PADB-logoLSSR - PepMap molecular information by study

Study ID 23308193
Species human
Disease bladder cancer
Tissue / Source T24 and T24T cells
Compartment cytosolic and nuclear fractionation

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A3808RPL4, RPL160S ribosomal protein L416579885AAAAAAALQAK   
A4200RCC2, TD60, TD-60Protein RCC2209969703AAAAAWEEPSSGNGTAR   
A6469EXOSC10, PMSCL, PMSCL2Polymyositis/scleroderma autoantigen 250301240AAAEQAISVR   
A0492STIP1Stress-induced-phosphoprotein 15803181AAALEFLNR   
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 394757926AAAMANNLQKGSAGPMR   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481AAAPAPEEEMDECEQALAAEPKAK   
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor119622017AAAVLPVLDLAQR   
A607AINTS1, INT1, UNQ1821/PRO3434Integrator complex subunit 1122937317AAAVQADDVEVLK   
A177BYB-1, YBX1, NSEP1Nuclease sensitive element binding protein 134098946AADPPAENSSAPEAEQGGAE   
A3574BASP1, NAP22Brain acid soluble protein 130795231AAEAAAAPAESAAPAAGEEPSKEEGEPK   
A0545NCKAP1, HEM2, NAP1Nck-associated protein 17305303AAEDLFVNIR   
A3793PHBProhibitin4505773AAELIANSLATAGDGLIELR   
A7566CADCarbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase18105007AAFALGGLGSGFASNR   
A0280YWHAE14-3-3 protein epsilon5803225AAFDDAIAELDTLSEESYK   
A7917FARSB, FRSB, FARSLBPhenylalanyl-tRNA synthetase beta chain124028525AAGASDVVLYK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995AAGFKDPLLASGTDGVGTK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023AAGVVLEMIR   
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUS4826734AAIDWFDGK   
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUS4826734AAIDWFDGKEFSGNPIK   
A551CSRP68Signal recognition particle 68 kDa protein24497620AAIEAFNK   
A1098PRMT5, HRMT1L5, IBP72Protein arginine N-methyltransferase 520070220AAILPTSIFLTNK   
A471AHIST1H1D, H1F3Histone H1.34885377AAKPKSGKPK   
A8207XRN25'-3' exoribonuclease 218860916AALEEVYPDLTPEETRR   
A8173UMPSUridine 5'-monophosphate synthase4507835AALGPLVTGLYDVQAFK   
A1418LLDBP, RFC1, RFC140Replication factor C subunit 132528306AALLSGPPGVGK   
A0782NuMA, NUMA1, NUMANuMA protein71361682AALMESQGQQQEER   
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursor4757732AALSASEGEEVPQDK   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327AALTGLLHR   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206AAMEALVVEVTK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805AANSLEAFIFETQDK   
A2143CORO1A, CORO1Coronin-like protein p575902134AAPEASGTPSSDAVSR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246AAPGAEFAPNK   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246AAPGAEFAPNKR   
A245CNUP155Nuclear pore complex protein Nup1554758844AAPQSPSVPK   
A174BWIBG, PYMPartner of Y14 and MAGO14150139AAPTAASDQPDSAATTEK   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264AAQAPSSFQLLYDLK   
A0896CSNK1A1Casein kinase I, alpha isoform68303572AAQQAASSSGQGQQAQTPTGK   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392AAQVMGPPDR   
A494AH2AFY, MACROH2A1Core histone macro-H2A.193141020AASADSTTEGTPADGFTVLSTK   
A0280YWHAE14-3-3 protein epsilon5803225AASDIAMTELPPTHPIR   
A470AHIST1H1C, H1F2Histone H1.24885375AASGEAKPK   
A473AHIST1H1B, H1F5Histone H1.54885381AASGEAKPK   
A4575ANXA4, PIG28, ANX4Annexin A44502105AASGFNAMEDAQTLR   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757AASITSEVFNK   
A1881TJP2, X104, ZO2Tight junction protein ZO-242518070AASSDQLR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135AATLAQELEK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304AATQFWR   
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E123510340AAVATFLQSVQVPEFTPK   
A043CKPNB1, NTF97Importin beta-1 subunit19923142AAVENLPTFLVELSR   
A3568PSMD126S proteasome non-ATPase regulatory subunit 125777600AAVESLGFILFR   
A408AEWSR1, EWSRNA-binding protein EWS4885225AAVEWFDGK   
A408AEWSR1, EWSRNA-binding protein EWS4885225AAVEWFDGKDFQGSK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216AAVGQESPGGLEAGNAK   
A6267DDX21Nucleolar RNA helicase 250659095AAVIGDVIR   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392AAVKEPLEFHAK   
A001BSF3B2, SAP145Splicing factor 3B subunit 255749531AAVLLEQER   
A8173UMPSUridine 5'-monophosphate synthase4507835AAWEAYLSR   
A0396SLC25A5, ANT2ADP/ATP translocase 2156071459AAYFGIYDTAK   
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T155749577AAYFGVYDTAK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156AAYLNMSEDPSHPSMALNTR   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581ACFLRDIPFSAIYFPCYAHVK   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103ACFLRDIPFSAIYFPVYAHCK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397ADDADEFGYSR   
A032BSART1SART-110863889ADDLLPLGDQTQDGDFGSR   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034ADDPSAADRNVEIWK   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 132455266ADEGISFR   
A3961MYH10, SmembMyosin-1041406064ADEWLMK   
A643DLAS1L, MSTP060LAS1-like protein13654270ADGDSKGSEEVDSHCK   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723ADGYEPPVQESV   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475ADLLLSTQPGREEGSPLELER   
A8790FLII, FLILFlightless-I protein homolog4503743ADLTALFLPR   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor46593007ADLTEYLSTHYK   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255ADMETLQR   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315ADQVDTQQLMR   
A0284SAFB, HAP, HETScaffold attachment factor B21264343ADSLLAVVK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794ADVFHAYLSLLK   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259ADVVESWIGEK   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139ADWLSHYWMPK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919AEAESMYQIK   
A370ATUFMElongation factor Tu, mitochondrial precursor34147630AEAGDNLGALVR   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805AEAGPEGVAPAPEGEK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805AEAGPEGVAPAPEGEKK   
A0204FLNA, FLN, FLN1Filamin A116063573AEAGVPAEFSIWTR   
A2553RBM4, RBM4A, COAZRNA-binding protein 493277122AEDAVEAIR   
A0782NuMA, NUMA1, NUMANuMA protein71361682AEDEWKAQVAR   
A3815RPS2, rps2, RPS440S ribosomal protein S215055539AEDKEWMPVTK   
A1377PCNAProliferating cell nuclear antigen33239451AEDNADTLALVFEAPNQEK   
A0452CANXCalnexin precursor66933005AEEDEILNR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135AEEDTQFNYHR   
A7908AARSAlanyl-tRNA synthetase109148542AEEIANEMIEAAKAVYTQDCPLAAAK   
A2187UBTF, UBF, UBF1Nucleolar transcription factor 17657671AEEIWQQSVIGDYLAR   
A0782NuMA, NUMA1, NUMANuMA protein71361682AEELGQELK   
A8008TOP1DNA topoisomerase-111225260AEEVATFFAK   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254AEFEVHEVYAVDVLVSSGEGK   
A850APHF6PHD-like zinc finger protein62865858AEFGDFDIK   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392AEGFVDALHR   
A602CTHOC2THO complex subunit 220799318AEGGYFGQIR   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954AEGPEVDVNLPK   
A968BFAM120A, OSSAConstitutive coactivator of PPAR-gamma-like protein 139652628AEGSSTASSGSQLAEGK   
A0430LMNB1, LMN2, LMNBLamin B15031877AEHDQLLLNYAK   
A4575ANXA4, PIG28, ANX4Annexin A44502105AEIDMLDIR   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454AEISNAIDQYVTGTIGEDEDLIK   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257AEKDEPGAWEETFK   
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 3517999541AELAELPLR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998AELDDTPMR   
A885APSPC1, PSP1Paraspeckle component 1109240550AELDGTILK   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399AELGTDLLSQLSLEDQK   
A8738CACYBP, S100A6BP, SIPCalcyclin binding protein7656952AELLDNEKPAAVVAPITTGYTVK   
A3816RPS340S ribosomal protein S315718687AELNEFLTR   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255AELNPWPEYIYTR   
A3965TPM1, TMSATropomyosin 1 alpha chain27597085AELSEGQVR   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827AEMELGLR   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenase7669492AENGKLVINGNPITIFQER   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206AENNSEVGASGYGVPGPTWDR   
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E123510340AENYDIPSADR   
A0234ACTR3, ARP3Actin-like protein 35031573AEPEDHYFLLTEPPLNTPENR   
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursor10864011AEPLETFPFDQSK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805AEPPLNASASDQGEK   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753AEPPQAMNALMR   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968AEPVEVVAPR   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503AEQINQAAGEASAVLAK   
A1881TJP2, X104, ZO2Tight junction protein ZO-242518070AEQMASVQNAQR   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995AERAGIPTR   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315AERVLELVSITANK   
A0658DCTN1Dynactin 113259510AESLQQEVEALK   
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursor14042596AESVVLEHR   
A067BSYMPK, SPKSymplekin124028529AEVLSFILEDVR   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401AEWQVYKEEISR   
A0819RDXRadixin4506467AFAAQEDLEK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427AFADAMEVIPSTLAENAGLNPISTVTELR   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995AFAHITGGGLLENIPR   
A9531PCBP1Poly(rC)-binding protein 1460771AFAMIIDK   
A046CIPO7, RANBP7RanBP7/importin 75453998AFAVGVQQVLLK   
A257CNUP93Nuclear pore complex protein Nup9321706468AFDIIER   
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunit4758774AFDLIVDRPVTLVR   
A3586ACLYATP-citrate synthase38569421AFDSGIIPMEFVNK   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254AFFSEVER   
A4815FLNC, ABPL, FLN2Filamin C116805322AFGPGLEGGLVNK   
A0204FLNA, FLN, FLN1Filamin A116063573AFGPGLQGGSAGSPAR   
A0204FLNA, FLN, FLN1Filamin A116063573AFGPGLQGGSAGSPARFTIDTK   
A4103CUL4BCullin-4B121114298AFGSTIVINPEKDK   
A3541TCP1, CCT1, CCTAT-complex protein 1, alpha subunit57863257AFHNEAQVNPER   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113AFIPAIDSFGFETDLR   
A3807RPLP060S acidic ribosomal protein P016933546AFLADPSAFVAAAPVAAATTAAPAAAAAPAK   
A5617MPG, AAG, ANPGDNA-3-methyladenine glycosylase62632769AFLGQVLVR   
A0658DCTN1Dynactin 113259510AFLQGGQEATDIALLLR   
A9559RPL3, rpl3, ASC-160S ribosomal protein L34506649AFMGPLKK   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159AFNDPFIQK   
A0208RANGAP1, SDRan GTPase-activating protein 14506411AFNSSSFNSNTFLTR   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315AFPMPGFDEH   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039AFSDPFVEAEK   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129AFSITQGLLK   
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursor112380628AFSVNIFK   
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursor112380628AFSVNIFKVWVQAFK   
A2583SFRS7, SRSF7, 9g8Splicing factor, arginine/serine-rich 772534660AFSYYGPLR   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454AFTHTAQYDEAISDYFR   
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursor4502491AFVDFLSDEIK   
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursor4502491AFVDFLSDEIKEER   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309AFVHWYVGEGMEEGEFSEAR   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892AFYPEEISSMVLTK   
A4633CAP1, CAPAdenylyl cyclase-associated protein 1157649073AGAAPYVQAFDSLLAGPVAEYLK   
A550CSRP54Signal recognition particle 54 kDa protein4507215AGAFDQLK   
A3696MDH2Malate dehydrogenase, mitochondrial precursor21735621AGAGSATLSMAYAGAR   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenase7669492AGAHLQGGAK   
A0419GSNGelsolin precursor, plasma4504165AGALNSNDAFVLK   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947AGCEVTILFADLHAYLDNMKAPWELLELR   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305AGDMENAENILTVMR   
A2141CORO1BCoronin 1B65787364AGEAGKLEEVMQELR   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747AGEKVEKPDTK   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246AGEVFIHK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885AGFAGDDAPR   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597AGFVPVYLR   
A4200RCC2, TD60, TD-60Protein RCC2209969703AGGAAVVITEPEHTK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315AGGADAVQTVTGGLR   
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 34503507AGGEAGVTLGQPHLSR   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159AGGIETIANEFSDR   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039AGGIETIANEYSDR   
A0430LMNB1, LMN2, LMNBLamin B15031877AGGPTTPLSPTR   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193AGGSASAMLQPLLDNQVGFK   
A7785SCCPDH, CGI-49Saccharopine dehydrogenase55770836AGGVFTPGAAFSK   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173AGIISTVEVLK   
A1303MCM7, CDC47, MCM2DNA replication licensing factor MCM733469968AGILTTLNAR   
A3586ACLYATP-citrate synthase38569421AGKDLVSSLTSGLLTIGDR   
A6339dkc1, DKC1, NOLA4Dyskerin4503337AGLESGAEPGDGDSDTTK   
A038CKPNA2, RCH1, SRP1Importin alpha-2 subunit4504897AGLIPKFVSFLGR   
A278ACCAR1, CARP1, DISCell division cycle and apoptosis regulator protein 146852388AGLLQPPVR   
A045CIPO4, IMP4B, RANBP4Importin 462460637AGLLVLAVLSDGAGDHIR   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256AGLNCSTENMPIK   
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.a19557656AGLQFPVGR   
A3584FASN, FASFatty acid synthase41872631AGLYGLPR   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301AGNFYVPAEPK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121AGNGQWASVIR   
A4814FLNB, FLN3, TAPFilamin-B105990514AGPGTLSVTIEGPSK   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586AGPIWDLR   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755AGPIWDLR   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597AGPNASIISLK   
A969ASNRPB2U2 small nuclear ribonucleoprotein B"38149981AGPNASIISLK   
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating40068518AGQAVDDFIEK   
A2492LMNB2, LMN2Lamin B227436951AGQMVTVWAAGAGVAHSPPSTLVWK   
A4687CNN3Calponin 34502923AGQSVIGLQMGTNK   
A0234ACTR3, ARP3Actin-like protein 35031573AGRLPACVVDCGTGYTK   
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenase23308577AGTGVDNVDLEAATR   
A2344ACTN4Alpha-actinin 412025678AGTQIENIDEDFRDGLK   
A494AH2AFY, MACROH2A1Core histone macro-H2A.193141020AGVIFPVGR   
A0072GNB4Guanine nucleotide-binding protein beta subunit 411055998AGVLAGHDNR   
A4684CGI-99, CLE7UPF0568 protein C14ORF1667706322AGVMALANLLQIQR   
A033APDCD6, ALG2, AHRRProgrammed cell death protein 67019485AGVNFSEFTGVWK   
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7a4506661AGVNTVTTLVENK   
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7a4506661AGVNTVTTLVENKK   
A027FPAF1, PD2RNA polymerase II-associated factor 1 homolog42476169AGVQSGTNALLVVK   
A3952SFXN3Sideroflexin 331621303AGVVTPGITEDQLWR   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305AGYPQYVSEILEK   
A5250WDR1, PNAS-29WD-repeat containing protein 19257257AHDGGIYAISWSPDSTHLLSASGDK   
A0688AP1M1, CLTNMAdaptor-related protein complex 1, mu 1 subunit14210504AHFGLPSVEAEDK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805AHFNLDESGVLSLDR   
A4103CUL4BCullin-4B121114298AHIISDQK   
A2544MSI2RNA-binding protein Musashi homolog 220373175AHLLADMAHISGLVAAK   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315AHLLADMAHISGLVAAK   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012AHMGMFTELAILYSK   
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunit4506003AHQVVEDGYEFFAK   
A9545RPL18A60S ribosomal protein L18A169163931AHSIQIMK   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763AHSSMVGVNLPQK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305AHVEGDGVVEGIIR   
A0089CTNNA1Alpha-1 catenin55770844AHVLAASVEQATENFLEK   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932AIADTGANVVVTGGK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995AIAFLQQPR   
A0097TLN1, TLNTalin 116753233AIAVTVQEMVTK   
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 1319923193AIDLFTDAIK   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586AIEALKEFNEDGALAVLQQFK   
A552CSRP72Signal recognition particle 72 kDa protein109638749AIELLQEFSDQHPENAAEIK   
A6663GSSGlutathione synthetase4504169AIENELLAR   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206AIEPPPLDAVIEAEHTLR   
A3995PGAM5-L, PGAM5Serine/threonine-protein phosphatase PGAM5 mitochondrial14198272AIETTDIISR   
A2142CORO1C, CRNN4, CRN2Coronin 1C7656991AIFLADGNVFTTGFSR   
A046CIPO7, RANBP7RanBP7/importin 75453998AIFQTIQNR   
A1164IPO5, KPNB3, RANBP5Importin 524797086AIGTEPDSDVLSEIMHSFAK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601AIGVLTSGGDAQGMNAAVR   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096AIIDEFEQK   
A9653RPS740S ribosomal protein S74506741AIIIFVPVPQLK   
A6348DNMT1, AIM, CXXC9DNA (cytosine-5)-methyltransferase 14503351AIILAAAPGEK   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255AILGSVER   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399AILNGIDSINK   
A067BSYMPK, SPKSymplekin124028529AILTMTQLYK   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785AILVDLEPGTMDSVR   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852AIMEMPSFYSHGLPR   
A2341ACTN1Alpha-actinin 14501891AIMTYVSSFYHAFSGAQK   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311AINDGFRLPTPMDCPSAIYQLMMQCWQQER   
A0029ANXA6, ANX6Annexin A671773415AINEAYKEDYHK   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960AINFNFGYAK   
A960APDCD11RRP5 protein homolog70980549AINIGQLVDVK   
A2360ARHGAP1, CDC42GAP, RHOGAP1Rho-GTPase-activating protein 14757766AINPINTFTK   
A0545NCKAP1, HEM2, NAP1Nck-associated protein 17305303AINQIAAALFTIHK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000AINQQTGAFVEISR   
A2520ELAVL1, HURELAV-like protein 138201714AINTLNGLR   
A0098VCLVinculin4507877AIPDLTAPVAAVQAAVSNLVR   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747AIPQLQGYLR   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042AIQGGTSHHLGQNFSK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042AIQGGTSHHLGQNFSKMFEIVFEDPK   
A8968PSMD326S proteasome non-ATPase regulatory subunit 325777612AIQLEYSEAR   
A4684CGI-99, CLE7UPF0568 protein C14ORF1667706322AIRILVQER   
A494AH2AFY, MACROH2A1Core histone macro-H2A.193141020AISSYFVSTMSSSIK   
A1420RFC4Replication factor C subunit 431881687AITFLQSATR   
A9552RPL2460S ribosomal protein L244506619AITGASLADIMAK   
A9655RPSA, LAMBR, LAMR140S ribosomal protein SA59859885AIVAIENPADVSVISSR   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392AIVSSGTLGDR   
A3586ACLYATP-citrate synthase38569421AIVWGMQTR   
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2148747351AIYHDLEQSIR   
A1425RFC3Replication factor C subunit 34506489AIYHLEAFVAK   
A629AMKI67Antigen KI-67103472005AKALEDLAGFK   
A2591SSB, SS-B/LaLupus La protein10835067AKDANNGNLQLR   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867AKDINQEVYNFLATAGAK   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481AKDPFAHLPK   
A4969MFAP1Microfibrillar-associated protein 150726968AKEQEAEPEEQEEDSSSDPR   
A046CIPO7, RANBP7RanBP7/importin 75453998AKEYITPFIRPVMQALLHIIR   
A6375HARS2, DTD1, DUEBD-tyrosyl-tRNA(Tyr) deacylase 130795227AKGPSESSK   
A3586ACLYATP-citrate synthase38569421AKPAMPQDSVPSPR   
A894BCOPB1, COPB, MSTP026Coatomer beta subunit221316632AKSQGMALSLGDK   
A470AHIST1H1C, H1F2Histone H1.24885375ALAAAGYDVEK   
A471AHIST1H1D, H1F3Histone H1.34885377ALAAAGYDVEK   
A470AHIST1H1C, H1F2Histone H1.24885375ALAAAGYDVEKNNSR   
A473AHIST1H1B, H1F5Histone H1.54885381ALAAGGYDVEK   
A473AHIST1H1B, H1F5Histone H1.54885381ALAAGGYDVEKNNSR   
A8086UAP1, SPAG2UDP-N-acetylhexosamine pyrophosphorylase 1156627575ALAAQNIVEDMEQR   
A6985MCM4, CDC21DNA replication licensing factor MCM433469919ALADDDFLTVTGK   
A013ANCSTN, UNQ1874/PRO4317, UNQ1874Nicastrin precursor24638433ALADVATVLGR   
A6663GSSGlutathione synthetase4504169ALAEGVLLR   
A451ETXNDC5, MUTED, TLP46Thioredoxin domain containing protein 5 precursor119575627ALAPTWEQLALGLEHSETVK   
A0098VCLVinculin4507877ALASQLQDSLK   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486ALDDMISTLK   
A0430LMNB1, LMN2, LMNBLamin B15031877ALDDTARER   
A8960PSMC2, MSS126S protease regulatory subunit 74506209ALDEGDIALLK   
A2552SRSF6, SFRS6, SRP55Serine/arginine-rich splicing factor 620127499ALDKLDGTEINGR   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973ALDLFSDNAPPPELLEIINEDIAK   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399ALDQFVNFSEQK   
A2507PABPC4, APP1, PABP4Poly(A) binding protein, cytoplasmic 44504715ALDTMNFDVIK   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787ALDTMNFDVIK   
A4314DNAJC8, SPF31, HSPC315DnaJ homolog subfamily C member 8112293277ALDVIQAGK   
