLTEPPMNPTK1657.94402 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), K12(iTRAQ4plex) peptide count: 1
21616181LALETTVLVESYTLPDGR2121.16715 (observed)   N-Term(iTRAQ4plex)peptide count: 4
21616181LALETTVLVESYTLPDGR2121.16147 (observed)   N-Term(iTRAQ4plex)peptide count: 2
21616181LCYVGYNIEQEQK1920.94512 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), K13(iTRAQ4plex)peptide count: 3
21616181LLLIR771.55693 (observed)   N-Term(iTRAQ4plex)MS2 score: 26peptide count: 64
21616181SMLEVNYPMENGIVR1896.93657 (observed)   N-Term(iTRAQ4plex), N11(Deamidated)peptide count: 15
21616181SMLEVNYPMENGIVR1912.92803 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), N11(Deamidated)peptide count: 10
21616181SMLEVNYPMENGIVR1928.9227 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), M9(Oxidation), N11(Deamidated)MS2 score: 49peptide count: 2
21616181SMLEVNYPMENGIVR1896.93425 (observed)   N-Term(iTRAQ4plex), N11(Deamidated)peptide count: 8
21616181SMLEVNYPMENGIVR1912.92534 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), N11(Deamidated)peptide count: 10
21616181SMLEVNYPMENGIVR1928.92253 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), M9(Oxidation), N11(Deamidated) peptide count: 2
21616181VVVCDNGTGFVK1572.80034 (observed)   N-Term(iTRAQ4plex), C4(Methylthio), N6(Deamidated), K12(iTRAQ4plex)peptide count: 2
21127740LCYVGYNIEQEQK822.39 (observed)28.89E+0524.87 (HPLC [min or %B]) MS2 score: 46.45
21127740ILLTEPPMNPTK685.37 (observed)28.27E+0522.43 (HPLC [min or %B])Oxidation (M)MS2 score: 27.7
21127740LCYVGYNIEQEQK822.39 (observed)22.79E+0624.97 (HPLC [min or %B]) MS2 score: 76.55
21127740LCYVGYNIEQEQK822.39 (observed)23.40E+0524.66 (HPLC [min or %B]) MS2 score: 27.94
23376485CGYAGSNFPEHIFPALVGR698.01 (observed)   :Cys_CAM:::::::::::::::::::
23376485DLMVGDEASELR667.818 (observed)   :::::::::::::
23376485GYAFNHSADFETVR807.373 (observed)   :::::::::::::::
23376485HIVLSGGSTMYPGLPSR591.312 (observed)   ::::::::::::::::::
23376485HIVLSGGSTMYPGLPSR596.643 (observed)   ::::::::::Oxidation_M::::::::
23376485HLWDYTFGPEK696.836 (observed)   ::::::::::::
23376485HLWDYTFGPEK696.836 (observed)   ::::::::::::
23376485ILLTEPPMNPTK685.375 (observed)   ::::::::Oxidation_M:::::
23376485ILLTEPPMNPTK677.383 (observed)   :::::::::::::
23376485ILLTEPPMNPTK677.38 (observed)   :::::::::::::
23376485ILLTEPPMNPTK685.377 (observed)   ::::::::Oxidation_M:::::
23376485ILLTEPPMNPTK685.374 (observed)   ::::::::Oxidation_M:::::
23376485KVVVCDNGTGFVK474.921 (observed)   :::::Cys_CAM:::::::::
23376485LCYVGYNIEQEQK822.396 (observed)   ::Cys_CAM::::::::::::
23376485VVVCDNGTGFVK647.832 (observed)   ::::Cys_CAM:::::::::

Compile date 12-23-2014© PADB initiative