A2555RBMX, HNRPG, RBMXP1Heterogeneous nuclear ribonucleoprotein G56699409ALEAVFGK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425ALEEELAGLK   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555ALEESESSQLISPPLAQAIR   
A7569CTPS1, CTPSCTP synthase 1148491070ALEHSALAINHK   
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunit5453607ALEIIPR   
A3961MYH10, SmembMyosin-1041406064ALELDPNLYR   
A2492LMNB2, LMN2Lamin B227436951ALELENDR   
A6276DDX46Probable ATP-dependent RNA helicase DDX4641327773ALELSGTAVPPDLEK   
A2536NCLNucleolin55956788ALELTGLK   
A753ACOBRA1, NELFBNegative elongation factor B20070260ALEPTGQSGEAVK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023ALESDMAPVLIMATNR   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763ALESPERPFLAILGGAK   
A0668RUVBL1, INO80H, NMP238RuvB-like 14506753ALESSIAPIVIFASNR   
A028FPABPC1L2A, PABPC1L2, RBM32APolyadenylate-binding protein 1-like 2109948285ALETLNFDVIKGRPVR   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454ALFEEVPELLTEAEK   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454ALFEEVPELLTEAEKK   
A2080PRPF4, PRP4U4/U6 small nuclear ribonucleoprotein Prp424431950ALGEPITLFGEGPAER   
A3960MYO6Unconventional myosin-VI92859701ALGLNENDYK   
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursor4757732ALGTEVIQLFPEK   
A0448CDK1, CDC2, CDC28ACrll division cycle 24502709ALGTPNNEVWPEVESLQDYK   
A4379PSMD526S proteasome non-ATPase regulatory subunit 54826952ALHSVLQAVPLNELR   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481ALIAAQYSGAQVR   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427ALIAGGGAPEIELALR   
A0029ANXA6, ANX6Annexin A671773415ALIEILATR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246ALIEMEK   
A7941WARS, IFI53, WRSTryptophanyl-tRNA synthetase, cytoplasmic47419916ALIEVLQPLIAEHQAR   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259ALINADELASDVAGAEALLDR   
A7736POLR2E, RPABC1DNA-directed RNA polymerase II polypeptide E14589951ALIVVQQGMTPSAK   
A3531KTN1, CG1, PDIA6Kinectin118498356ALKEEIGNVQLEK   
A065BXAB2, HCNP, SYF1Pre-mRNA-splicing factor SYF155770906ALKLLPCSYK   
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunit163965364ALKNNSNDIVNAIMELTM   
A8028TRIM25, EFP, RNF147Zinc finger protein 14768160937ALLDASETTSTR   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257ALLDSLQLGPDSLTVHLIHEVTK   
A3804EEF2, EF2Elongation factor 24503483ALLELQLEPEELYQTFQR   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191ALLFVPR   
A9626TROVE2, RO60, SSA2TROVE domain family, member 231377800ALLQEMPLTALLR   
A551CSRP68Signal recognition particle 68 kDa protein24497620ALLQQQPEDDSKR   
A8382AATF, CHE1, DEDApoptosis antagonizing transcription factor7657013ALLTTNQLPQPDVFPLFK   
A8963PSMD1126S proteasome non-ATPase regulatory subunit 1128872725ALLVEVQLLESK   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763ALMDEVVK   
A0324JUP, CTNNG, DP3Junction plakoglobin12056468ALMGSPQLVAAVVR   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216ALNEMWK   
A4182PDS5B, APRIN, AS3Sister chromatid cohesion protein PSD homolog B7657269ALNEMWK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425ALNHEIEELEK   
A1426RFC5Replication factor C subunit 56677723ALNILQSTNMAFGK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426ALNMAIPGGPK   
A588AEIF5Eukaryotic translation initiation factor 537537716ALNRPPTYPTK   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932ALPDMEVVGLNFSSATTPELLLK   
A024BSMARCC2, BAF170SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily C, member 221237805ALPEFFNGK   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase P4504183ALPGQLKPFETLLSQNQGGK   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330ALPLIVGAQLIHADK   
A1941PLEC1, PLECPlectin41322910ALQALEELR   
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursor112380628ALQATVGNSYK   
A2117PRPF19, NMP200, PRP19Pre-mRNA-processing factor 197657381ALQDEWDAVMLHSFTLR   
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1B11034845ALQDLENAASGDATVR   
A6271DDX27, RHLP, HSPC259Probable ATP-dependent RNA helicase DDX2719743937ALQEFDLALR   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171ALQFLEEVK   
A0326VIL2, EZREzrin161702986ALQLEEER   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597ALQLLQMYYEGR   
A897BCOPG, COPG1Coatomer gamma subunit11559929ALQQYTLEPSEKPFDLK   
A4231STAG1, SA1Cohesin subunit SA-162243696ALQSLYTNR   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787ALQSPALGLR   
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolic22547186ALSEALTELGYK   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475ALSEIAGMTLPYDTLDQVR   
A5239UBQLN1, DA41, PLIC1Ubiquilin 116753203ALSNLESIPGGYNALR   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907ALSNQK   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158ALSPLEEWLR   
A726AMTA2, MTA1L1, PIDMetastasis associated protein MTA214141170ALTHLEMR   
A428BESYT1, FAM62A, MBC2Extended syntaptotagmin-114149680ALTLGALTLPLAR   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794ALTLIAGSPLK   
A0446CSE1L, CAS, XPO2Exportin-229029559ALTLPGSSENEYIMK   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675ALTSEIALLQSR   
A0808MSNMoesin4505257ALTSELANAR   
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursor20127408ALTSFER   
A9060SRISorcin4507207ALTTMGFR   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735ALTVPELTQQMFDAK   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785ALTVPELTQQVFDAK   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250ALVADSHPESER   
A669AMYBBP1A, P160MYB-binding protein 1A157694492ALVDILSEVSK   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768ALVFQPVAELK   
A476AH1FXHistone H1x5174449ALVQNDTLLQVK   
A7910CARSCysteinyl-tRNA synthetase62240992ALVSQCNLYMAAR   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926ALVTGYFMQVAHLER   
A1426RFC5Replication factor C subunit 56677723ALVTLSSGDMR   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129ALWEETSFQLDR   
A668AMATR3Matrin 362750354ALWFQGR   
A2492LMNB2, LMN2Lamin B227436951ALYESELADAR   
A0430LMNB1, LMN2, LMNBLamin B15031877ALYETELADAR   
A2360ARHGAP1, CDC42GAP, RHOGAP1Rho-GTPase-activating protein 14757766ALYIVHPTMFIK   
A248CNUP205Nuclear pore complex protein Nup20557634534ALYTYESKMAFLTR   
A336ADDB1, XAP1DNA damage binding protein 1148529014ALYYLQIHPQELR   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315AMADALLER   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960AMAVLESLR   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601AMEWITAK   
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunit4504041AMGNLQIDFADPSR   
A588AEIF5Eukaryotic translation initiation factor 537537716AMGPLVLTEVLFNEK   
A643DLAS1L, MSTP060LAS1-like protein13654270AMGQGLPDEEQEK   
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 224638454AMGVVVATGVNTEIGK   
A635ALUC7L2, CGI-59, CGI-74Putative RNA-binding protein LUC7-like 2116812577AMLDQLMGTSR   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947AMLESIGVPLEK   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012AMLSANIR   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425AMNVLTEAEER   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768AMNWMSGK   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555AMQADISQAAQILSSDPSR   
A998ASF3A3, SAP61Splicing factor 3A subunit 35803167AMQDRYMEVSGNLR   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315AMQEQLENYDFTK   
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunit163965364AMSKLGLR   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486AMTGVEQWPYR   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852AMTILLEEAK   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193AMTTGAIAAMLSTILYSR   
A5087PLS3Plastin 3209862851ANDDIIVNWVNR   
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1115387104ANDTTFGLAAGVFTR   
A033BUSP39, CGI-21, HSPC332U4/U6.U5 TRI-SNRNP-associated protein 256550051ANDYANAVLQALSNVPPLR   
A043CKPNB1, NTF97Importin beta-1 subunit19923142ANFDKESER   
A411AEXOSC3, PNAS-3, RRP40Exosome complex exonuclease RRP4050511943ANGMGVIGQDGLLFK   
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8A16933567ANINVENAFFTLAR   
A4815FLNC, ABPL, FLN2Filamin C116805322ANIRDNGDGTYTVSYLPDMSGR   
A0446CSE1L, CAS, XPO2Exportin-229029559ANIVHLMLSSPEQIQK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305ANLGVFSVFAPR   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904ANLLNNEAHAITMQVTK   
A744ANCBP1, CBP80, NCBP80 kDa nuclear cap binding protein4505343ANNYNEAVYLVR   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945ANPQVGVAFPHIK   
A371ETAGLN2, CDABP0035Transgelin 24507357ANRGPAYGLSR   
A681CHDLBP, HBP, VGLVigilin42716280ANSFTVSSVAAPSWLHR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847ANSNLVLQADR   
A3696MDH2Malate dehydrogenase, mitochondrial precursor21735621ANTFVAELK   
A1166XPOTExportin T8051636ANVEAIMLAVMK   
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 18659555ANYLASPPLVIAYAIAGTIR   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454ANYWWLR   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723APAMFNIR   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675APDELHYTYLDTFGRPVIVAYK   
A0326VIL2, EZREzrin161702986APDFVFYAPR   
A0808MSNMoesin4505257APDFVFYAPR   
A0819RDXRadixin4506467APDFVFYAPR   
A3656DDX1ATP-dependent RNA helicase DDX14826686APDGYIVK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954APDVDVNIAGPDAALK   
A0181MAPK1, ERK2, PRKM1Mitogen-activated protein kinase 166932916APEIMLNSK   
A0181MAPK1, ERK2, PRKM1Mitogen-activated protein kinase 166932916APEIMLNSKGYTK   
A1478CDK7, CAK, CAK1Cell division protein kinase 74502743APELLFGAR   
A6015CDC2L2, CDC2L1, CDK11BCell division protein kinase 11B16332358APELLLGAK   
A3574BASP1, NAP22Brain acid soluble protein 130795231APEQEQAAPGPAAGGEAPK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594APFDLFENK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594APFDLFENKK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191APFDLFENR   
A4783EMD, EDMD, STAEmerin4557553APGAGLGQDR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932APGFAQMLK   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454APGQLALFSVSDK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418APIIAVTR   
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p684758138APILIATDVASR   
A6264DDX17ATP-dependent RNA helicase DDX17148613856APILIATDVASR   
A3808RPL4, RPL160S ribosomal protein L416579885APIRPDIVNFVHTNLR   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954APKVSMPDVDLNLK   
A4815FLNC, ABPL, FLN2Filamin C116805322APLQVAVLGPTGVAEPVEVR   
A0978PYGLGlycogen phosphorylase, liver form71037379APNDFNLR   
A838APDCD4, H731Programmed cell death 421735596APQLVGQFIAR   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096APQMYEFHLPLSPEELLK   
A6267DDX21Nucleolar RNA helicase 250659095APQVLVLAPTR   
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunit12408656APSDLYQIILK   
A8958PSMC3, TBP126S protease regulatory subunit 6A21361144APSIIFIDELDAIGTK   
A027FPAF1, PD2RNA polymerase II-associated factor 1 homolog42476169APTIQTQAQR   
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-A116256489APVDFGYVGIDSILEQMR   
A7910CARSCysteinyl-tRNA synthetase62240992APVDITGQFEK   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503APVPGTPDSLSSGSSR   
A0452CANXCalnexin precursor66933005APVPTGEVYFADSFDR   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602APVQPQQSPAAAPGGTDEKPSGK   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947APWELLELR   
A9558RPL2960S ribosomal protein L294506629AQAAAPASVPAQAPK   
A0782NuMA, NUMA1, NUMANuMA protein71361682AQADLALEK   
A6269DDX24, HSPC328ATP-dependent RNA helicase DDX249966805AQAVSEEEEEEEGKSSSPK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427AQDIEAGDGTTSVVIIAGSLLDSCTK   
A290CPLIN3, M6PRBP1, TIP47Perilipin-368846601AQEALLQLSQALSLMETVK   
A0326VIL2, EZREzrin161702986AQEEAERLEADR   
A0782NuMA, NUMA1, NUMANuMA protein71361682AQELGHSQSALASAQR   
A045CIPO4, IMP4B, RANBP4Importin 462460637AQELQAVLGLS   
A996ASF3A1, SAP114Splicing factor 3 subunit 15032087AQEPSAAIPK   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursor24234688AQFEGIVTDLIR   
A0439PHB2, BAP, REAProhibitin 2221307584AQFLVEK   
A613CTIMM50, TIM50, PRO1512Import inner membrane translocase subunit TIM50L mitochondrial precursor48526509AQGPQQQPGSEGPSYAK   
A907BCPNE1, CPN1Copine-123397708AQGWAPLKPLPPSAK   
A1374LMNA, LMN1Lamin A/C27436946AQHEDQVEQYK   
A1374LMNA, LMN1Lamin A/C27436946AQHEDQVEQYKK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426AQIAGYLYGVSPPDNPQVK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892AQIHDLVLVGGSTR   
A4314DNAJC8, SPF31, HSPC315DnaJ homolog subfamily C member 8112293277AQKAFEAVDK   
A3965TPM1, TMSATropomyosin 1 alpha chain27597085AQKDEEK   
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 144827050AQLFALTGVQPAR   
A788ANOP56, NOL5ANucleolar protein Nop5632483374AQLGLGHSYSR   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171AQLGVQAFADALLIIPK   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983AQLLQPTLEINPR   
A9062SMNDC1, SMNR, SPF30Survival of motor neuron-related splicing factor 305032113AQLQQVEAALSGNGENEDLLK   
A0808MSNMoesin4505257AQMVQEDLEK   
A6469EXOSC10, PMSCL, PMSCL2Polymyositis/scleroderma autoantigen 250301240AQNIMESFENPFRMFLPSLGHR   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771AQPLSLEELLAK   
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursor48255889AQQEQELAADAFK   
A0098VCLVinculin4507877AQQVSQGLDVLTAK   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250AQTLPTSVVTITSESSPGK   
A3584FASN, FASFatty acid synthase41872631AQVADVVVSR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135AQVQLQLFK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919AQYEDIANR   
A629AMKI67Antigen KI-67103472005ARALEDLVDFK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892ARFEELCSDLFR   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa protein5729877ARFEELNADLFR   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505ARGNIMLSQK   
A640ALEO1, RDLRNA polymerase-associated protein LEO120270337ARIYSSDSDEGSEEDK   
A3804EEF2, EF2Elongation factor 24503483ARPFPDGLAEDIDKGEVSAR   
A0367RPL13, BBC160S ribosomal protein L1315431297ARVITEEEK   
A7920HARS, HRSHistidyl-tRNA synthetase, cytoplasmic6996014ASAELIEEEVAK   
A0097TLN1, TLNTalin 116753233ASAGPQPLLVQSCK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426ASEMAGPPQMPNDFLSFQDIATEAAHPIR   
A028BSMARCB1, BAF47, INI1SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 127545326ASEVEEILDGNDEK   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597ASEVFLQR   
A0242CAV1, CAV, MSTP085Caveolin-115451856ASFTTFTVTK   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581ASGDSARPVLLQVAESAYR   
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 144827050ASGEMASAQYITAALRDLFDSMDK   
A3812RPL860S ribosomal protein L815431306ASGNYATVISHNPETK   
A0204FLNA, FLN, FLN1Filamin A116063573ASGPGLNTTGVPASLPVEFTIDAK   
A470AHIST1H1C, H1F2Histone H1.24885375ASGPPVSELITK   
A471AHIST1H1D, H1F3Histone H1.34885377ASGPPVSELITK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827ASGVEGADVVK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301ASINMLR   
A3515SEPT2, DIFF6, NEDD5Septin-256549640ASIPFSVVGSNQLIEAK   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747ASITPGTILIILTGR   
A996ASF3A1, SAP114Splicing factor 3 subunit 15032087ASKPLPPAPAPDEYLVSPITGEK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919ASLEAAIADAEQR   
A038CKPNA2, RCH1, SRP1Importin alpha-2 subunit4504897ASLSLIEK   
A1043DIS3, RRP44Exosome complex exonuclease RRP4417225572ASLTYAEAQLR   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029ASMHPVTAMLVGK   
A2102COPACoatomer alpha subunit148536855ASNLENSTYDLYTIPK   
A8192VRK1Serine/threonine protein kinase VRK14507903ASNLLLNYK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425ASNLQDLVYK   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027ASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVK   
A2184SSRP1, FACT80Structure-specific recognition protein 14507241ASSGLLYPLER   
A248CNUP205Nuclear pore complex protein Nup20557634534ASTEGVAIQGQQGTR   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926ASTNAMLISAGLPPLK   
A681CHDLBP, HBP, VGLVigilin42716280ASVITQVFHVPLEER   
A3211CKAP4, P63P63 protein19920317ASVSQVEADLK   
A6375HARS2, DTD1, DUEBD-tyrosyl-tRNA(Tyr) deacylase 130795227ASVTVGGEQISAIGR   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932ASVVTLPVYLNFTR   
A0782NuMA, NUMA1, NUMANuMA protein71361682ASYAEQLSMLK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601ASYDVSDSGQLEHVQPWSV   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503ASYGVEDPEYAVTQLAQTTMR   
A6663GSSGlutathione synthetase4504169ASYILMEK   
A1164IPO5, KPNB3, RANBP5Importin 524797086ATAAFILANEHNVALFK   
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrial50592988ATAAPAGAPPQPQDLEFTK   
A0126GRB2, ASHGrowth factor receptor-bound protein 24504111ATADDELSFK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892ATAGDTHLGGEDFDNR   
A3803EEF1D, EF1DElongation factor 1-delta194239731ATAPQTQHVSPMR   
A2553RBM4, RBM4A, COAZRNA-binding protein 493277122ATAPVPTVGEGYGYGHESELSQASAAAR   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 132455266ATAVMPDGQFK   
A887APTRF, FKSG13Polymerase I and transcript release factor42734430ATEMVEVGADDDEGGAER   
A553AHNRNPH3, HNRPH3Heterogeneous nuclear ribonucleoprotein H314141157ATENDIANFFSPLNPIR   
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein H5031753ATENDIYNFFSPLNPVR   
A557AHNRNPF, HNRPFHeterogeneous nuclear ribonucleoprotein F148470406ATENDIYNFFSPLNPVR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426ATEPQMVLFNLYDDWLK   
A3815RPS2, rps2, RPS440S ribosomal protein S215055539ATFDAISK   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173ATFDISLVVPK   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787ATFYGEQVDYYK   
A897BCOPG, COPG1Coatomer gamma subunit11559929ATFYLNVLEQK   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960ATGILLYGLASR   
A473AHIST1H1B, H1F5Histone H1.54885381ATGPPVSELITK   
A332CRAB7A, RAB7Ras-related protein Rab-7A34147513ATIGADFLTK   
A3961MYH10, SmembMyosin-1041406064ATISALEAK   
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunit5453607ATISNDGATILK   
A5866ATAD3AATPase family, AAA domain containing, protein 3A21749446ATLNAFLYR   
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E123510340ATLPSPDKLPGFK   
A669AMYBBP1A, P160MYB-binding protein 1A157694492ATLQEILPEVLK   
A5809PRMT1, HRMT1L2, HMT2Protein arginine N-methyltransferase 1150456457ATLYVTAIEDR   
A744ANCBP1, CBP80, NCBP80 kDa nuclear cap binding protein4505343ATNDEIFSILK   
A242ERSL1D1, CATX11, CSIGRibosomal L1 domain-containing protein 1118498359ATNESEDEIPQLVPIGK   
A965ASNRPN, HCERN3, SMNSmall nuclear ribonucleoprotein associated protein N13027650ATPPPGIMAPPPGMRPPMGPPIGLPPAR   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529ATQALVLAPTR   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675ATSFLLALEPELEAR   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942ATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPK   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505ATSTATSGFAGAIGQK   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381ATVGILITTIASK   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117ATVNTFGYIAK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794AVAALLTIPEAEK   
A470AHIST1H1C, H1F2Histone H1.24885375AVAASKER   
A473AHIST1H1B, H1F5Histone H1.54885381AVAASKER   
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrial50592988AVAFQNPQTHVIENLHAAAYR   
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursor21361181AVAGDASESALLK   
A8008TOP1DNA topoisomerase-111225260AVALYFIDK   
A3918VCPTransitional endoplasmic reticulum ATPase6005942AVANETGAFFFLINGPEIMSK   
A8957PSMC126S protease regulatory subunit 424430151AVANQTSATFLR   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505AVANYDSVEEGEK   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486AVAQALEVIPR   
A0097TLN1, TLNTalin 116753233AVASAAAALVLK   
A172CMYO1CUnconventional myosin-Ic124494238AVASEIFK   
A8700CDKN2AIP, CARFCDKN2A interacting protein8923040AVASREALK   
A3812RPL860S ribosomal protein L815431306AVDFAERHGYIK   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588AVDITTPK   
A362AEBNA1BP2, EBP2EBNA1 binding protein 21835786AVDPEDDFQR   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984AVDSLVPIGR   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747AVDSQILPK   
A7908AARSAlanyl-tRNA synthetase109148542AVFDETYPDPVR   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881AVFPSIVGRPR   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283AVFVDLEPTVIDEVR   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309AVFVDLEPTVIDEVR   
A045CIPO4, IMP4B, RANBP4Importin 462460637AVGEPMRPLAEECCQLGLGLCDQVDDPDLR   
A712CXPO1, CRM1CRM1 protein4507943AVGHPFVIQLGR   
A294BZRANB2, ZIS, ZNF265Zinc finger protein 26542741682AVGPASILK   
A4633CAP1, CAPAdenylyl cyclase-associated protein 1157649073AVGRLEAVSHTSDMHR   
A583DCLUHPutative eukaryotic translation initiation factor 3 subunit87162455AVGSISSTAFDIR   
A145BU2AF1, U2AF35, U2AFBPSplicing factor U2AF 35 kDa subunit5803207AVIDLNNR   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103AVKVQTTK   
A6551GPIGlucose-6-phosphate isomerase18201905AVLHVALR   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023AVLIAGQPGTGK   
A0668RUVBL1, INO80H, NMP238RuvB-like 14506753AVLLAGPPGTGK   
A5200TUBG2Tubulin gamma-2 chain7706751AVLLDLEPR   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735AVLVDLEPGTMDSVR   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121AVMISAIEK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121AVMISAIEKQK   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942AVNPFLADVDK   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012AVNYFSK   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602AVPLALALISVSNPR   
A604CTHOC6, WDR58THO complex subunit 6 homolog31543164AVPLAVPLGQTEVFQALQR   
A311ACPSF6, CFIM68, HPBRII-4Cleavage and polyadenylation specificity factor subunit 6871301AVSDASAGDYGSAIETLVTAISLIK   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753AVSDWIDEQEK   
A199AABCF1, ABC50ATP-binding cassette sub-family F (GCN20) member 169354671AVSEEQQPALK   
A199AABCF1, ABC50ATP-binding cassette sub-family F (GCN20) member 169354671AVSEEQQPALKGK   
A028BSMARCB1, BAF47, INI1SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 127545326AVSISTEPPTYLR   
A0097TLN1, TLNTalin 116753233AVSSAIAQLLGEVAQGNENYAGIAAR   
A0633YWHAH, YWHA114-3-3 protein eta4507951AVTELNEPLSNEDR   
A0907YWHAQ14-3-3 protein tau5803227AVTEQGAELSNEER   
A0467YWHAB14-3-3 protein beta/alpha21328448AVTEQGHELSNEER   
A0583PUF60, FIR, ROBPIPoly-U binding splicing factor PUF6017298690AVTPPMPLLTPATPGGLPPAAAVAAAAATAK   
A3812RPL860S ribosomal protein L815431306AVVGVVAGGGR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998AVVIVDDR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246AVVIVDDR   
A0967CUL2Cullin homolog 219482174AVVMLEYVER   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883AVVVCPKDEDYK   
A3731SLC25A11, SLC20A4Solute carrier family 25 member 1121361114AVVVNAAQLASYSQSK   
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunit4504041AVVYSNTIQSIMAIVK   
A0787FKBP4, FKBP52FK506-binding protein 44503729AWDIAIATMK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000AWEEYYK   
A4814FLNB, FLN3, TAPFilamin-B105990514AWGPGLHGGIVGR   
A260CNXF1, TAPNuclear RNA export factor 115487670AWLLSMIQSK   
A0978PYGLGlycogen phosphorylase, liver form71037379AWNTMVLK   
A4323FKBP3, FKBP25FK506-binding protein 34503727AWTVEQLR   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753AYAALAALEK   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505AYALAFAER   
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2148747351AYAQQLTEWAR   
A033BUSP39, CGI-21, HSPC332U4/U6.U5 TRI-SNRNP-associated protein 256550051AYDGTTYLPGIVGLNNIK   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012AYEFAER   
A5087PLS3Plastin 3209862851AYFHLLNQIAPK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427AYILNLVK   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264AYIQENLELVEK   
A3804EEF2, EF2Elongation factor 24503483AYLPVNESFGFTADLR   
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunit5031597AYLQQLR   
A1881TJP2, X104, ZO2Tight junction protein ZO-242518070AYSPEYR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388AYTNFDAER   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388AYTNFDAERDALNIETAIK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042AYVDDTPAEQMK   
A5792RNPEP, APBAminopeptidase B40316915AYVHEFK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519AYVSTLMGVPGR   
A1389CDC37, CDC37A, MBD5Hsp90 co-chaperone Cdc375901922CALMEQVAHQTIVMQFILELAK   
A6277DDX47, E4-DBP, MST162DEAD box protein 4720149629CAVSSKYQTVEK   
A639CTpr, tpr, TPRNuclear pore complex-associated protein TPR114155142CEDLEKQNR   
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunit13654237CGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFSR   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158CGEMAQAASAAVTRGDLR   
A0208RANGAP1, SDRan GTPase-activating protein 14506411CHWSDMFTGRLR   
A8684ATXN10, SCA10, E46LAtaxin-107106299CLRNACIECSVNQNSIR   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418CNRAGKPVICATQMLESMIK   
A6441LSS, OSCLanosterol synthase47933397CPHVTEHIPR   
A002AMYOF, FER1L3Myoferlin7305053CRLDMIPDLK   
A7449PNKP, DEM1Polynucleotide kinase-3'-phosphatase31543419CVTTCETALKQGK   
A899ARAE1, MRNP41mRNA-associated protein mrnp 4162739173CYCADVIYPMAVVATAER   
A607AINTS1, INT1, UNQ1821/PRO3434Integrator complex subunit 1122937317DAAAALSSASALTGLTK   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942DAAFEALGTALK   
A9484SRPRSignal recognition particle receptor alpha subunit23308697DAAGIAMEAIAFAR   
A0446CSE1L, CAS, XPO2Exportin-229029559DAAIYLVTSLASK   
A0430LMNB1, LMN2, LMNBLamin B15031877DAALATALGDK   
A0430LMNB1, LMN2, LMNBLamin B15031877DAALATALGDKK   
A0208RANGAP1, SDRan GTPase-activating protein 14506411DAALAVAEAMADK   
A2550SFRS5, SRSF5, HRSSerine/arginine-rich splicing factor 586991440DADDAVYELDGK   
A2552SRSF6, SFRS6, SRP55Serine/arginine-rich splicing factor 620127499DADDAVYELNGK   
A2141CORO1BCoronin 1B65787364DADPILISLR   
A1129SRSF9, SFRS9, SRP30CSerine/arginine-rich splicing factor 94506903DAEDAIYGR   
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 247271443DAEDAMDAMDGAVLDGR   
A2520ELAVL1, HURELAV-like protein 138201714DAERAINTLNGLR   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173DAESIHQYLLQR   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000DAFADAVQR   
A028BSMARCB1, BAF47, INI1SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 127545326DAFTWNMNEK   
A0204FLNA, FLN, FLN1Filamin A116063573DAGEGLLAVQITDPEGKPKK   
A4814FLNB, FLN3, TAPFilamin-B105990514DAGEGLLAVQITDQEGKPK   
A1308BLMHBleomycin hydrolase4557367DAGPLLISLK   
A2143CORO1A, CORO1Coronin-like protein p575902134DAGPLLISLK   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursor24234688DAGQISGLNVLR   
A0451HSPA5, GRP78Heat shock 70kDa protein 516507237DAGTIAGLNVMR   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892DAGVIAGLNVLR   
A7989TKT, TKT1Transketolase205277463DAIAQAVRGLITK   
A0029ANXA6, ANX6Annexin A671773415DAISGIGTDEK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475DALEFWLQAGVDGFQVRDIENLK   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388DALNIETAIK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427DALSDLALHFLNK   
A2520ELAVL1, HURELAV-like protein 138201714DANLYISGLPR   
A681CHDLBP, HBP, VGLVigilin42716280DAPWTASSSEK   
A369CRRBP1Ribosome-binding protein 1110611220DAQDVQASQAEADQQQTR   
A581AEIF5B, IF2Eukaryotic translation initiation factor 5B84043963DAQEMADSLGVR   
A8997RAB3GAP2, RAB3-GAP150RAB3 GTPase-activating protein non-catalytic subunit19923790DAQIGWIQTVEDLHER   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335DASDDLDDLNFFNQK   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657DASIVGFFDDSFSEAHSEFLK   
A3615ENO1, ENO1L1, MBPB1Alpha enolase4503571DATNVGDEGGFAPNILENK   
A3531KTN1, CG1, PDIA6Kinectin118498356DAVEHQRK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805DAVITVPVFFNQAER   
A3531KTN1, CG1, PDIA6Kinectin118498356DAVSNTTNQLESK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805DAVVYPILVEFTR   
A9769API5, MIG8, AAC11Apoptosis inhibitor 55729730DAYQVILDGVK   
A0284SAFB, HAP, HETScaffold attachment factor B21264343DDAYWPEAK   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027DDEENYLDLFSHK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211DDETMYVESK   
A371ETAGLN2, CDABP0035Transgelin 24507357DDGLFSGDPNWFPK   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursor4885281DDGSWEVIEGYR   
A1941PLEC1, PLECPlectin41322910DDGTGQLLLPLSDAR   
A2044SMARCA5, SNF2H, WCRF135SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily A, member 521071058DDIENIAR   
A8684ATXN10, SCA10, E46LAtaxin-107106299DDIPVFLR   
A710AMINA, MDIG, MINA53Myc-induced nuclear antigen23346418DDPALATYYGSLFK   
A9559RPL3, rpl3, ASC-160S ribosomal protein L34506649DDPSKPVHLTAFLGYK   
A2344ACTN4Alpha-actinin 412025678DDPVTNLNNAFEVAEK   
A7691RRM1, RR1Ribonucleoside-diphosphate reductase M1 chain4506749DDSIEGIYDTLK   
A242ERSL1D1, CATX11, CSIGRibosomal L1 domain-containing protein 1118498359DDVAPESGDTTVK   
A242ERSL1D1, CATX11, CSIGRibosomal L1 domain-containing protein 1118498359DDVAPESGDTTVKKPESK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475DDVAQTDLLQIDPNFGSK   
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunit12408656DEAFPPVPQSLGYK   
A492CSCRN1Secernin-126251972DEAWVLETIGK   
A0854PAWR, PAR4Prostate apoptosis response protein PAR-455769533DEEEPDGVPEK   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741DEEVHAGLGELLR   
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E123510340DEFEGLFK   
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A94721250DEGLRLR   
A2507PABPC4, APP1, PABP4Poly(A) binding protein, cytoplasmic 44504715DEGNYLDDALVR   
A4575ANXA4, PIG28, ANX4Annexin A44502105DEGNYLDDALVR   
A3816RPS340S ribosomal protein S315718687DEILPTTPISEQK   
A4357NPM1, NPMNucleophosmin10835063DELHIVEAEAMNYEGSPIK   
A581AEIF5B, IF2Eukaryotic translation initiation factor 5B84043963DELIHELK   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096DELKPAVTQLLWER   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381DELLPHILPLLK   
A2044SMARCA5, SNF2H, WCRF135SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily A, member 521071058DEMLQMIR   
A9493TFRCTransferrin receptor protein 1224192DENLALYVENQFR   
A639CTpr, tpr, TPRNuclear pore complex-associated protein TPR114155142DEPQEPSNKVPEQQR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847DEPTGEVLSLVGK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256DEQLESLFQR   
A4573ANXA11, ANX11Annexin A1122165433DESTNVDMSLAQR   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447DETNYGIPQR   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947DFAAEVVHPGDLK   
A031FRPRD1A, P15RSRegulation of nuclear pre-mRNA domain-containing protein 1A21361709DFAPVIVEAFK   
A377AEIF3C, EIF3S8Eukaryotic translation initiation factor 3 subunit C83700233DFESHITSYK   
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunit12408656DFFLANASR   
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 138327552DFFQSYGNVVELR   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471DFIKNMITGTSQADCAVLIVAAGVGEFEAGISK   
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like36796743DFILPISDVR   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588DFKPGDLIFAK   
A0396SLC25A5, ANT2ADP/ATP translocase 2156071459DFLAGGVAAAISK   
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T155749577DFLAGGVAAAVSK   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371DFLLKPELLR   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623DFLLKPELLR   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129DFLTHVSAR   
A712CXPO1, CRM1CRM1 protein4507943DFLVQIK   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029DFLYSYFK   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950DFMIQGGDFTR   
A2552SRSF6, SFRS6, SRP55Serine/arginine-rich splicing factor 620127499DFMRQAGEVTYADAHK   
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 18659555DFNDPSQDPDFTQVVELDLK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827DFNPTATVK   
A0978PYGLGlycogen phosphorylase, liver form71037379DFNVGDYIQAVLDR   
A9740PDLIM7, ENIGMAEnigma protein11496885DFNVPLSISR   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304DFPEYTFAIADEEDYAGEVK   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932DFPLNDLLSATELDK   
A7691RRM1, RR1Ribonucleoside-diphosphate reductase M1 chain4506749DFSYNYFGFK   
A3211CKAP4, P63P63 protein19920317DFTSLENTVEER   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529DFTVSAMHGDMDQK   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529DFTVSAMHGDMDQKER   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206DFVNYLVR   
A3579CYFIP1Cytoplasmic FMR1 interacting protein 124307969DFVSEAYLITLGK   
A452AGAR1, NOLA1Nucleolar protein family A, member 115011916DFYFSVK   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475DFYMTDSISR   
A046CIPO7, RANBP7RanBP7/importin 75453998DGALHMIGSLAEILLK   
A4317ERP29, ERP28Endoplasmic reticulum resident protein 295803013DGDFENPVPYTGAVK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939DGDVTVTNDGATILSMMDVDHQIAK   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657DGEEAGAYDGPR   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973DGELPVEDDIDLSDVELDDLGKDEL   
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursor4757732DGEQHEDLNEVAK   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029DGETPDPEDPSR   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392DGFGGLAAAR   
A443AFRG1FRG1 protein4758404DGFLHETLLDR   
A3656DDX1ATP-dependent RNA helicase DDX14826686DGFVALSK   
A895BARCN1, COPDCoatomer delta subunit11863154DGGLQNMELHGMIMLR   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159DGHGEAIMFK   
A2344ACTN4Alpha-actinin 412025678DGLAFNALIHR   
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5148727247DGLGGLPDIVR   
A553AHNRNPH3, HNRPH3Heterogeneous nuclear ribonucleoprotein H314141157DGMDNQGGYGSVGR   
A3671GLS, GLS1Glutaminase, kidney isoform, mitochondrial precursor156104878DGPGETDAFGNSEGK   
A1166XPOTExportin T8051636DGPVGFADFVYK   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447DGQAMLWDLNEGK   
A4200RCC2, TD60, TD-60Protein RCC2209969703DGQILPVPNVVVR   
A0850VIMVimentin62414289DGQVINETSQHHDDLE   
A7183NSUN2, SAKI, TRM4tRNA (cytosine-5-)-methyltransferase NSUN239995082DGQWFTDWDAVPHSR   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852DGSAFEDGLR   
A375AEIF2A, CDA02, MSTP004Eukaryotic translation initiation factor 2A54873624DGTAGIPNLQLYDVK   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076DGTGVVEFVR   
A172CMYO1CUnconventional myosin-Ic124494238DGTIDFTPGSELLITK   
A4814FLNB, FLN3, TAPFilamin-B105990514DGTYAVTYVPLTAGMYTLTMK   
A1129SRSF9, SFRS9, SRP30CSerine/arginine-rich splicing factor 94506903DGVGMVEYLR   
A8968PSMD326S proteasome non-ATPase regulatory subunit 325777612DGVIEASINHEK   
A744ANCBP1, CBP80, NCBP80 kDa nuclear cap binding protein4505343DGVLEEQIER   
A3586ACLYATP-citrate synthase38569421DGVYVLDLAAK   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867DGYAQILR   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076DGYDYDGYR   
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-beta5032179DHQYQFLEDAVR   
A002AMYOF, FER1L3Myoferlin7305053DHYIPNTLNPVFGR   
A602CTHOC2THO complex subunit 220799318DIAKEMK   
A2633CTR9, SH2BP1RNA polymerase-associated protein CTR9 homolog7661950DIAKGHLK   
A0361YWHAZ14-3-3 protein zeta/delta208973244DICNDVLSLLEK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847DIDAFWLQR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932DIDEVSSLLR   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883DIDIHEVR   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805DIEAKMMALDR   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076DIEDVFYK   
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor119622017DIEEIIDELK   
A415AEXOSC7, RRP42Exosome complex component RRP4221362903DIELSDDPYDCIR   
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunit163965364DIELVMSQANVSR   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920DIEQYYSTQIDEMPMNVADLI   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529DIETFYNTSIEEMPLNVADLI   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588DIFPYSENK   
A024BSMARCC2, BAF170SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily C, member 221237805DIGEGNLSTAAAAALAAAAVK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426DIILGMEISAPSQQR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388DIISDTSGDFR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388DIISDTSGDFRK   
A024FDDX42ATP-dependent RNA helicase DDX4245446747DILIDPIR   
A8192VRK1Serine/threonine protein kinase VRK14507903DILLQGLK   
A8192VRK1Serine/threonine protein kinase VRK14507903DILLQGLKAIGSK   
A248CNUP205Nuclear pore complex protein Nup20557634534DILQDVHDK   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904DILQNVFK   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852DINAVLIDMER   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158DINLDVNR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426DINLQDEDWNEFNDINK   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867DINQEVYNFLATAGAK   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206DINTDFLLVVLR   
A629AMKI67Antigen KI-67103472005DINTFLGTPVQK   
A9652RPS6, PNAS-2040S ribosomal protein S617158044DIPGLTDTTVPR   
A024FDDX42ATP-dependent RNA helicase DDX4245446747DIPVLVATDVAAR   
A8963PSMD1126S proteasome non-ATPase regulatory subunit 1128872725DIQENDEEAVQVK   
A3531KTN1, CG1, PDIA6Kinectin118498356DIQNMNFLLK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315DIQSLPQK   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 132455266DISLSDYK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794DISSIGLKTVIGELPPASSGSALAANVCK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677DISTNYYASQK   
A726AMTA2, MTA1L1, PIDMetastasis associated protein MTA214141170DITLFHAMDTLQR   
A3967KIF5B, KNS, KNS1Kinesin family member 5B4758648DITLTNDKPATAIGVIGNFTDAERR   
A0234ACTR3, ARP3Actin-like protein 35031573DITYFIQQLLR   
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 224638454DIVPGDIVEIAVGDK   
A909BCPNE3, CPN3Copine III4503015DIVQFVPFR   
A907BCPNE1, CPN1Copine-123397708DIVQFVPYR   
A8694CALUCalumenin precursor4502551DIVVQETMEDIDK   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602DKAPVQPQQSPAAAPGGTDEKPSGK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304DKDPPIPVAK   
A0145PRKACA, PKACA, KIN27cAMP-dependent protein kinase, alpha-catalytic subunit4506055DKDTLDFIR   
A351ESRBD1S1 RNA-binding domain-containing protein 1193786457DKDTLDFIR   
A1426RFC5Replication factor C subunit 56677723DKEFGSMVLELNASDDR   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757DKFPGEFMK   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135DKFQETSDEFEAAR   
A0787FKBP4, FKBP52FK506-binding protein 44503729DKFSFDLGK   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246DKGFGFIR   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408DKLDETGVALK   
A3286LRRC59, PRO1855Leucine-rich repeat-containing protein 5940254924DKLDGNELDLSLSDLNEVPVK   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998DKLESEMEDAYHEHQANLLR   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932DKPTYDEIFYTLSPVNGK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315DKPVYDELFYTLSPINGK   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447DKTIIMWK   
A6789IMPDH2, IMPD2Inosine-5'-monophosphate dehydrogenase 266933016DKYPNLQVIGGNVVTAAQAK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857DLADELALVDVIEDK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857DLADELALVDVIEDKLK   
A4814FLNB, FLN3, TAPFilamin-B105990514DLAEDAPWK   
A4815FLNC, ABPL, FLN2Filamin C116805322DLAEDAPWK   
A4815FLNC, ABPL, FLN2Filamin C116805322DLAEDAPWKK   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435DLAGSIIGK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216DLALVNDQLLGFVR   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625DLAQALINR   
A5617MPG, AAG, ANPGDNA-3-methyladenine glycosylase62632769DLAQDEAVWLER   
A2049CHD1L, ALC1Chromodomain helicase DNA binding protein 1-like148612870DLDAFENETAK   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564DLDAPDDVDFF   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250DLDDFQSWLSR   
A668AMATR3Matrin 362750354DLDELSRYPEDK   
A4158MLECMalectin7661948DLDIFDR   
A4814FLNB, FLN3, TAPFilamin-B105990514DLDIIDNYDYSHTVK   
A428BESYT1, FAM62A, MBC2Extended syntaptotagmin-114149680DLDKDDFLGR   
A0029ANXA6, ANX6Annexin A671773415DLEADIIGDTSGHFQK   
A1374LMNA, LMN1Lamin A/C27436946DLEALLNSK   
A7375PGM1Phosphoglucomutase 121361621DLEALMFDR   
A1374LMNA, LMN1Lamin A/C27436946DLEDSLAR   
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 394757926DLEEFFSTVGK   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586DLEGENIEIVFAKPPDQK   
A0446CSE1L, CAS, XPO2Exportin-229029559DLEGSDIDTR   
A370ATUFMElongation factor Tu, mitochondrial precursor34147630DLEKPFLLPVEAVYSVPGR   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586DLFEDELVPLFEK   
A691ACRSP3, MED23, ARC130Mediator of RNA polymerase II transcription subunit 2328558969DLFEPQTALLR   
A9769API5, MIG8, AAC11Apoptosis inhibitor 55729730DLFHIPPSYK   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757DLGFNGAPYR   
A3656DDX1ATP-dependent RNA helicase DDX14826686DLGLAFEIPPHMK   
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5148727247DLGYIYFYQR   
A6520FNTAProtein farnesyltransferase alpha subunit4503771DLHEEMNYITAIIEEQPK   
A4575ANXA4, PIG28, ANX4Annexin A44502105DLIDDLK   
A681CHDLBP, HBP, VGLVigilin42716280DLIIEQR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426DLILADYGK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121DLILNPR   
A5201TPT1, HDCMB21Tumor protein, translationally-controlled 14507669DLISHDEMFSDIYK   
A2633CTR9, SH2BP1RNA polymerase-associated protein CTR9 homolog7661950DLITQATLLYTMADK   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454DLIVATIAVK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414DLKDYFSK   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919DLKDYFTK   
A8017TPP2Tripeptidyl-peptidase II339880DLKEEFTEALR   
A1478CDK7, CAK, CAK1Cell division protein kinase 74502743DLKPNNLLLDENGVLK   
A0448CDK1, CDC2, CDC28ACrll division cycle 24502709DLKPQNLLIDDK   
A4576ANXA5, ANX5, ENX2Annexin A54502107DLLDDLK   
A4576ANXA5, ANX5, ENX2Annexin A54502107DLLDDLKSELTGK   
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3X87196351DLLDLLVEAK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794DLLDTVLPHLYNETK   
A7917FARSB, FRSB, FARSLBPhenylalanyl-tRNA synthetase beta chain124028525DLLFQALGR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657DLLIAYYDVDYEK   
A2341ACTN1Alpha-actinin 14501891DLLLDPAWEK   
A2344ACTN4Alpha-actinin 412025678DLLLDPAWEK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475DLLLTSSYLSDSGSTGEHTK   
A4182PDS5B, APRIN, AS3Sister chromatid cohesion protein PSD homolog B7657269DLLMNDR   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159DLLNMYIETEGK   
A9062SMNDC1, SMNR, SPF30Survival of motor neuron-related splicing factor 305032113DLLSTQPSETLASSDSFASTQPTHSWK   
A3531KTN1, CG1, PDIA6Kinectin118498356DLLTELQK   
A0029ANXA6, ANX6Annexin A671773415DLMTDLK   
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursor20127408DLNSDMDSILASLK   
A551CSRP68Signal recognition particle 68 kDa protein24497620DLPDVQELITQVR   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883DLPEHAVLK   
A838APDCD4, H731Programmed cell death 421735596DLPELALDTPR   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042DLPIKLNQWCNVVR   
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenase23308577DLPLLLFR   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932DLPPVSGSIIWAK   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305DLPVTEAVFSALVTGHAR   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768DLQANVEHLVQK   
A1166XPOTExportin T8051636DLQEFIPLINQITAK   
A9062SMNDC1, SMNR, SPF30Survival of motor neuron-related splicing factor 305032113DLQEVIELTK   
A0439PHB2, BAP, REAProhibitin 2221307584DLQMVNISLR   
A3793PHBProhibitin4505773DLQNVNITLR   
A468CSEC22B, SEC22L1Vesicle trafficking protein SEC22B94429050DLQQYQSQAK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601DLQSNVEHLTEK   
A3211CKAP4, P63P63 protein19920317DLSDGIHVVK   
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursor5802974DLSLDDFK   
A8890NARG1, NAA15, GA19NMDA receptor-regulated protein 117149828DLSLLQIQMR   
A278ACCAR1, CARP1, DISCell division cycle and apoptosis regulator protein 146852388DLSQLQENLK   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029DLSSHQLNEFLAQTLQR   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885DLTDYLMK   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881DLTDYLMK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216DLTEYLK   
A2541HNRNPDL, HNRPDL, JKTBPJKTBP214110407DLTEYLSR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135DLTLEENQVK   
A3586ACLYATP-citrate synthase38569421DLVSSLTSGLLTIGDR   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881DLYANNVMSGGTTMYPGIADR   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885DLYANTVLSGGTTMYPGIADR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388DLYDAGVK   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388DLYDAGVKR   
A998ASF3A3, SAP61Splicing factor 3A subunit 35803167DLYDDKDGLR   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755DLYEDELVPLFEK   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursor41399285DMAIATGGAVFGEEGLTLNLEDVQPHDLGK   
A024BSMARCC2, BAF170SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily C, member 221237805DMDEPSPVPNVEEVTLPK   
A026FORC5L, ORC5Origin recognition complex subunit 54505525DMEANLLPGFLR   
A023BSMARCC1, BAF155SWI/SNF complex subunit SMARCC121237802DMEDPTPVPNIEEVVLPK   
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursor48255889DMEESIR   
A6985MCM4, CDC21DNA replication licensing factor MCM433469919DMFEEALR   
A1927DNM2, DYN2Dynamin 256549119DMILQFISR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932DMLEAGILDTYLGK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827DMLLEVK   
A681CHDLBP, HBP, VGLVigilin42716280DMNQFGEGEQAK   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998DMRMGGGGAMNMGDPYGSGGQK   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471DMRQTVAVGVIK   
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 24503475DMRQTVAVGVIK   
A9060SRISorcin4507207DMSGTMGFNEFK   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159DMSQMILR   
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit I4503513DMTMFVTASK   
A6264DDX17ATP-dependent RNA helicase DDX17148613856DMVGIAQTGSGK   
A550CSRP54Signal recognition particle 54 kDa protein4507215DMYEQFQNIMK   
A308CQKI, HKQ, QUAKINGQuaking45827706DMYNDTLNGSTEKR   
A257CNUP93Nuclear pore complex protein Nup9321706468DNALLSAIEESR   
A0326VIL2, EZREzrin161702986DNAMLEYLK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984DNGKHALIIYDDLSK   
A9709ECM29Proteasome-associated protein ECM29 homolog122937211DNHSPEIQHGSLLALGFTVGRYLAK   
A7910CARSCysteinyl-tRNA synthetase62240992DNILPELGVR   
A0850VIMVimentin62414289DNLAEDIMR   
A0850VIMVimentin62414289DNLAEDIMRLR   
A3584FASN, FASFatty acid synthase41872631DNLEFFLAGIGR   
A3568PSMD126S proteasome non-ATPase regulatory subunit 125777600DNLEWLAR   
A0280YWHAE14-3-3 protein epsilon5803225DNLTLWTSDMQGDGEEQNK   
A0207RCC1, CHC1Regulator of chromosome condensation114796642DNNGVIGLLEPMK   
A0207RCC1, CHC1Regulator of chromosome condensation114796642DNNGVIGLLEPMKK   
A3286LRRC59, PRO1855Leucine-rich repeat-containing protein 5940254924DNPLDPVLAK   
A033APDCD6, ALG2, AHRRProgrammed cell death protein 67019485DNSGMIDKNELK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191DNSTMGYMAAK   
A0295PPP2R1ASerine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoform21361399DNTIEHLLPLFLAQLK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211DNTINLIHTFR   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159DNYLFLK   
A172CMYO1CUnconventional myosin-Ic124494238DNYPQSVPR   
A4576ANXA5, ANX5, ENX2Annexin A54502107DPDAGIDEAQVEQDAQALFQAGELK   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158DPEAEAALELALSITR   
A9655RPSA, LAMBR, LAMR140S ribosomal protein SA59859885DPEEIEKEEQAAAEK   
A009ANCLNNicalin precursor51873031DPEFVFYDQLK   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481DPFAHLPK   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158DPGVITYDLPTPPGEK   
A581AEIF5B, IF2Eukaryotic translation initiation factor 5B84043963DPIVMGVTVEAGQVK   
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit I4503513DPIVNVWYSVNGER   
A4379PSMD526S proteasome non-ATPase regulatory subunit 54826952DPLELFR   
A3960MYO6Unconventional myosin-VI92859701DPLLDDHGDFIR   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602DPNNLFMVR   
A8964PSMD1226S proteasome non-ATPase regulatory subunit 124506221DPNNLLNDWSQK   
A0492STIP1Stress-induced-phosphoprotein 15803181DPQALSEHLK   
A8207XRN25'-3' exoribonuclease 218860916DPQFAEDYIFK   
A280ACCNK, CPR4Cyclin K150417989DPQQPAQQQQPAQQPK   
A0098VCLVinculin4507877DPSASPGDAGEQAIR   
A6520FNTAProtein farnesyltransferase alpha subunit4503771DPSQELEFIADILNQDAK   
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit I4503513DPSQIDNNEPYMK   
A7849SPCS2, SPC25Signal peptidase complex subunit 2133777120DPTGMDPDDIWQLSSSLK   
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunit13654237DPTVHDDVLELEMDELNR   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418DPVQEAWAEDVDLR   
A6029CDK9, CDC2L4, TAKCell division protein kinase 94502747DPYALDLIDK   
A1941PLEC1, PLECPlectin41322910DPYTEQTISLFQAMK   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741DQAVENILVSPVVVASSLGLVSLGGK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042DQDLEPGAPSMGAK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425DQEALEAVKR   
A669AMYBBP1A, P160MYB-binding protein 1A157694492DQEALMKSVK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394DQEGQDVLLFIDNIFR   
A7920HARS, HRSHistidyl-tRNA synthetase, cytoplasmic6996014DQGGELLSLR   
A681CHDLBP, HBP, VGLVigilin42716280DQGLSIMVSGK   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529DQIYDIFQK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857DQLIYNLLK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857DQLIYNLLKEEQTPQNK   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327DQLLLGPTYATPK   
A0782NuMA, NUMA1, NUMANuMA protein71361682DQLQEQLQALK   
A002AMYOF, FER1L3Myoferlin7305053DQLRPTQLLQNVAR   
A3656DDX1ATP-dependent RNA helicase DDX14826686DQLSVLENGVDIVVGTPGR   
A0430LMNB1, LMN2, LMNBLamin B15031877DQMQQQLNDYEQLLDVK   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase P4504183DQQEAALVDMVNDGVEDLR   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399DQTIVDPFSSK   
A573AIGF2BP1, IMP-1, CRDBPInsulin-like growth factor 2 mRNA-binding protein 156237027DQTPDENDQVIVK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191DQVANSAFVER   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042DQVDIAVQELLQLK   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311DQVNTVGIPI   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945DQVTAQEIFQDNHEDGPTAK   
A002AMYOF, FER1L3Myoferlin7305053DRDNDSDDVESNLLLPAGIALR   
A5617MPG, AAG, ANPGDNA-3-methyladenine glycosylase62632769DRELCSGPSK   
A4231STAG1, SA1Cohesin subunit SA-162243696DRIVSMTLDK   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173DRVALSNMNVIDR   
A0782NuMA, NUMA1, NUMANuMA protein71361682DSALETLQGQLEEK   
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolic22547186DSDVEVYNIIK   
A663CUSO1, VDPGeneral vesicular transport factor p1154505541DSEQVAELKQELATLK   
A7010MAT2A, AMS2, MATA2S-adenosylmethionine synthetase gamma form5174529DSFPWEVPK   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555DSGSFVAFQNIPGSELMSSFAK   
A0668RUVBL1, INO80H, NMP238RuvB-like 14506753DSIEKEHVEEISELFYDAK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211DSIVHQAGMLK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113DSIVQGFQWGTR   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027DSLDPSFTHAMQLLTAEIEK   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841DSLIFLVDASK   
A1395MSH2DNA mismatch repair protein Msh24557761DSLIIIDELGR   
A1405RAD50DNA repair protein RAD5019924129DSLIQSLATQLELDGFER   
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3X87196351DSLTLVFVETK   
A024FDDX42ATP-dependent RNA helicase DDX4245446747DSNFAGDLVR   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursor4885281DSNYHLLMSVQESLER   
A753ACOBRA1, NELFBNegative elongation factor B20070260DSPDLLLLLR   
A1941PLEC1, PLECPlectin41322910DSQDAGGFGPEDR   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867DSSGQHVDVSPTSQR   
A2135SMU1, SMU-1WD40 repeat-containing protein SMU1109948304DSSQILSASFDQTIR   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305DSTEYFIVFEPR   
A0280YWHAE14-3-3 protein epsilon5803225DSTLIMQLLR   
A0361YWHAZ14-3-3 protein zeta/delta208973244DSTLIMQLLR   
A0362YWHAG14-3-3 protein gamma21464101DSTLIMQLLR   
A0467YWHAB14-3-3 protein beta/alpha21328448DSTLIMQLLR   
A0633YWHAH, YWHA114-3-3 protein eta4507951DSTLIMQLLR   
A0907YWHAQ14-3-3 protein tau5803227DSTLIMQLLR   
A3804EEF2, EF2Elongation factor 24503483DSVVAGFQWATK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885DSYVGDEAQSK   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881DSYVGDEAQSK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885DSYVGDEAQSKR   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881DSYVGDEAQSKR   
A043CKPNB1, NTF97Importin beta-1 subunit19923142DTAAWTVGR   
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4192807312DTALETALNAK   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399DTAYPETNDAIPMISK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211DTDAAVGDNIGYITFVLFPR   
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunit5031597DTDIVDEAIYYFK   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065DTLVADNLDQATR   
A3813RPL10A, NEDD660S ribosomal protein L10a15431288DTLYEAVR   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397DTNGENIAESLVAEGLATR   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950DTNGSQFFITTVK   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942DTNVMLVALAAK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397DTPDEPWAFPAR   
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor119622017DTPENNPDTPFDFTPENYK   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117DTPGHGSGWAETPR   
A0967CUL2Cullin homolog 219482174DTPQEMEQTR   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741DTQSGSLLFIGR   
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursor20127408DTSASAVAVGLK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425DTSATTALELVAGER   
A3568PSMD126S proteasome non-ATPase regulatory subunit 125777600DTSEDIEELVEPVAAHGPK   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602DTSLYRPALEELRR   
A2515TIAL1Nucleolysin TIAR4507499DTSNHFHVFVGDLSPEITTEDIK   
A0207RCC1, CHC1Regulator of chromosome condensation114796642DTSVEGSEMVPGK   
A3584FASN, FASFatty acid synthase41872631DTVTISGPQAPVFEFVEQLR   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139DTYGVRPLFK   
A086BTCEA1, GTF2S, TFIISTranscription elongation factor A protein 15803191DTYVSSFPR   
A2173HMGB3, HMG2A, HMG4High mobility group protein B371143137DVADYKSK   
A2102COPACoatomer alpha subunit148536855DVAVMQLR   
A527CSNX6Sorting nexin 688703041DVDDFFEHER   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919DVDEAYMNK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919DVDEAYMNKVELESR   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907DVDFEGTDEPIFGK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939DVDFELIK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939DVDFELIKVEGK   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264DVDGLTSINAGR   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259DVEDEETWIR   
A2520ELAVL1, HURELAV-like protein 138201714DVEDMFSR   
A2135SMU1, SMU-1WD40 repeat-containing protein SMU1109948304DVEEEKFPTQLSR   
A6267DDX21Nucleolar RNA helicase 250659095DVESYIHR   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193DVFISAAER   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 14507879DVFTKGYGFGLIK   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973DVIELTDDSFDK   
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating40068518DVLGMAQDEMAQAFEDWNK   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241DVLLPWYNAYR   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447DVLSVAFSSDNR   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447DVLSVAFSSDNRQIVSGSR   
A2492LMNB2, LMN2Lamin B227436951DVMQQQLAEYQELLDVK   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283DVNAAIATIK   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309DVNAAIATIK   
A1405RAD50DNA repair protein RAD5019924129DVNGELIAVQR   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675DVPAYSQDTFK   
A4121FANCIFanconi anemia group I protein82830440DVPLTAEEVEFVVEK   
A744ANCBP1, CBP80, NCBP80 kDa nuclear cap binding protein4505343DVPNPNQDDDDDEGFSFNPLK   
A0224FSCN1, FAN1, HSNFascin 14507115DVPWGVDSLITLAFQDQR   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597DVQDSLTVSNEAQTAK   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371DVQEIFR   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623DVQEIFR   
A550CSRP54Signal recognition particle 54 kDa protein4507215DVQELLTQYTK   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503DVQGTDASLDEELDR   
A1389CDC37, CDC37A, MBD5Hsp90 co-chaperone Cdc375901922DVQMLQDAISK   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454DVSELTGFPEMLGGR   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486DVTHPRMR   
A3520SEPT7, CDC10Septin-7148352329DVTNNVHYENYR   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960DVVENGETADQTLSLMEQLR   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158DVVEPLLRPQWYVR   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor46593007DVVFNYLHATAFQGTPLAQAVEGPSENVR   
A0181MAPK1, ERK2, PRKM1Mitogen-activated protein kinase 166932916DVYIVQDLMETDLYK   
A2555RBMX, HNRPG, RBMXP1Heterogeneous nuclear ribonucleoprotein G56699409DVYLSPR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323DWNVDLIPK   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195DWSHYFK   
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p684758138DWVLNEFK   
A6264DDX17ATP-dependent RNA helicase DDX17148613856DWVLNEFR   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723DWYDVK   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586DYAFIHFDER   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435DYDDMSPR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435DYDDMSPRR   
A1941PLEC1, PLECPlectin41322910DYELQLVTYK   
A2341ACTN1Alpha-actinin 14501891DYETATLSEIK   
A2187UBTF, UBF, UBF1Nucleolar transcription factor 17657671DYEVELLR   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072DYFEEYGK   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329DYFEKYGK   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445DYFEQYGK   
A3588PYGBGlycogen phosphorylase, brain form21361370DYFFALAHTVR   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091DYFLFNPVTDIEEIIR   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173DYFNVPYPLPK   
A1135PTBP1, PTBPolypyrimidine tract-binding protein 14506243DYGNSPLHR   
A2173HMGB3, HMG2A, HMG4High mobility group protein B371143137DYGPAKGGK   
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursor5802974DYGVLLEGSGLALR   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121DYIVVGSDSGR   
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunit4758774DYKVDQEIINIMQDR   
A6984MCM3, HCC5DNA replication licensing factor MCM36631095DYLDFLDDEEDQGIYQSK   
A0098VCLVinculin4507877DYLIDGSR   
A3615ENO1, ENO1L1, MBPB1Alpha enolase4503571DYPVVSIEDPFDQDDWGAWQK   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335DYTYEELLNR   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397DYVAPTANLDQK   
A0978PYGLGlycogen phosphorylase, liver form71037379DYYFALAHTVR   
A040BBCAS2, DAM1Pre-mRNA-splicing factor SPF275031653EAAAALVEEETRR   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471EAAEMGKGSFK   
A0280YWHAE14-3-3 protein epsilon5803225EAAENSLVAYK   
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyase18375505EAAGEGPALYEDPPDQK   
A032BSART1SART-110863889EAAGTTAAAGTGGATEQPPR   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327EAALGAGFSDK   
A1374LMNA, LMN1Lamin A/C27436946EAALSTALSEK   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715EAAMEAEIKAAR   
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursor20070125EADDIVNWLK   
A7908AARSAlanyl-tRNA synthetase109148542EADGILKPLPK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397EADGSETPEPFAAEAK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418EAEAAIYHLQLFEELR   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418EAEAAIYHLQLFEELRR   
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 96274550EAEEEFWYR   
A0782NuMA, NUMA1, NUMANuMA protein71361682EAEQMGNELER   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158EAFLQEVWK   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139EAFSDGITSVK   
A4814FLNB, FLN3, TAPFilamin-B105990514EAFTNKPNVFTVVTR   
A894BCOPB1, COPB, MSTP026Coatomer beta subunit221316632EAGELKPEEEITVGPVQK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805EAGMQPQLQIR   
A1489ITGA3, MSK18Integrin alpha-3 precursor6006011EAGNPGSLFGYSVALHR   
A022FFAM50B, X5L, D6S2654EXAP-5-like protein6912326EAGRAMHLLK   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306EAGVEMGDEDDLSTPNEK   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306EAGVEMGDEDDLSTPNEKLLGHLVK   
A3586ACLYATP-citrate synthase38569421EAGVFVPR   
A1944FEN1, RAD2Flap endonuclease-14758356EAHQLFLEPEVLDPESVELK   
A2344ACTN4Alpha-actinin 412025678EAILAIHK   
A0029ANXA6, ANX6Annexin A671773415EAILDIITSR   
A332CRAB7A, RAB7Ras-related protein Rab-7A34147513EAINVEQAFQTIAR   
A552CSRP72Signal recognition particle 72 kDa protein109638749EAISDLQQLWK   
A6271DDX27, RHLP, HSPC259Probable ATP-dependent RNA helicase DDX2719743937EAIVAALLTR   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259EAIVTSEELGQDLEHVEVLQK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305EAIYSGYIR   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228EAKESFQR   
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A94721250EAKPDELMDSK   
A907BCPNE1, CPN1Copine-123397708EALAQTVLAEVPTQLVSYFR   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454EALGIPAAASFK   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065EALIAASETLK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603EALLSSAVDHGSDEVK   
A2330EEA1, ZFYVE2Early endosome antigen 155770888EALMTELSTVK   
A552CSRP72Signal recognition particle 72 kDa protein109638749EALNVINTHTK   
A3568PSMD126S proteasome non-ATPase regulatory subunit 125777600EALQLMATYLPK   
A257CNUP93Nuclear pore complex protein Nup9321706468EALQYFYFLR   
A587AEIF4H, WBSCR1, WSCR1Eukaryotic translation initiation factor 4H11559923EALTYDGALLGDR   
A047CIPO9, IMP9, RANBP9Importin-921361659EALVDTLTGILSPVQEVR   
A2536NCLNucleolin55956788EAMEDGEIDGNK   
A2536NCLNucleolin55956788EAMEDGEIDGNKVTLDWAKPK   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926EAMNDPLLER   
A788ANOP56, NOL5ANucleolar protein Nop5632483374EAMVQAEEAAAEITR   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259EANELQQWINEK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920EANFTVSSMHGDMPQK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301EANNFLWPFK   
A033BUSP39, CGI-21, HSPC332U4/U6.U5 TRI-SNRNP-associated protein 256550051EAPASVVPFVR   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129EAPEPGMEVVK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519EAPNPIHLTVDTSLQNGRMSIK   
A637BTMEM109Transmembrane protein 109 precursor13129092EAPVDVLTQIGR   
A637BTMEM109Transmembrane protein 109 precursor13129092EAPVDVLTQIGRSVR   
A0326VIL2, EZREzrin161702986EAQDDLVKTK   
A6267DDX21Nucleolar RNA helicase 250659095EAQELSQNSAIK   
A2330EEA1, ZFYVE2Early endosome antigen 155770888EAQNDLEQVLR   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597EASDPQPEEADGGLK   
A0924TOP2A, TOP2DNA topoisomerase 219913406EASHKQIMENAEINNIIK   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408EASHKQIMENAEINNIIK   
A8963PSMD1126S proteasome non-ATPase regulatory subunit 1128872725EASIDILHSIVK   
A0782NuMA, NUMA1, NUMANuMA protein71361682EASLRER   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330EASYSLIR   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753EATDAIGHLDR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657EATNPPVIQEEKPK   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555EATQILSVPK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603EAVAMESYAK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677EAVEKEFEPLLNWMK   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368EAVQLVNTR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426EAVVNTQELLDLLVK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984EAYPGDVFYLHSR   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283EDAANNYAR   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309EDAANNYAR   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968EDAIEHFMKLYEEK   
A0808MSNMoesin4505257EDAVLEYLK   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029EDDLNSFNATDLK   
A7732POLR1BDNA-directed RNA polymerase I 135 kDa polypeptide33469941EDDSFLR   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475EDFDSLLQSAK   
A0446CSE1L, CAS, XPO2Exportin-229029559EDFPQKWPDLLTEMVNR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932EDGAISTIVLR   
A3584FASN, FASFatty acid synthase41872631EDGLAQQQTQLNLR   
A177BYB-1, YBX1, NSEP1Nuclease sensitive element binding protein 134098946EDGNEEDKENQGDETQGQQPPQR   
A5201TPT1, HDCMB21Tumor protein, translationally-controlled 14507669EDGVTPYMIFFK   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867EDIANLADEFK   
A7691RRM1, RR1Ribonucleoside-diphosphate reductase M1 chain4506749EDIDAAIETYNLLSER   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945EDIIQGFR   
A912ARBM25, RNPC7, S164U1 small nuclear ribonucleoprotein 1 SNRP homolog55741709EDINAIEMEEDKR   
A894BCOPB1, COPB, MSTP026Coatomer beta subunit221316632EDIQSVMTEIR   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753EDITQSAQHALR   
A2548HNRNPA0, HNRPA0Heterogeneous nuclear ribonucleoprotein A05803036EDIYSGGGGGGSR   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159EDLKDMSQMILR   
A542AHMGN1, HMG14Non-histone chromosomal protein HMG-1448255933EDLPAENGETKTEESPASDEAGEK   
A3807RPLP060S acidic ribosomal protein P016933546EDLTEIR   
A3804EEF2, EF2Elongation factor 24503483EDLYLKPIQR   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283EDMAALEK   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309EDMAALEK   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771EDSAVFYELK   
A4103CUL4BCullin-4B121114298EDSLDSVLFLK   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329EDTEEYNLR   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602EDVLTLLLPVMGDSK   
A3991MTDH, AEG1, LYRICProtein Lyric28277147EEAAAVPAAAPDDLALLK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995EEACKAVQEIMQEK   
A0850VIMVimentin62414289EEAENTLQSFR   
A383AEIF3J, EIF3S1, PRO0391Eukaryotic translation initiation factor 3 subunit 183281438EEAEVKPEVKISEK   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715EEAIQNFK   
A629AMKI67Antigen KI-67103472005EEAQSLEDLAGFK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677EEASDYLELDTIK   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945EEASGSSVTAEEAKK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995EEAWVIGSVVAR   
A0029ANXA6, ANX6Annexin A671773415EEDDVVSEDLVQQDVQDLYEAGELK   
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-beta5032179EEDGSLSLDGADSTGVVAK   
A4275BAT3, BAG6, G3Large proline-rich protein BAT3149158696EEDQRLINLVGESLR   
A410AEXOSC2, RRP4Exosome component 219923403EEEAGGFIANLEPVSLADR   
A0452CANXCalnexin precursor66933005EEEEEKEEEK   
A3531KTN1, CG1, PDIA6Kinectin118498356EEELNAIR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998EEEMMIRQR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847EEEVTGPVIAPLFPQK   
A8694CALUCalumenin precursor4502551EEFTAFLHPEEYDYMK   
A370ATUFMElongation factor Tu, mitochondrial precursor34147630EEGGRHKPFVSHFMPVMFSLTWDMACR   
A4814FLNB, FLN3, TAPFilamin-B105990514EEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSK   
A3731SLC25A11, SLC20A4Solute carrier family 25 member 1121361114EEGVLTLWR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847EEGWWVVIGDAK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191EEKESEDKPEIEDVGSDEEEEK   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597EELEALFLPYDLK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426EELGLIEQAYDNPHEALSR   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195EELLFMK   
A998ASF3A3, SAP61Splicing factor 3A subunit 35803167EELNAISGPNEFAEFYNR   
A0430LMNB1, LMN2, LMNBLamin B15031877EELRELNDR   
A2492LMNB2, LMN2Lamin B227436951EELRELNDR   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529EELTLEGIR   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529EELTLEGIRQFYINVER   
A002AMYOF, FER1L3Myoferlin7305053EELYMPPLVIK   
A3586ACLYATP-citrate synthase38569421EEMGIGGVLGLLWFQK   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399EENAEQQALAAK   
A555AHNRNPUL2, HNRPUL2, BSCL2Heterogeneous nuclear ribonucleoprotein U-like protein 2118601081EEPFFPPPEEFVFIHAVPVEER   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677EESDDEAAVEEEEEEKKPK   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679EETQPPVALK   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679EETQPPVALKK   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368EEVEDLCR   
A7736POLR2E, RPABC1DNA-directed RNA polymerase II polypeptide E14589951EEVTELLAR   
A6671COLGALT1, GLT25D1Procollagen galactosyltransferase 131377697EEYGFLPVPLR   
A6267DDX21Nucleolar RNA helicase 250659095EEYQLVQVEQK   
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 224638454EFDELNPSAQR   
A4629CALD1, CAD, CDMCaldesmon4826657EFDPTITDASLSLPSR   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241EFEDAFPADFIAEGIDQTR   
A773ANOC3L, AD24, FAD24Nucleolar complex protein 3 homolog20806097EFEEGLVSQYK   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715EFEEYIR   
A9485SRPRB, APMCF1Signal recognition particle receptor beta subunit14917113EFEFSQLPLK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677EFEPLLNWMK   
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1B11034845EFESVLVDAFSHVAR   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942EFGFSGLNVK   
A8086UAP1, SPAG2UDP-N-acetylhexosamine pyrophosphorylase 1156627575EFHAPLIIDENGVHELVK   
A994ASETSET protein338039EFHLNESGDPSSK   
A3525SEPT8, SEPT8Septin-8149363638EFLSELQR   
A059BSTRAP, MAWD, UNRIPSerone-threonine kinase receptor-associated protein148727341EFLVAGGEDFK   
A1222RPL5, MSTP03060S ribosomal protein L514591909EFNAEVHR   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586EFNEDGALAVLQQFK   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755EFNEEGALSVLQQFK   
A1164IPO5, KPNB3, RANBP5Importin 524797086EFQQYLPVVMGPLMK   
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUS4826734EFSGNPIK   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039EFSITDVVPYPISLR   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787EFSPFGTITSAK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156EFSTNNPFK   
A381AEIF3H, EIF3S3Eukaryotic translation initiation factor 3 subunit 34503515EFTAQNLGK   
A3793PHBProhibitin4505773EFTEAVEAK   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597EGAAHAFAQYNMDQFTPVK   
A6267DDX21Nucleolar RNA helicase 250659095EGAFSNFPISEETIK   
A3657PYCR1, PIG45Pyrroline-5-carboxylate reductase24797095EGATVYATGTHAQVEDGR   
A027FPAF1, PD2RNA polymerase II-associated factor 1 homolog42476169EGDGVYYNELETR   
A1374LMNA, LMN1Lamin A/C27436946EGDLIAAQAR   
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit I4503513EGDLLFTVAK   
A4121FANCIFanconi anemia group I protein82830440EGDLTNLLQNQAVK   
A724AMRTO4, MRT4mRNA turnover protein 4 homolog18490987EGDVLTPEQAR   
A3586ACLYATP-citrate synthase38569421EGDYVLFHHEGGVDVGDVDAK   
A596AILF2, NF45, PRO3063Interleukin enhancer binding factor 2, 45kD24234747EGEEEEENTEEPPQGEEEESMETQE   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254EGEFVAQFK   
A6029CDK9, CDC2L4, TAKCell division protein kinase 94502747EGFPITALR   
A1164IPO5, KPNB3, RANBP5Importin 524797086EGFVEYTEQVVK   
A8828PDAP1, HASPP2828 kDa heat- and acid-stable phosphoprotein7657441EGGDGAAGDPK   
A024BSMARCC2, BAF170SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily C, member 221237805EGGGAIEEEAKEK   
A6086CNDP1, CN1, CPGL2Beta-Ala-His dipeptidase precursor7023109EGGSIPVTLTFQEATGK   
A6663GSSGlutathione synthetase4504169EGIAQTVFLGLNR   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762EGIDPTPYYWYTDQR   
A2591SSB, SS-B/LaLupus La protein10835067EGIILFK   
A3804EEF2, EF2Elongation factor 24503483EGIPALDNFLDK   
A3804EEF2, EF2Elongation factor 24503483EGIPALDNFLDKL   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091EGIPGLYR   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor208022622EGIPPDQQRLIFAGK   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193EGIREETVSLR   
A283ACDC73, HRPT2Parafibromin40018640EGIVQTEQIR   
A4314DNAJC8, SPF31, HSPC315DnaJ homolog subfamily C member 8112293277EGKPTIVEEDDPELFK   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942EGLDEVAGIINDAK   
A3615ENO1, ENO1L1, MBPB1Alpha enolase4503571EGLELLK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594EGLELPEDEEEK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191EGLELPEDEEEKK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594EGLELPEDEEEKK   
A3159DPF2, BAF45D, REQZinc-finger protein ubi-d45454004EGLISQDGSSLEALLR   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827EGLLFEGR   
A4684CGI-99, CLE7UPF0568 protein C14ORF1667706322EGLPVALDK   
A351ESRBD1S1 RNA-binding domain-containing protein 1193786457EGMEKIAER   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425EGMFNNANVLFK   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250EGMQLISEKPETEAVVK   
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursor10864011EGNAIFTFPNTPVK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394EGNDLYHEMIESGVINLK   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305EGNQEVPFDVPELWYEDEK   
A1419RFC2, RFC40Replication factor C subunit 231563534EGNVPNIIIAGPPGTGK   
A679AMCTS1, MCT1, MCT-1Malignant T cell amplified sequence 17662502EGPFYPTLR   
A8964PSMD1226S proteasome non-ATPase regulatory subunit 124506221EGRLQEVIETLLSLEK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603EGTIGDMAILGITESFQVK   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867EGWPLDIR   
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyase18375505EGYSGVGLLSR   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471EHALLAYTLGVK   
A0446CSE1L, CAS, XPO2Exportin-229029559EHDPVGQMVNNPK   
A008BSIN3APaired amphipathic helix protein Sin3a223941785EHLAQKPVFLPRNLR   
A3531KTN1, CG1, PDIA6Kinectin118498356EHLEMELEK   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932EHQISPGDFPSLR   
A086BTCEA1, GTF2S, TFIISTranscription elongation factor A protein 15803191EHQMAKTGGTQTDLFTCGK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892EIAEAYLGYPVTNAVITVPAYFNDSQR   
A553AHNRNPH3, HNRPH3Heterogeneous nuclear ribonucleoprotein H314141157EIAENALGKHK   
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like protein11067747EIDDTYIEDAADVDAR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847EIDLLLGQTDDTR   
A0242CAV1, CAV, MSTP085Caveolin-115451856EIDLVNRDPK   
A0208RANGAP1, SDRan GTPase-activating protein 14506411EIEDFDSLEALR   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597EIELPSGQLMGLFNR   
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursor14603136EIEQEAAVELSQLR   
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunit4506003EIFLSQPILLELEAPLK   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096EIGQKCPQELSR   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283EIIDLVLDR   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309EIIDLVLDR   
A065BXAB2, HCNP, SYF1Pre-mRNA-splicing factor SYF155770906EIINTYTEAVQTVDPFK   
A0098VCLVinculin4507877EILGTCKMLGQMTDQVADLR   
A4273BAG2BAG-family molecular chaperone regulator-24757834EILLEMIHSIQNSQDMR   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486EILSEVER   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216EINSDQATQGNISSDR   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216EINSDQATQGNISSDRGK   
A669AMYBBP1A, P160MYB-binding protein 1A157694492EIPSATQSPISK   
A669AMYBBP1A, P160MYB-binding protein 1A157694492EIPSATQSPISKK   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315EIPYTFEDR   
A3531KTN1, CG1, PDIA6Kinectin118498356EIQNGNLHESDSESVPRDFK   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323EIRPALELLEPIEQK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885EITALAPSTMK   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881EITALAPSTMK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885EITALAPSTMKIK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984EIVTNFLAGFEA   
A5224TPM4Tropomyosin alpha 4 chain4507651EKAEGDVAALNR   
A8958PSMC3, TBP126S protease regulatory subunit 6A21361144EKAPSIIFIDELDAIGTK   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311EKDGEFSVLQLVGMLR   
A912ARBM25, RNPC7, S164U1 small nuclear ribonucleoprotein 1 SNRP homolog55741709EKEELEEIR   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939EKFEEMIQQIK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425EKLEAEMK   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246EKLEMEMEAAR   
A0850VIMVimentin62414289EKLQEEMLQR   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335EKNPDMVAGEK   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753EKPTTALLDK   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883EKPYFPIPEEYTFIQNVPLEDR   
A038CKPNA2, RCH1, SRP1Importin alpha-2 subunit4504897EKQPPIDNIIR   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757ELAAQLNEEAK   
A3816RPS340S ribosomal protein S315718687ELAEDGYSGVEVR   
A380AEIF3G, EIF3S4Eukaryotic translation initiation factor 3 subunit 449472822ELAEQLGLSTGEK   
A3656DDX1ATP-dependent RNA helicase DDX14826686ELAEQTLNNIK   
A6265DDX18ATP-dependent RNA helicase DDX1838327634ELAMQTFGVLK   
A6264DDX17ATP-dependent RNA helicase DDX17148613856ELAQQVQQVADDYGK   
A0433TPI1, TPI, TIMTriosephosphate isomerase 14507645ELASQPDVDGFLVGGASLKPEFVDIINAK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920ELAVQIQK   
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3X87196351ELAVQIYEEAR   
A5617MPG, AAG, ANPGDNA-3-methyladenine glycosylase62632769ELCSGPSKLCQALAINK   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206ELDALDANDELTPLGR   
A0492STIP1Stress-induced-phosphoprotein 15803181ELDPTNMTYITNQAAVYFEK   
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein154354962ELDSITPEVLPGWK   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065ELEANVLATAPDK   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228ELEDLEGYQNTIVAGSLITK   
A3525SEPT8, SEPT8Septin-8149363638ELEEETNAFNR   
A3823RPS840S ribosomal protein S84506743ELEFYLR   
A639CTpr, tpr, TPRNuclear pore complex-associated protein TPR114155142ELENANDLLSATK   
A1420RFC4Replication factor C subunit 431881687ELFGPELFR   
A4527TOMM40, PEREC1, TOM40Mitochondrial import receptor subunit TOM40 homolog193083122ELFPIQMEGVK   
A201AACTL6A, BAF53, BAF53AActin-like protein 6A4757718ELFQEMNIELVPPYMIASK   
A0782NuMA, NUMA1, NUMANuMA protein71361682ELGELIPLR   
A047CIPO9, IMP9, RANBP9Importin-921361659ELGENLDQILR   
A1018DIAPH1, DIAP1Diaphanous 1119395758ELGEYFLFDPK   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486ELGIWEPLAVK   
A4315DNAJC9, RCDNAJ9DNAJ homolog subfamily C member 927597059ELGLDEGVDSLK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191ELHINLIPNK   
A0492STIP1Stress-induced-phosphoprotein 15803181ELIEQLR   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984ELIIGDR   
A0924TOP2A, TOP2DNA topoisomerase 219913406ELILFSNSDNER   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408ELILFSNSDNER   
A351ESRBD1S1 RNA-binding domain-containing protein 1193786457ELINNLDADSLR   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594ELISNASD   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594ELISNASDALDK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677ELISNASDALDKIR   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191ELISNSSDALDKIR   
A8812TXNL2, GLRX3, PICOTGlutaredoxin-395113651ELKENGELLPILR   
A024FDDX42ATP-dependent RNA helicase DDX4245446747ELLDLAMQNAWFR   
A681CHDLBP, HBP, VGLVigilin42716280ELLELASR   
A662ALYAR, PNAS-5Cell growth-regulating nucleolar protein224591430ELLEQISAFDNVPR   
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursor9295347ELLESNFTLVGDDGTNK   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159ELLGPDFGYVTR   
A377AEIF3C, EIF3S8Eukaryotic translation initiation factor 3 subunit C83700233ELLGQGLLLR   
A3656DDX1ATP-dependent RNA helicase DDX14826686ELLIIGGVAAR   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392ELLITDLLPDNR   
A045CIPO4, IMP4B, RANBP4Importin 462460637ELLLPDTER   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625ELLLSAIDSVNATSK   
A678DLRRC47Leucine-rich repeat-containing protein 4724308207ELLLTGPGLEER   
A0098VCLVinculin4507877ELLPVLISAMK   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983ELLQESALIR   
A370ATUFMElongation factor Tu, mitochondrial precursor34147630ELLTEFGYK   
A9654RPS940S ribosomal protein S914141193ELLTLDEK   
A9654RPS940S ribosomal protein S914141193ELLTLDEKDPR   
A146BU2AF2, U2AF65Splicing factor U2AF 65 kDa subunit6005926ELLTSFGPLK   
A7923LARS, HSPC192, PIG44Leucyl-tRNA synthetase, cytoplasmic108773810ELMGEEILGASLSAPLTSYK   
A639CTpr, tpr, TPRNuclear pore complex-associated protein TPR114155142ELMLHAADVEALQAAK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156ELMRGEEGRPGK   
A3584FASN, FASFatty acid synthase41872631ELNLVLSVR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135ELNQVMEQLGDAR   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763ELNYFAK   
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4192807312ELPEYYELIR   
A9769API5, MIG8, AAC11Apoptosis inhibitor 55729730ELPQFATGENLPR   
A8812TXNL2, GLRX3, PICOTGlutaredoxin-395113651ELPQVSFVK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211ELQAHGADELLK   
A362AEBNA1BP2, EBP2EBNA1 binding protein 21835786ELQDAFSR   
A753ACOBRA1, NELFBNegative elongation factor B20070260ELQGFLDGVK   
A3657PYCR1, PIG45Pyrroline-5-carboxylate reductase24797095ELQSMADQEQVSPAAIK   
A3657PYCR1, PIG45Pyrroline-5-carboxylate reductase24797095ELQSMADQEQVSPAAIKK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919ELQSQISDTSVVLSMDNSR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657ELSDFISYLQR   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129ELSDPAGAIIYTSR   
A0326VIL2, EZREzrin161702986ELSEQIQR   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039ELSTTLNADEAVTR   
A8008TOP1DNA topoisomerase-111225260ELTAPDENIPAK   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401ELTLLGKPK   
A8207XRN25'-3' exoribonuclease 218860916ELTMASLPFTFDVER   
A0658DCTN1Dynactin 113259510ELTNQQEASVER   
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitor42822874ELTVSNNDINEAGVR   
A1044RANBP2, NUP358Ran-binding protein 2150418007ELVGPPLAETVFTPK   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932ELVNNLGEIYQK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601ELVVTQLGYDTR   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841ELVYPPDYNPEGK   
A552CSRP72Signal recognition particle 72 kDa protein109638749ELYGQVLYR   
A1425RFC3Replication factor C subunit 34506489ELYGVGVEK   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401ELYIQHAK   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139ELYLFDVLR   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368EMAIPVLEAR   
A4315DNAJC9, RCDNAJ9DNAJ homolog subfamily C member 927597059EMDNFLAQMEAK   
A3166MYH9Myosin heavy chain 9, non-muscle12667788EMEAELEDERK   
A0850VIMVimentin62414289EMEENFAVEAANYQDTIGR   
A040BBCAS2, DAM1Pre-mRNA-splicing factor SPF275031653EMESNWVSLVSK   
A1405RAD50DNA repair protein RAD5019924129EMISSLG   
A086BTCEA1, GTF2S, TFIISTranscription elongation factor A protein 15803191EMLAAALR   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039EMLNLYIENEGK   
A4573ANXA11, ANX11Annexin A1122165433EMSGDLEEGMLAVVK   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679EMTLDEWK   
A7923LARS, HSPC192, PIG44Leucyl-tRNA synthetase, cytoplasmic108773810EMVANWDSLR   
A3918VCPTransitional endoplasmic reticulum ATPase6005942EMVELPLR   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392EMVLEIIR   
A446AFUBP1Far upstream element binding protein 117402900EMVLELIR   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793EMVQNLMVLR   
A1018DIAPH1, DIAP1Diaphanous 1119395758EMVSQYLYTSK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315EMVTSKLPNSVLGK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256ENAEVDGDDDAEEMEAK   
A8207XRN25'-3' exoribonuclease 218860916ENAIDRLVNIYK   
A1135PTBP1, PTBPolypyrimidine tract-binding protein 14506243ENALVQMADGNQAQLAMSHLNGHK   
A1135PTBP1, PTBPolypyrimidine tract-binding protein 14506243ENALVQMADGNQAQLAMSHLNGHKLHGKPIR   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156ENEFSFEDNAIR   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679ENEVEEVKEEGPK   
A919ARBM5, H37, LUCA15RNA-binding protein 55032031ENFKNSFQPVNSLR   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241ENGAFTVLVDNYVK   
A8812TXNL2, GLRX3, PICOTGlutaredoxin-395113651ENGELLPILR   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755ENILEEFSK   
A025FNUP133Nuclear pore complex protein Nup13326051235ENITDAIWGSESNYEAIK   
A046CIPO7, RANBP7RanBP7/importin 75453998ENIVEAIIHSPELIR   
A0656DCTN2, DCTN50Dynactin 25453629ENLATVEGNFASIDER   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995ENLISALEEAK   
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursor20070125ENLLDFIK   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159ENLSYDLVPLK   
A201AACTL6A, BAF53, BAF53AActin-like protein 6A4757718ENMEAISPLK   
A0326VIL2, EZREzrin161702986ENPLQFK   
A0819RDXRadixin4506467ENPLQFK   
A2123WDR61, REC14WD repeat-containing protein 6113376840ENSETVVTGSLDDLVK   
A604CTHOC6, WDR58THO complex subunit 6 homolog31543164ENSLILAGGDCQLHTMDLETGTFTR   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392ENTDSVVMQPKR   
A492CSCRN1Secernin-126251972EPAAEIEALLGMDLVR   
A3882LASP1, MLN50LIM and SH3 domain protein 15453710EPAAPVSIQR   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228EPAFEDITLESER   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323EPEKEIRPALELLEPIEQK   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932EPELFQTVAEGLRQLYAQK   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445EPEQLRK   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329EPEQLRK   
A6217CSNK2A2, CK2A2Casein kinase II, alpha' chain4503097EPFFHGQDNYDQLVR   
A385AEIF3L, EIF3EIP, EIF3S6IPEukaryotic translation initiation factor 3 subunit 6 interacting protein7705433EPFLQQLK   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762EPFPTIYVDSQK   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762EPFPTIYVDSQKENER   
A339ADEKDEK oncogene (DNA binding)4503249EPFTIAQGK   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602EPLLTLVK   
A3995PGAM5-L, PGAM5Serine/threonine-protein phosphatase PGAM5 mitochondrial14198272EPLSLINVR   
A309BAPMAP, UNQ1869/PRO4305, UNQ1869Adipocyte plasma membrane-associated protein24308201EPPLLLGVLHPNTK   
A6269DDX24, HSPC328ATP-dependent RNA helicase DDX249966805EPQPEQPQPSTSAN   
A668AMATR3Matrin 362750354EPSDKAVK   
A498EWDR89, MSTP050, MST050WD repeat-containing protein 8957165359EPTYLLGIDTSK   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257EPWLLPSQHNDIIR   
A3205TPM3Tropomyosin alpha 3 chain24119203EQAEAEVASLNR   
A3995PGAM5-L, PGAM5Serine/threonine-protein phosphatase PGAM5 mitochondrial14198272EQAELTGLR   
A4969MFAP1Microfibrillar-associated protein 150726968EQEAEPEEQEEDSSSDPR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246EQEIRMGQMAMGGAMGINNR   
A369CRRBP1Ribosome-binding protein 1110611220EQEITAVQAR   
A1609CALR, CRTCCalreticulin precursor4757900EQFLDGDGWTSR   
A7691RRM1, RR1Ribonucleoside-diphosphate reductase M1 chain4506749EQGPYETYEGSPVSK   
A0396SLC25A5, ANT2ADP/ATP translocase 2156071459EQGVLSFWR   
A3584FASN, FASFatty acid synthase41872631EQGVTFPSGDIQEQLIR   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392EQIDTLFK   
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein Q15809586EQILEEFSK   
A9543RPL17, RPL17P960S ribosomal protein L1778000186EQIVPKPEEEVAQK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920EQIYDVYR   
A7910CARSCysteinyl-tRNA synthetase62240992EQKVPEILQLSDALR   
A3541TCP1, CCT1, CCTAT-complex protein 1, alpha subunit57863257EQLAIAEFAR   
A7763RTCB, HSPC117UPF0027 protein C22ORF287657015EQLAQAMFDHIPVGVGSK   
A6267DDX21Nucleolar RNA helicase 250659095EQLGEEIDSK   
A669AMYBBP1A, P160MYB-binding protein 1A157694492EQLMTVLQAGK   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401EQLPIFK   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787EQLSDMMMINK   
A4176ORC4L, ORC4Origin recognition complex subunit 4-like32454750EQLSLPAEFPDK   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401EQLTPSQIMSLEK   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787EQLWLANEGLITR   
A994ASETSET protein338039EQQEAIEHIDEVQNEIDR   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594EQVANSAFVER   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264EQVPGFTPR   
A1405RAD50DNA repair protein RAD5019924129EQVSPLETTLEK   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768EQWWLK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601EQWWLK   
A3211CKAP4, P63P63 protein19920317ERDFTSLENTVEER   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787ERDVYEELLTQAEIQGNINK   
A3531KTN1, CG1, PDIA6Kinectin118498356EREHLEMELEK   
A3525SEPT8, SEPT8Septin-8149363638ERELHEK   
A8968PSMD326S proteasome non-ATPase regulatory subunit 325777612EREQQDLEFAK   
A9559RPL3, rpl3, ASC-160S ribosomal protein L34506649ERLEQQVPVNQVFGQDEMIDVIGVTK   
A473AHIST1H1B, H1F5Histone H1.54885381ERNGLSLAALK   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursor24234688ERVEAVNMAEGIIHDTETK   
A1941PLEC1, PLECPlectin41322910ESADPLGAWLQDAR   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503ESAINVAEGK   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597ESCDSALRAYVK   
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like protein11067747ESDLPSAILQTSGVSEFTK   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755ESDLSHVQNK   
A2044SMARCA5, SNF2H, WCRF135SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily A, member 521071058ESEITDEDIDGILER   
A3574BASP1, NAP22Brain acid soluble protein 130795231ESEPQAAAEPAEAK   
A0126GRB2, ASHGrowth factor receptor-bound protein 24504111ESESAPGDFSLSVK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995ESGVDIAAGNMLVK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920ESIMKEFR   
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursor48255889ESLQQMAEVTR   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564ESLSEEEAQK   
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM233356547ESLVVNYEDLAAR   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503ESMQMQVEAER   
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 3517999541ESPESEGPIYEGLIL   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381ESQSPDTTIQR   
A669AMYBBP1A, P160MYB-binding protein 1A157694492ESRDPAQPMSPGEATQSGARPADR   
A0821CD44, LHR, MDU2CD44 antigen48255935ESSETPDQFMTADETR   
A1927DNM2, DYN2Dynamin 256549119ESSLILAVTPANMDLANSDALK   
A9531PCBP1Poly(rC)-binding protein 1460771ESTGAQVQVAGDMLPNSTER   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor13559030ESTLHLVLR   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor208022622ESTLHLVLR   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor208022622ESTLHLVLRLR   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241ESVDHLTIPSR   
A0439PHB2, BAP, REAProhibitin 2221307584ESVFTVEGGHR   
A241BZNF326, ZIRDZinc finger protein 32633946297ESVLTATSILNNPIVK   
A362AEBNA1BP2, EBP2EBNA1 binding protein 21835786ESYDDVSSFR   
A4317ERP29, ERP28Endoplasmic reticulum resident protein 295803013ESYPVFYLFR   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173ETALLIDPKNSCSSSR   
A1425RFC3Replication factor C subunit 34506489ETANAIVSQQTPQR   
A592AEIF6, EIF3A, ITGB4BPEukaryotic translation initiation factor 631563378ETEEILADVLK   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983ETEELMAWMR   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399ETEGGTVLTATTSELEAINKR   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588ETEISLK   
A046CIPO7, RANBP7RanBP7/importin 75453998ETENDDLTNVIQK   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139ETFEDSNLIPK   
A383AEIF3J, EIF3S1, PRO0391Eukaryotic translation initiation factor 3 subunit 183281438ETFGVNNAVYGIDAMNPSSR   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255ETLLAMFK   
A712CXPO1, CRM1CRM1 protein4507943ETLVYLTHLDYVDTER   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195ETMQSLNDR   
A0850VIMVimentin62414289ETNLDSLPLVDTHSK   
A3574BASP1, NAP22Brain acid soluble protein 130795231ETPAATEAPSSTPK   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206ETPFELIEALLK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920ETQALILAPTR   
A4576ANXA5, ANX5, ENX2Annexin A54502107ETSGNLEQLLLAVVK   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588ETSVSKEDTDHEEK   
A2344ACTN4Alpha-actinin 412025678ETTDTDTADQVIASFK   
A4103CUL4BCullin-4B121114298ETVEEQASTTER   
A0658DCTN1Dynactin 113259510ETVGDLEAMNEMNDELQENAR   
A0098VCLVinculin4507877ETVQTTEDQILK   
A3804EEF2, EF2Elongation factor 24503483ETVSEESNVLCLSK   
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homolog18379349EVAEAATGEDASSPPPK   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250EVAELTRLR   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564EVAFFNNFLTDAK   
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein154354962EVAGAKPHITAAEGKLHNMIVDLDNVVK   
A0097TLN1, TLNTalin 116753233EVANSTANLVK   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926EVDDLGPEVGDIK   
A443AFRG1FRG1 protein4758404EVDEGPSPPEQFTAVK   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735EVDEQMLNVQNK   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785EVDEQMLNVQNK   
A5809PRMT1, HRMT1L2, HMT2Protein arginine N-methyltransferase 1150456457EVDIYTVK   
A788ANOP56, NOL5ANucleolar protein Nop5632483374EVEEISLLQPQVEESVLNLGK   
A9769API5, MIG8, AAC11Apoptosis inhibitor 55729730EVEELILTESK   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335EVEPEPTEDKDLEADEEDTR   
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunit4758774EVEQFTQVAK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397EVEVEVESMDK   
A2536NCLNucleolin55956788EVFEDAAEIR   
A2536NCLNucleolin55956788EVFEDAAEIRLVSK   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904EVFLVMPTGGGK   
A3541TCP1, CCT1, CCTAT-complex protein 1, alpha subunit57863257EVGDGTTSVVIIAAELLK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426EVGIEFMDLYSHLVPVYDVEPLEK   
A9531PCBP1Poly(rC)-binding protein 1460771EVGSIIGK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042EVIPVNVPEAQEEMK   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329EVKPPPGRPQPDSGR   
A2515TIAL1Nucleolysin TIAR4507499EVKVNWATTPSSQK   
A763BSLC1A5, ASCT2, M7V1Neutral amino acid transporter B(0)5032093EVLDSFLDLAR   
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like36796743EVLSLLQEK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156EVMLQNGETPK   
A045CIPO4, IMP4B, RANBP4Importin 462460637EVMPLLLAYLK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301EVPAVPETLK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301EVPAVPETLKK   
A0642ILK, ILK1, ILK2Integrin-linked protein kinase 162420875EVPFADLSNMEIGMK   
A4634CAPG, AFCP, MCPGelsolin-like capping protein63252913EVQGNESDLFMSYFPR   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216EVQLAQIFEPLSR   
A604CTHOC6, WDR58THO complex subunit 6 homolog31543164EVQTIEVYK   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723EVQTNDLK   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805EVQYLLNK   
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 24503475EVSAYIK   
A7558ATIC, PURHBifunctional purine biosynthesis protein PURH20127454EVSDGIIAPGYEEEALTILSK   
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursor4502491EVSFQSTGESEWK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304EVSQPDWTPPPEVTLVLTK   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471EVSTYIK   
A0924TOP2A, TOP2DNA topoisomerase 219913406EVTFVPGLYK   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408EVTFVPGLYK   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327EVVDYIIFGTVIQEVK   
A669AMYBBP1A, P160MYB-binding protein 1A157694492EVVEQGLLK   
A3584FASN, FASFatty acid synthase41872631EVWALVQAGIR   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158EVYLHAIVR   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919EVYQQQQYGSGGR   
A6551GPIGlucose-6-phosphate isomerase18201905EWFLQAAK   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408EWLVGMLGAESTK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601EWSGLLEELAR   
A9854CTNNBL1, PP8304Beta-catenin-like protein 118644734EYAENIGDGR   
A0978PYGLGlycogen phosphorylase, liver form71037379EYAQNIWNVEPSDLK   
A2030MORF4L1, MRG15, FWP006Transcription factor-like protein MRG155803102EYAVNEVVAGIK   
A025FNUP133Nuclear pore complex protein Nup13326051235EYEIPSNLTPADVFFR   
A2541HNRNPDL, HNRPDL, JKTBPJKTBP214110407EYFGAFGEIENIELPMDTK   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919EYFGEFGEIEAIELPMDPK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414EYFGGFGEVESIELPMDNK   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481EYFSWEGAFQHVGK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397EYGMIYLGK   
A046CIPO7, RANBP7RanBP7/importin 75453998EYNEFAEVFLK   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907EYPFILDAFQR   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023EYQDAFLFNELK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023EYQDAFLFNELKGETMDTS   
A0850VIMVimentin62414289EYQDLLNVK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315EYQISAGDFPEVK   
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunit4504041EYQLNDSAAYYLNDLER   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315EYSLQVLK   
A912ARBM25, RNPC7, S164U1 small nuclear ribonucleoprotein 1 SNRP homolog55741709EYSSELNAPSQESDSHPR   
A710AMINA, MDIG, MINA53Myc-induced nuclear antigen23346418EYSVEAEER   
A0439PHB2, BAP, REAProhibitin 2221307584EYTAAVEAK   
A002AMYOF, FER1L3Myoferlin7305053EYTGFPDPYDELNTGK   
A451ETXNDC5, MUTED, TLP46Thioredoxin domain containing protein 5 precursor119575627EYVESQLQR   
A0978PYGLGlycogen phosphorylase, liver form71037379EYYEALPELK   
A9655RPSA, LAMBR, LAMR140S ribosomal protein SA59859885FAAATGATPIAGR   
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 225777602FAADIISVLAMTMSGER   
A199AABCF1, ABC50ATP-binding cassette sub-family F (GCN20) member 169354671FAALDNEEEDKEEEIIK   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595FACFERTVEALYK   
A7919GARSGlycyl-tRNA synthetase116805340FADFMVK   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311FADIVSILDK   
A4815FLNC, ABPL, FLN2Filamin C116805322FADKHVPGSPFTVK   
A0850VIMVimentin62414289FADLSEAANR   
A0204FLNA, FLN, FLN1Filamin A116063573FADQHVPGSPFSVK   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932FAEAFEAIPR   
A3960MYO6Unconventional myosin-VI92859701FAEFDQIMK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidase41393561FAEIIEK   
A4158MLECMalectin7661948FAEVYFAQSQQK   
A1489ITGA3, MSK18Integrin alpha-3 precursor6006011FAGSESAVFHGFFSMPEMR   
A0821CD44, LHR, MDU2CD44 antigen48255935FAGVFHVEK   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117FAGYVTSIAATELEDDDDDYSSSTSLLGQK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304FAMEPEEFDSDTLR   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250FANSLVGVQQQLQAFNTYR   
A0850VIMVimentin62414289FANYIDK   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998FAQHGTFEYEYSQR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246FAQPGSFEYEYAMR   
A885APSPC1, PSP1Paraspeckle component 1109240550FAQPGTFEFEYASR   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475FASEIAGVDDLGTTGR   
A1531KRT8, CYK8Keratin, type II cytoskeletal 84504919FASFIDK   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368FASYLTFSPSEVK   
A3541TCP1, CCT1, CCTAT-complex protein 1, alpha subunit57863257FATEAAITILR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998FATHAAALSVR   
A885APSPC1, PSP1Paraspeckle component 1109240550FATHGAALTVK   
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoform4506725FAVHRITPEEAK   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475FAYDGLK   
A1420RFC4Replication factor C subunit 431881687FCLICNYVSR   
A3793PHBProhibitin4505773FDAGELITQR   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254FDAMPFTLR   
A3584FASN, FASFatty acid synthase41872631FDASFFGVHPK   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841FDDPGLMLMGFKPLVLLK   
A7923LARS, HSPC192, PIG44Leucyl-tRNA synthetase, cytoplasmic108773810FDDPLLGPR   
A1405RAD50DNA repair protein RAD5019924129FDEIFSATR   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418FDEILEASDGIMVAR   
A2184SSRP1, FACT80Structure-specific recognition protein 14507241FDEISFVNFAR   
A6276DDX46Probable ATP-dependent RNA helicase DDX4641327773FDETEQALANER   
A172CMYO1CUnconventional myosin-Ic124494238FDEVLIR   
A6449ERO1L, UNQ434/PRO865, ERO1-LERO1-like protein alpha7657069FDGILTEGEGPR   
A2633CTR9, SH2BP1RNA polymerase-associated protein CTR9 homolog7661950FDLALAATEAR   
A0567GDI1, GDIL, OPHN2Rab GDP dissociation inhibitor alpha4503971FDLGQDVIDFTGHALALYR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323FDLGQDVIDFTGHALALYR   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309FDLMYAK   
A8096UBA6, MOP4, UBE1L2Ubiquitin-activating enzyme E1-like protein 2150417996FDLNEPLHLSFLQNAAK   
A0642ILK, ILK1, ILK2Integrin-linked protein kinase 162420875FDMIVPILEK   
A284ACEBPZ, CBF2CCAAT/enhancer binding protein zeta42542392FDNIGMNAMANK   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679FDQLFDDESDPFEVLK   
A0020BPTP-3, PTPN11, PTP2CProtein-tyrosine phosphatase, non-receptor type 1133356177FDSLTDLVEHYK   
A8028TRIM25, EFP, RNF147Zinc finger protein 14768160937FDTIYQILLK   
A4317ERP29, ERP28Endoplasmic reticulum resident protein 295803013FDTQYPYGEK   
A1044RANBP2, NUP358Ran-binding protein 2150418007FDVESKEWK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304FDVSGYPTIK   
A3671GLS, GLS1Glutaminase, kidney isoform, mitochondrial precursor156104878FDYVMQFLNK   
A7910CARSCysteinyl-tRNA synthetase62240992FEDHEGLPTVVK   
A4121FANCIFanconi anemia group I protein82830440FEDILSLFMCYKK   
A7735POLR1E, PAF53, PRAF1DNA-directed RNA polymerase I subunit RPA4911968047FEDLLSPAEYEALQSPSEAFR   
A2515TIAL1Nucleolysin TIAR4507499FEDVVNQSSPK   
A3520SEPT7, CDC10Septin-7148352329FEDYLNAESR   
A0896CSNK1A1Casein kinase I, alpha isoform68303572FEEAPDYMYLR   
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 96274550FEEHKNEK   
A3803EEF1D, EF1DElongation factor 1-delta194239731FEEHVQSVDIAAFNK   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa protein5729877FEELNADLFR   
A377AEIF3C, EIF3S8Eukaryotic translation initiation factor 3 subunit C83700233FEELTNLIR   
A377AEIF3C, EIF3S8Eukaryotic translation initiation factor 3 subunit C83700233FEELTNLIRTIR   
A3519SEPT6, SEP2Septin 621361478FEGEPATHTQPGVQLQSNTYDLQESNVR   
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial4758788FEIVYNLLSLR   
A330CRAB5C, RABLRas-related protein Rab-5C41393614FEIWDTAGQER   
A1297KARSLysyl-tRNA synthetase5031815FELFVMK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984FENAFLSHVVSQHQALLGTIR   
A1018DIAPH1, DIAP1Diaphanous 1119395758FENNELFAK   
A046BU2SURP, SR140U2-associated SR140 protein122937227FEPPQSDSDGQR   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206FERLETHMTPEMFR   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206FESILPRPHASIMFCTVGVLLRK   
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein M14141152FESPEVAER   
A428BESYT1, FAM62A, MBC2Extended syntaptotagmin-114149680FEWELPLDEAQR   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113FFDDPMLLELAK   
A7849SPCS2, SPC25Signal peptidase complex subunit 2133777120FFDHSGTLVMDAYEPEISR   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983FFEDYGLFMR   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805FFGDSAASMAIK   
A7925MARSMethionyl-tRNA synthetase, cytoplasmic14043022FFGGYVPEMVLTPDDQR   
A1396MSH6, GTBPDNA mismatch repair protein MSH64504191FFIGQFSDDR   
A428BESYT1, FAM62A, MBC2Extended syntaptotagmin-114149680FFLQDPQSQELDVQVK   
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursor112380628FFLQGIQLNTILPDAR   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945FFMGNQVLK   
A0433TPI1, TPI, TIMTriosephosphate isomerase 14507645FFVGGNWK   
A3750SLC25A1, SLC20A3Tricarboxylate transport protein, mitochondrial precursor21389315FFVMTSLR   
A7176NRD1Nardilysin precursor156071450FFWGNAETLK   
A897BCOPG, COPG1Coatomer gamma subunit11559929FGAQNEEMLPSILVLLK   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034FGATLEIVTDK   
A5250WDR1, PNAS-29WD-repeat containing protein 19257257FGAVFLWDSGSSVGEITGHNK   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257FGAVWTGDNTAEWDHLK   
A8173UMPSUridine 5'-monophosphate synthase4507835FGDFVLK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426FGDLILK   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129FGEPVLAGFAR   
A2541HNRNPDL, HNRPDL, JKTBPJKTBP214110407FGEVVDCTIKTDPVTGR   
A3656DDX1ATP-dependent RNA helicase DDX14826686FGFGFGGTGK   
A3816RPS340S ribosomal protein S315718687FGFPEGSVELYAEK   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595FGFYEVFK   
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursor20127408FGGGNPELLTQMVSK   
A8513TARDBP, TDP43TAR DNA-binding protein-436678271FGGNPGGFGNQGGFGNSR   
A840APELP1, HMX3, MNARProline and glutamic acid rich nuclear protein 1155030232FGILIGRLLPQVLNSWSIGR   
A983ASARNP, HCC1, HSPC316SAP domain-containing ribonucleoprotein32129199FGISSVPTK   
A983ASARNP, HCC1, HSPC316SAP domain-containing ribonucleoprotein32129199FGIVTSSAGTGTTEDTEAK   
A907BCPNE1, CPN1Copine-123397708FGIYDIDNK   
A024FDDX42ATP-dependent RNA helicase DDX4245446747FGKAYNLR   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581FGLGSVAGAVGATAVYPIDLVK   
A983ASARNP, HCC1, HSPC316SAP domain-containing ribonucleoprotein32129199FGLNVSSISR   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581FGLYLPLFKPSVSTSK   
A3918VCPTransitional endoplasmic reticulum ATPase6005942FGMTPSKGVLFYGPPGCGK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315FGNAFLNR   
A0126GRB2, ASHGrowth factor receptor-bound protein 24504111FGNDVQHFK   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932FGNPLLVQDVESYDPVLNPVLNR   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787FGPALSVK   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787FGPALSVKVMTDESGK   
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursor6681764FGPIPLGSLGWK   
A1426RFC5Replication factor C subunit 56677723FGPLTPELMVPR   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246FGQAATMEGIGAIGGTPPAFNR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998FGQGGAGPVGGQGPR   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998FGQGGAGPVGGQGPRGMGPGTPAGYGR   
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolic33350932FGQMLGSNMTEFHSQISK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418FGVEQDVDMVFASFIR   
A896BCOPECoatomer epsilon subunit31542319FGVVLDEIKPSSAPELQAVR   
A2546DAZAP1DAZ associated protein 125470886FGVVTEVVMIYDAEK   
A2536NCLNucleolin55956788FGYVDFESAEDLEK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304FHHTFSTEIAK   
A7176NRD1Nardilysin precursor156071450FHLISPLIQK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156FHNLEGFLEEFADIAK   
A2083WDR57, SNRNP40, PRP8BPU5 snRNP-specific 40 kDa protein115298668FHPNGSTLASAGFDR   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034FHTEALTALLSDDSK   
A2117PRPF19, NMP200, PRP19Pre-mRNA-processing factor 197657381FIASTGMDR   
A7908AARSAlanyl-tRNA synthetase109148542FIDFFK   
A7560ADSS, ADSS2Adenylosuccinate synthetase 234577063FIEDELQIPVK   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883FIEIAAR   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857FIIPNVVK   
A0369LDHBL-lactate dehydrogenase B chain4557032FIIPQIVK   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947FIKGTDYQLSK   
A3816RPS340S ribosomal protein S315718687FIMESGAK   
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-A116256489FINDQYEK   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597FITHAPPGEFNEVFNDVR   
A4576ANXA5, ANX5, ENX2Annexin A54502107FITIFGTR   
A027FPAF1, PD2RNA polymerase II-associated factor 1 homolog42476169FITYPFDQNR   
A7162NMNAT1, NMNATNicotinamide mononucleotide adenylyltransferase 120070321FIYESDVLWK   
A0020BPTP-3, PTPN11, PTP2CProtein-tyrosine phosphatase, non-receptor type 1133356177FIYMAVQHYIETLQR   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954FKAEAPLPSPK   
A4357NPM1, NPMNucleophosmin169161624FKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK   
A7288PANK4Pantothenate kinase 48922665FKDLIEEK   
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursor4507401FKEQLTPSQIMSLEK   
A002AMYOF, FER1L3Myoferlin7305053FKGFPQPILSEDGSR   
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A94721250FKGPFTDVVTTNLK   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723FKLITEDVQGK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121FLAVGLVDNTVR   
A4273BAG2BAG-family molecular chaperone regulator-24757834FLDDLGNAK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601FLEHLSGAGK   
A691ACRSP3, MED23, ARC130Mediator of RNA polymerase II transcription subunit 2328558969FLELLPVSK   
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDa38327039FLEMCNDLLAR   
A583DCLUHPutative eukaryotic translation initiation factor 3 subunit87162455FLENALAVSTK   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306FLEPTLR   
A2187UBTF, UBF, UBF1Nucleolar transcription factor 17657671FLESLPEEEQQR   
A0446CSE1L, CAS, XPO2Exportin-229029559FLESVEGNQNYPLLLLTLLEK   
A1164IPO5, KPNB3, RANBP5Importin 524797086FLFDSVSSQNVGLR   
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursor9910280FLFVDADQIVR   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255FLGDIEVWDQAEK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305FLHHLIIEEK   
A0361YWHAZ14-3-3 protein zeta/delta208973244FLIPNASQAESK   
A067BSYMPK, SPKSymplekin124028529FLIPVLNGLEK   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241FLIQNVLR   
A0224FSCN1, FAN1, HSNFascin 14507115FLIVAHDDGR   
A9701CUL3Cullin homolog 34503165FLLESFNNDR   
A8890NARG1, NAA15, GA19NMDA receptor-regulated protein 117149828FLLMLQSVK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827FLLSESGSGK   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323FLMANGQLVK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519FLMSLVNQVPK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519FLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEK   
A7910CARSCysteinyl-tRNA synthetase62240992FLNEFFLNVK   
A712CXPO1, CRM1CRM1 protein4507943FLNVPMFR   
A632BTEX10, L18Testis expressed sequence 10 protein46947031FLQALADGSSR   
A1303MCM7, CDC47, MCM2DNA replication licensing factor MCM733469968FLQEFYQDDELGKK   
A4323FKBP3, FKBP25FK506-binding protein 34503727FLQEHGSDSFLAEHK   
A773ANOC3L, AD24, FAD24Nucleolar complex protein 3 homolog20806097FLQGDSFLNEDLNQLIK   
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 1319923193FLREWVESMGGK   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787FLSAIVSSVDK   
A385AEIF3L, EIF3EIP, EIF3S6IPEukaryotic translation initiation factor 3 subunit 6 interacting protein7705433FLSPVVPNYDNVHPNYHK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827FLSQIESDR   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394FLSQPFQVAEVFTGHMGK   
A6950MAN2A1, MANA2Alpha-mannosidase II51477714FLSSSLYTALTEAR   
A4231STAG1, SA1Cohesin subunit SA-162243696FLTEQMMER   
A691ACRSP3, MED23, ARC130Mediator of RNA polymerase II transcription subunit 2328558969FLTEVLLPIVK   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762FLTWILNR   
A6015CDC2L2, CDC2L1, CDK11BCell division protein kinase 11B16332358FLTYFPGR   
A3549SSR1, TRAPATranslocon-associated protein, alpha subunit precursor551638FLVGFTNK   
A3656DDX1ATP-dependent RNA helicase DDX14826686FLVLDEADGLLSQGYSDFINR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323FLVYVANFDEK   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323FLVYVANFDEKDPR   
A0924TOP2A, TOP2DNA topoisomerase 219913406FLYDDNQR   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408FLYDDNQR   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852FLYSELMK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794FMATNDL   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250FMELLEPLNER   
A0234ACTR3, ARP3Actin-like protein 35031573FMEQVIFK   
A5866ATAD3AATPase family, AAA domain containing, protein 3A21749446FMLVLASNQPEQFDWAINDRINEMVHFDLPGQEER   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623FMQDPMEIFVDDETK   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371FMQDPMEVFVDDETK   
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 138327552FMQTFVLAPEGSVANK   
A030FPCID2, HT004PCI domain-containing protein 27023880FMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQK   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920FMTDPIR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012FNALFAQGNYSEAAK   
A0439PHB2, BAP, REAProhibitin 2221307584FNASQLITQR   
A4815FLNC, ABPL, FLN2Filamin C116805322FNDEHIPDSPFVVPVASLSDDAR   
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein M14141152FNECGHVLYADIKMENGK   
A3960MYO6Unconventional myosin-VI92859701FNEVVSVLK   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327FNFLAPELPAVSEFSTSETMGHSADR   
A996ASF3A1, SAP114Splicing factor 3 subunit 15032087FNFLNPNDPYHAYYR   
A7375PGM1Phosphoglucomutase 121361621FNISNGGPAPEAITDKIFQISK   
A583DCLUHPutative eukaryotic translation initiation factor 3 subunit87162455FNPDIFSPGVR   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867FNPETDYLTGTDGKK   
A8968PSMD326S proteasome non-ATPase regulatory subunit 325777612FNQVLDQFGEK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216FNQVLGDDEK   
A0126GRB2, ASHGrowth factor receptor-bound protein 24504111FNSLNELVDYHR   
A0152RAN, ARA24, TC4GTP-binding nuclear protein RAN5453555FNVWDTAGQEK   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950FPDENFK   
A3611RPN2Ribophorin II35493916FPEEEAPSTVLSQNLFTPK   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481FPEELTQTFMSCNLITGMFQR   
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursor195976805FPEHELTFDPQR   
A7931RARSArginyl-tRNA synthetase15149476FPEILQK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256FPEVEDVVMVNVR   
A1927DNM2, DYN2Dynamin 256549119FPFELVK   
A1927DNM2, DYN2Dynamin 256549119FPFELVKMEFDEK   
A023FASNS, TS11Asparagine synthetase [glutamine-hydrolyzing]119597139FPFNTPK   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241FPGAYLK   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735FPGQLNADLR   
A1222RPL5, MSTP03060S ribosomal protein L514591909FPGYDSESK   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675FPLFGGWK   
A9551RPL23A60S ribosomal protein L23a17105394FPLTTESAMK   
A3813RPL10A, NEDD660S ribosomal protein L10a15431288FPSLLTHNENMVAK   
A555AHNRNPUL2, HNRPUL2, BSCL2Heterogeneous nuclear ribonucleoprotein U-like protein 2118601081FPTLWSGAR   
A912ARBM25, RNPC7, S164U1 small nuclear ribonucleoprotein 1 SNRP homolog55741709FPVAPLIPYPLITK   
A248CNUP205Nuclear pore complex protein Nup20557634534FQDDNVEGDKVSK   
A046BU2SURP, SR140U2-associated SR140 protein122937227FQDELESGK   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase P4504183FQDGDLTLYQSNTILR   
A4290DNAJB11, EDJ, ERJ3DnaJ homolog subfamily B member 11 precursor7706495FQDLGAAYEVLSDSEK   
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-A116256489FQDLGVK   
A4121FANCIFanconi anemia group I protein82830440FQDQVLDLLK   
A960APDCD11RRP5 protein homolog70980549FQEAGELYNR   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555FQETEFLSPPR   
A1018DIAPH1, DIAP1Diaphanous 1119395758FQPLLDGLK   
A5239UBQLN1, DA41, PLIC1Ubiquilin 116753203FQQQLEQLSAMGFLNR   
A0446CSE1L, CAS, XPO2Exportin-229029559FQSGDFHVINGVLR   
A332CRAB7A, RAB7Ras-related protein Rab-7A34147513FQSLGVAFYR   
A2187UBTF, UBF, UBF1Nucleolar transcription factor 17657671FREDHPDLIQNAK   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257FRIDELEPR   
A0982PPP1R8, ARD1, NIPP1Protein phosphatase 1, regulatory inhibitor subunit 813699256FRNMVQTAVVPVK   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904FRPLQLETINVTMAGK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603FRQDLMNIAGTTLSSK   
A8997RAB3GAP2, RAB3-GAP150RAB3 GTPase-activating protein non-catalytic subunit19923790FSAATYLMDK   
A3588PYGBGlycogen phosphorylase, brain form21361370FSAFLEK   
A022FFAM50B, X5L, D6S2654EXAP-5-like protein6912326FSAHYDAVEAELK   
A1377PCNAProliferating cell nuclear antigen33239451FSASGELGNGNIK   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381FSDQFPLPLK   
A7569CTPS1, CTPSCTP synthase 1148491070FSDSYASVIK   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960FSEGEATLR   
A899ARAE1, MRNP41mRNA-associated protein mrnp 4162739173FSFWDK   
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3X87196351FSGGFGAR   
A3966KIF2A, KIF2, KNS2Kinesin-like protein KIF2A148612849FSLIDLAGNER   
A028FPABPC1L2A, PABPC1L2, RBM32APolyadenylate-binding protein 1-like 2109948285FSPAGPILSIR   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787FSPAGPILSIR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426FSPIPFPPLSYK   
A2073WDR5, BIG3, BIGWD-repeat protein 516554629FSPNGEWLASSSADK   
A2187UBTF, UBF, UBF1Nucleolar transcription factor 17657671FSQELLSNGELNHLPLK   
A6323DHX16, DBP2, DDX16DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 163107913FSTFFDDAPVFR   
A3804EEF2, EF2Elongation factor 24503483FSVSPVVR   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156FSWAQGTDTILADEMGLGK   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135FTAIIGPNGSGK   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926FTDILVR   
A6348DNMT1, AIM, CXXC9DNA (cytosine-5)-methyltransferase 14503351FTEDSLLR   
A8513TARDBP, TDP43TAR DNA-binding protein-436678271FTEYETQVK   
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursor9910280FTILDSQGK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794FTISDHPQPIDPLLK   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597FTITPPTAQVVGVLK   
A587AEIF4H, WBSCR1, WSCR1Eukaryotic translation initiation factor 4H11559923FTITPPTAQVVGVLK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426FTLWWSPTINR   
A7735POLR1E, PAF53, PRAF1DNA-directed RNA polymerase I subunit RPA4911968047FTLYENK   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228FTNMLGQPGSTALDLFK   
A9655RPSA, LAMBR, LAMR140S ribosomal protein SA59859885FTPGTFTNQIQAAFR   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394FTQAGSEVSALLGR   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425FTQCQNGKISK   
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursor14042596FTQISPVWLQLK   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065FTQLDLEDVQVR   
A629AMKI67Antigen KI-67103472005FTQTSGETTDADKEPAGEDK   
A549BNRM, NRM29, UNQ555/PRO1112Multispanning nuclear envelope membrane protein NURIM25282391FTSLRPLLGGIPESGGPDAR   
A001BSF3B2, SAP145Splicing factor 3B subunit 255749531FTVAELK   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034FTVDLPK   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254FTVLLMPNGPMR   
A3816RPS340S ribosomal protein S315718687FVADGIFK   
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 177404397FVDGEWYR   
A3816RPS340S ribosomal protein S315718687FVDGLMIHSGDPVNYYVDTAVR   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675FVDHVFDEQVIDSLTVK   
A9854CTNNBL1, PP8304Beta-catenin-like protein 118644734FVDILGLR   
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 18659555FVEFFGPGVAQLSIADR   
A3960MYO6Unconventional myosin-VI92859701FVEIHFNEK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042FVELPGAEMGK   
A8086UAP1, SPAG2UDP-N-acetylhexosamine pyrophosphorylase 1156627575FVFDIFQFAK   
A8790FLII, FLILFlightless-I protein homolog4503743FVFLLDR   
A3696MDH2Malate dehydrogenase, mitochondrial precursor21735621FVFSLVDAMNGK   
A7010MAT2A, AMS2, MATA2S-adenosylmethionine synthetase gamma form5174529FVIGGPQGDAGLTGR   
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p684758138FVINYDYPNSSEDYIHR   
A6264DDX17ATP-dependent RNA helicase DDX17148613856FVINYDYPNSSEDYVHR   
A8017TPP2Tripeptidyl-peptidase II339880FVLHAVQLVK   
A894BCOPB1, COPB, MSTP026Coatomer beta subunit221316632FVLPLQDHTIK   
A451ETXNDC5, MUTED, TLP46Thioredoxin domain containing protein 5 precursor119575627FVLSQAKDEL   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753FVMEVEVDGQK   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335FVMKPPQVVR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657FVMQEEFSR   
A8960PSMC2, MSS126S protease regulatory subunit 74506209FVNLGIEPPK   
A4527TOMM40, PEREC1, TOM40Mitochondrial import receptor subunit TOM40 homolog193083122FVNWQVDGEYR   
A1562GPIa, ITGA2, CD49BIntegrin alpha-2 precursor116295258FVQGLDIGPTK   
A038CKPNA2, RCH1, SRP1Importin alpha-2 subunit4504897FVSFLGR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323FVSISDLLVPK   
A6348DNMT1, AIM, CXXC9DNA (cytosine-5)-methyltransferase 14503351FVSNITR   
A0446CSE1L, CAS, XPO2Exportin-229029559FVTAIWNLLVTTGQEVK   
A632BTEX10, L18Testis expressed sequence 10 protein46947031FVTETLEDGSR   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564FVTSNTQELGK   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159FVVQNVSAQK   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159FVVQNVSAQKDGEK   
A2083WDR57, SNRNP40, PRP8BPU5 snRNP-specific 40 kDa protein115298668FVYVWDTTSR   
A023BSMARCC1, BAF155SWI/SNF complex subunit SMARCC121237802FWESPETVSQLDSVR   
A9545RPL18A60S ribosomal protein L18A169163931FWYFVSQLK   
A7183NSUN2, SAKI, TRM4tRNA (cytosine-5-)-methyltransferase NSUN239995082FYALDPSFPR   
A1609CALR, CRTCCalreticulin precursor4757900FYALSASFEPFSNK   
A967ASNRPCU1 small nuclear ribonucleoprotein C4507127FYCDYCDTYLTHDSPSVR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847FYDDAIVSQK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594FYEAFSK   
A5416NAP1L1, NRPNucleosome assembly protein 1-like 121327708FYEEVHDLER   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191FYEQFSK   
A3803EEF1D, EF1DElongation factor 1-delta194239731FYEQMNGPVAGASR   
A1164IPO5, KPNB3, RANBP5Importin 524797086FYFHDGVR   
A452AGAR1, NOLA1Nucleolar protein family A, member 115011916FYIDPYK   
A7732POLR1BDNA-directed RNA polymerase I 135 kDa polypeptide33469941FYMLCLMTRK   
A6217CSNK2A2, CK2A2Casein kinase II, alpha' chain4503097FYMYELLK   
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting protein22027538FYNELTEILVR   
A0326VIL2, EZREzrin161702986FYPEDVAEELIQDITQK   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968FYPLEIDYGQDEEAVK   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968FYPLEIDYGQDEEAVKK   
A8192VRK1Serine/threonine protein kinase VRK14507903FYQRAAKPEQIQK   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968FYTLIPHDFGMK   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228FYVEDLK   
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 138327552FYVHNDIFR   
A2184SSRP1, FACT80Structure-specific recognition protein 14507241FYVPPTQEDGVDPVEAFAQNVLSK   
A310CRAB14Ras-related protein Rab-1419923483GAAGALMVYDITR   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827GAALITAVGVR   
A311ACPSF6, CFIM68, HPBRII-4Cleavage and polyadenylation specificity factor subunit 6871301GAAPNVVYTYTGK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418GADFLVTEVENGGSLGSK   
A7288PANK4Pantothenate kinase 48922665GADLVVIEGMGR   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625GADSELSTVPSVTK   
A840APELP1, HMX3, MNARProline and glutamic acid rich nuclear protein 1155030232GADTAPTLAPEALPSQGEVER   
A177BYB-1, YBX1, NSEP1Nuclease sensitive element binding protein 134098946GAEAANVTGPGGVPVQGSK   
A4814FLNB, FLN3, TAPFilamin-B105990514GAGIGGLGITVEGPSESK   
A4575ANXA4, PIG28, ANX4Annexin A44502105GAGTDEGCLIEILASR   
A4815FLNC, ABPL, FLN2Filamin C116805322GAGTGGLGLAIEGPSEAK   
A9540RPL1160S ribosomal protein L1115431290GAKAEEILEK   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264GALALAQAVQR   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158GALINVPPPFLGLPR   
A4317ERP29, ERP28Endoplasmic reticulum resident protein 295803013GALPLDTVTFYK   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenase7669492GALQNIIPASTGAAK   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenase7669492GALQNIIPASTGAAKAVGK   
A043CKPNB1, NTF97Importin beta-1 subunit19923142GALQYLVPILTQTLTK   
A1043DIS3, RRP44Exosome complex exonuclease RRP4417225572GALTLSSPEVR   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505GALVVVNDLGGDFK   
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8A16933567GAMGIMLVYDITNEKSFDNIR   
A7908AARSAlanyl-tRNA synthetase109148542GAMSTQQIK   
A668AMATR3Matrin 362750354GAPPSSNIEDFHGLLPK   
A172CMYO1CUnconventional myosin-Ic124494238GAPVGGHILSYLLEK   
A330CRAB5C, RABLRas-related protein Rab-5C41393614GAQAAIVVYDITNTDTFAR   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330GASGSFVVVQK   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330GASGTFQLK   
A4687CNN3Calponin 34502923GASQAGMLAPGTR   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173GASVIRMLHDYIGDK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603GATQQILDEAER   
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyase18375505GAVAEDGDELR   
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyase18375505GAVAEDGDELRTEPEAK   
A0208RANGAP1, SDRan GTPase-activating protein 14506411GAVAMAETLK   
A1222RPL5, MSTP03060S ribosomal protein L514591909GAVDGGLSIPHSTK   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193GAVYSFDPVGSYQR   
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T155749577GAWSNVLR   
A0396SLC25A5, ANT2ADP/ATP translocase 2156071459GAWSNVLR   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305GAYDIFLNAK   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255GAYIYNALIEFIR   
A3815RPS2, rps2, RPS440S ribosomal protein S215055539GCTATLGNFAKATFDAISK   
A9506TOMM22, TOM22, MST065Mitochondrial import receptor subunit TOM22 homolog9910382GDAEKPEEELEEDDDEELDETLSER   
A408AEWSR1, EWSRNA-binding protein EWS4885225GDATVSYEDPPTAK   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597GDDEEWNEVLNK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954GDFDVSVPK   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827GDFIALDLGGSSFR   
A3918VCPTransitional endoplasmic reticulum ATPase6005942GDIFLVRGGMR   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264GDILVVATGQPEMVK   
A6984MCM3, HCC5DNA replication licensing factor MCM36631095GDINILLIGDPSVAK   
A6986MCM5, CDC46DNA replication licensing factor MCM523510448GDINLLMLGDPGTAK   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757GDKVDILYNNIK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954GDLDASVPSMK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418GDLGIEIPAEKVFLAQK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847GDPLLDQR   
A369CRRBP1Ribosome-binding protein 1110611220GDPVAILK   
A369CRRBP1Ribosome-binding protein 1110611220GDPVAILKR   
A043CKPNB1, NTF97Importin beta-1 subunit19923142GDQENVHPDVMLVQPR   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159GDRWIQDEIEFGYIEAPHK   
A2548HNRNPA0, HNRPA0Heterogeneous nuclear ribonucleoprotein A05803036GDVAEGDLIEHFSQFGTVEK   
A0688AP1M1, CLTNMAdaptor-related protein complex 1, mu 1 subunit14210504GDVDMSEVEHFMPILMEK   
A9485SRPRB, APMCF1Signal recognition particle receptor beta subunit14917113GDVGSADIQDLEK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427GDVTITNDGATILK   
A172CMYO1CUnconventional myosin-Ic124494238GDVVLQSDHVIETLTK   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392GDWSVGAPGGVQEITYTVPADK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418GDYPLEAVR   
A0787FKBP4, FKBP52FK506-binding protein 44503729GEAHLAVNDFELAR   
A468CSEC22B, SEC22L1Vesicle trafficking protein SEC22B94429050GEALSALDSK   
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUS4826734GEATVSFDDPPSAK   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942GEAVQEELLK   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675GEDEEENNLEVR   
A3549SSR1, TRAPATranslocon-associated protein, alpha subunit precursor551638GEDFPANNIVK   
A6986MCM5, CDC46DNA replication licensing factor MCM523510448GEDNIDFMPTILSR   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329GEEGHDPKEPEQLR   
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 27657347GEELGPGNVQK   
A172CMYO1CUnconventional myosin-Ic124494238GEELLSPLNLEQAAYAR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932GEENLMDAQVK   
A1057RBBP4, RBAP48Retinoblastoma-binding protein 45032027GEFGGFGSVSGK   
A7919GARSGlycyl-tRNA synthetase116805340GEFTIETEGK   
A3991MTDH, AEG1, LYRICProtein Lyric28277147GEGALPTGKSK   
A9854CTNNBL1, PP8304Beta-catenin-like protein 118644734GEGLQLMNLMLR   
A1095HMGB1, HMG1, FM1High mobility group protein B120138433GEHPGLSIGDVAK   
A9652RPS6, PNAS-2040S ribosomal protein S617158044GEKDIPGLTDTTVPR   
A7946GTF2F2, RAP30Transcription initiation factor IIF, beta subunit4758488GELDLTGAK   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381GELQNWPDLLPK   
A0029ANXA6, ANX6Annexin A671773415GELSGDFEK   
A8812TXNL2, GLRX3, PICOTGlutaredoxin-395113651GELVGGLDIVK   
A0369LDHBL-lactate dehydrogenase B chain4557032GEMMDLQHGSLFLQTPK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857GEMMDLQHGSLFLR   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907GEMQVVPVLVHLLSAISSVR   
A965ASNRPN, HCERN3, SMNSmall nuclear ribonucleoprotein associated protein N13027650GENLVSMTVEGPPPK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475GENSWFSTQVDTVATK   
A0545NCKAP1, HEM2, NAP1Nck-associated protein 17305303GEPEREKPGVESMR   
A381AEIF3H, EIF3S3Eukaryotic translation initiation factor 3 subunit 34503515GEPPLPEEDLSK   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304GESDPAYQQYQDAANNLR   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973GESPVDYDGGR   
A0099ITGB1, FNRB, MDF2Integrin beta-1 precursor19743823GEVFNELVGK   
A724AMRTO4, MRT4mRNA turnover protein 4 homolog18490987GEVGLLFTNR   
A7288PANK4Pantothenate kinase 48922665GEVQALFLR   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096GFAAFLTELAER   
A0710HNRPC, HNRNPCHeterogeneous nuclear ribonucleoproteins C1/C2117190254GFAFVQYVNER   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1169164476GFAFVTFDDHDSVDK   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445GFAFVTFDDHDSVDK   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329GFAFVTFDDHDTVDK   
A2555RBMX, HNRPG, RBMXP1Heterogeneous nuclear ribonucleoprotein G56699409GFAFVTFESPADAK   
A2555RBMX, HNRPG, RBMXP1Heterogeneous nuclear ribonucleoprotein G56699409GFAFVTFESPADAKDAAR   
A1132SFRS10, TRA2B, SILG41Splicing factor, arginine/serine-rich 104759098GFAFVYFENVDDAK   
A311ACPSF6, CFIM68, HPBRII-4Cleavage and polyadenylation specificity factor subunit 6871301GFALVGVGSEASSK   
A2581FUSIP1, SRSF10, FUSIP2FUS-interacting Serine-Arginine-rich protein 15730079GFAYVQFEDVR   
A7931RARSArginyl-tRNA synthetase15149476GFDILGIKPVQR   
A3619DDOST, OST48Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit precursor20070197GFELTFK   
A1941PLEC1, PLECPlectin41322910GFFDPNTEENLTYLQLMER   
A2102COPACoatomer alpha subunit148536855GFFEGTIASK   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072GFGDGYNGYGGGPGGGNFGGSPGYGGGR   
A0426VDAC2Voltage-dependent anion-selective channel protein 242476281GFGFGLVK   
A1021CSRP1, CSRP, CYRPCysteine-rich protein 14758086GFGFGQGAGALVHSE   
A1014SFPQ, PSFSplicing factor, proline-and glutamine-rich4826998GFGFIKLESR   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919GFGFILFK   
A2536NCLNucleolin55956788GFGFVDFNSEEDAK   
A2550SFRS5, SRSF5, HRSSerine/arginine-rich splicing factor 586991440GFGFVEFEDPR   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414GFGFVLFK   
A2541HNRNPDL, HNRPDL, JKTBPJKTBP214110407GFGFVLFK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414GFGFVLFKESESVDK   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787GFGFVSFER   
A2544MSI2RNA-binding protein Musashi homolog 220373175GFGFVTFADPASVDK   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072GFGFVTFDDHDPVDK   
A2548HNRNPA0, HNRPA0Heterogeneous nuclear ribonucleoprotein A05803036GFGFVYFQNHDAADK   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034GFGGIGGILR   
A0029ANXA6, ANX6Annexin A671773415GFGSDKEAILDIITSR   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960GFHQVPFAPIVFIER   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursor4885281GFIGPGIDVPAPDMSTGER   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529GFKDQIYDIFQK   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588GFNEGLWEIDNNPK   
A199AABCF1, ABC50ATP-binding cassette sub-family F (GCN20) member 169354671GFNLPYQDAR   
A2591SSB, SS-B/LaLupus La protein10835067GFPTDATLDDIKEWLEDK   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973GFPTIKIFQK   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursor21361657GFPTIYFSPANK   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159GFPVVLDSPR   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255GFQEVVTPNIFNSR   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852GFQHPSPRGR   
A0367RPL13, BBC160S ribosomal protein L1315431297GFSLEELR   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968GFSLLATEDKEALK   
A3882LASP1, MLN50LIM and SH3 domain protein 15453710GFSVVADTPELQR   
A7260PYCR2, P5CR2Pyrroline 5-carboxylate reductase21361454GFTAAGILSAHK   
A3657PYCR1, PIG45Pyrroline-5-carboxylate reductase24797095GFTAAGVLAAHK   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 114251209GFTIPEAFR   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305GFTLNDAANSR   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306GFVEIQTPK   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919GFVFITFK   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158GFVPSPTSQPGGHESLVDR   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171GFVVINQK   
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursor20127408GFYIYQEGVK   
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunit5453607GGAEQFMEETER   
A415AEXOSC7, RRP42Exosome complex component RRP4221362903GGDDLGTEIANTLYR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435GGDLMAYDR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435GGDLMAYDRR   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117GGDSIGETPTPGASK   
A032FSNRNP27, RY1, RY-1U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein24307919GGFNRPLDFIA   
A550CSRP54Signal recognition particle 54 kDa protein4507215GGGALSAVAATK   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445GGGFGGNDNFGR   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796GGGGGGPGEGFDVAK   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072GGGGNFGPGPGSNFR   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156GGGNQVSLLNVVMDLK   
A414AEXOSC6, MTR3Exosome complex exonuclease MTR317402904GGGPAGAGGEAPAALR   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113GGGQIIPTAR   
A3804EEF2, EF2Elongation factor 24503483GGGQIIPTAR   
A7763RTCB, HSPC117UPF0027 protein C22ORF287657015GGGVGGFLPAMK   
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenase23308577GGIVDEGALLR   
A3816RPS340S ribosomal protein S315718687GGKPEPPAMPQPVPTA   
A3619DDOST, OST48Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit precursor20070197GGKYSVQFK   
A4815FLNC, ABPL, FLN2Filamin C116805322GGLVGTPAPFSIDTK   
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUS4826734GGMGGSDRGGFNK   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195GGMGSGGLATGIAGGLAGMGGIQNEK   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072GGNFGFGDSR   
A9484SRPRSignal recognition particle receptor alpha subunit23308697GGNNSFTHEALTLK   
A2531HNRNPR, HNRPRHeterogeneous nuclear ribonucleoprotein R5031755GGPAQQQRGR   
A408AEWSR1, EWSRNA-binding protein EWS4885225GGPGGPGGPGGPMGRMGGR   
A0753CSNK2A1, CK2A1Casein kinase II, alpha chain29570791GGPNIITLADIVK   
A0753CSNK2A1, CK2A1Casein kinase II, alpha chain29570791GGPNIITLADIVKDPVSR   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076GGPPFAFVEFEDPR   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076GGPPFAFVEFEDPRDAEDAVYGR   
A968ASNRPA1U2 small nuclear ribonucleoprotein A'50593002GGPSPGDVEAIK   
A2536NCLNucleolin55956788GGRGGFGGR   
A286ACENPBMajor centromere autoantigen B21735415GGVTTQALAK   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793GGYFDEFGIIR   
A7908AARSAlanyl-tRNA synthetase109148542GGYVLHIGTIYGDLK   
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunit12408656GHAYSVTGAK   
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit I4503513GHFGPINSVAFHPDGK   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867GHLDNISNNLLIGAINIENGK   
A3807RPLP060S acidic ribosomal protein P016933546GHLENNPALEK   
A3656DDX1ATP-dependent RNA helicase DDX14826686GHVDILAPTVQELAALEK   
A3804EEF2, EF2Elongation factor 24503483GHVFEESQVAGTPMFVVK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113GHVTQDAPIPGSPLYTIK   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735GHYTEGAELVDSVLDVVR   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785GHYTEGAELVDSVLDVVR   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311GIAAGMKYLANMNYVHR   
A3656DDX1ATP-dependent RNA helicase DDX14826686GIDIHGVPYVINVTLPDEK   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771GIDIQDVSMVVNYDMAK   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171GIDPFSLDALSK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427GIEILTDMSRPVELSDR   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595GIFNGFSVTLK   
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunit13654237GIFTSEIGTK   
A679AMCTS1, MCT1, MCT-1Malignant T cell amplified sequence 17662502GIGIENIHYLNDGLWHMK   
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein M14141152GIGMGNIGPAGMGMEGIGFGINK   
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunit38455427GIHPTIISESFQK   
A7569CTPS1, CTPSCTP synthase 1148491070GIIASSVGTILK   
A5653ACAD9Acyl-CoA dehydrogenase family member 9, mitochondrial precursor21361497GIILAGTEEQKAK   
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1115387104GIKPVTLELGGK   
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating40068518GILFVGSGVSGGEEGAR   
A0098VCLVinculin4507877GILSGTSDLLLTFDEAEVR   
A0098VCLVinculin4507877GILSGTSDLLLTFDEAEVRK   
A330ACWC22, NCMPre-mRNA-splicing factor CWC22 homolog55749769GINAIFER   
A5416NAP1L1, NRPNucleosome assembly protein 1-like 121327708GIPEFWLTVFK   
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoform4506725GIPHLVTHDAR   
A2049CHD1L, ALC1Chromodomain helicase DNA binding protein 1-like148612870GIPTYIYYFPR   
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-24503377GIQEEMEALVK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984GIRPAINVGLSVSR   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486GISDLAQHYLMR   
A2341ACTN1Alpha-actinin 14501891GISQEQMNEFR   
A2344ACTN4Alpha-actinin 412025678GISQEQMQEFR   
A8700CDKN2AIP, CARFCDKN2A interacting protein8923040GISSSNEGVEEPSK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidase41393561GITFDSGGISIK   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471GITIDISLWKFETSK   
A0361YWHAZ14-3-3 protein zeta/delta208973244GIVDQSQQAYQEAFEISK   
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding protein224028246GIVEFSGKPAAR   
A0978PYGLGlycogen phosphorylase, liver form71037379GIVGVENVAELK   
A0978PYGLGlycogen phosphorylase, liver form71037379GIVGVENVAELKK   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907GIVILMVDEKMSPTIGK   
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursor21361181GIVVYTGDR   
A3966KIF2A, KIF2, KNS2Kinesin-like protein KIF2A148612849GIYALAARDVFLMLK   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529GIYAYGFEKPSAIQQR   
A6781EIF4A3, DDX48Probable ATP-dependent helicase DDX487661920GIYAYGFEKPSAIQQR   
A1941PLEC1, PLECPlectin41322910GIYQSLEGAVQAGQLK   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368GKDHVVSDFSEHGSLK   
A6502FBL, FIB1, FLRNFibrillarin12056465GKEDALVTK   
A3882LASP1, MLN50LIM and SH3 domain protein 15453710GKGFSVVADTPELQR   
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 394757926GKIGLPHSIK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954GKKPDIDITGPK   
A6789IMPDH2, IMPD2Inosine-5'-monophosphate dehydrogenase 266933016GKLPIVNEDDELVAIIAR   
A850APHF6PHD-like zinc finger protein62865858GKVEIDQQQLTQQQLNGN   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113GLAEDIENEVVQITWNR   
A0097TLN1, TLNTalin 116753233GLAGAVSELLR   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371GLAITFVSDENDAK   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623GLAITFVSDENDAK   
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM233356547GLALALFGGEPK   
A7920HARS, HRSHistidyl-tRNA synthetase, cytoplasmic6996014GLAPEVADR   
A6267DDX21Nucleolar RNA helicase 250659095GLDIPEVDLVIQSSPPK   
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4192807312GLDPVEILQER   
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p684758138GLDVEDVK   
A6264DDX17ATP-dependent RNA helicase DDX17148613856GLDVEDVK   
A555AHNRNPUL2, HNRPUL2, BSCL2Heterogeneous nuclear ribonucleoprotein U-like protein 2118601081GLEEPEMDPK   
A2492LMNB2, LMN2Lamin B227436951GLESDVAELR   
A1021CSRP1, CSRP, CYRPCysteine-rich protein 14758086GLESTTLADK   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595GLFARIIMIGTLTALQWFIYDSVK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677GLFDEYGSK   
A309BAPMAP, UNQ1869/PRO4305, UNQ1869Adipocyte plasma membrane-associated protein24308201GLFEVNPWK   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 132455266GLFIIDDK   
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursor5802974GLFIIDPNGVIK   
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 27657347GLFTGLTPR   
A7763RTCB, HSPC117UPF0027 protein C22ORF287657015GLGHQVATDALVAMEK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023GLGLDDALEPR   
A0668RUVBL1, INO80H, NMP238RuvB-like 14506753GLGLDESGLAK   
A7569CTPS1, CTPSCTP synthase 1148491070GLGLSPDLVVCRCSNPLDTSVK   
A4575ANXA4, PIG28, ANX4Annexin A44502105GLGTDDNTLIR   
A4575ANXA4, PIG28, ANX4Annexin A44502105GLGTDEDAIISVLAYR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388GLGTDEDSLIEIICSR   
A0029ANXA6, ANX6Annexin A671773415GLGTDEDTIIDIITHR   
A4576ANXA5, ANX5, ENX2Annexin A54502107GLGTDEESILTLLTSR   
A5742AFG3L2AFG3-like protein 25802970GLGYAQYLPK   
A4379PSMD526S proteasome non-ATPase regulatory subunit 54826952GLIHPDDSVK   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103GLIPQLIGVAPEK   
A899ARAE1, MRNP41mRNA-associated protein mrnp 4162739173GLIVYQLENQPSEFR   
A7288PANK4Pantothenate kinase 48922665GLLAGNVFDWGAK   
A633AKRR1, HRB2, Rip-1KRR1 small subunit processome component homolog117676403GLLEESSFATLFPK   
A1215GANAB, G2ANNeutral alpha-glucosidase AB38202257GLLEFEHQR   
A362AEBNA1BP2, EBP2EBNA1 binding protein 21835786GLLKPGLNVVLEGPK   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581GLLPQLLGVAPEK   
A968ASNRPA1U2 small nuclear ribonucleoprotein A'50593002GLLQSGQIPGR   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475GLLTYTSWEDALSR   
A4103CUL4BCullin-4B121114298GLNNLLDENR   
A919ARBM5, H37, LUCA15RNA-binding protein 55032031GLPITITESDIR   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195GLQAQIASSGLTVEVDAPK   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171GLQDVLR   
A8173UMPSUridine 5'-monophosphate synthase4507835GLQEVGLPLHR   
A2536NCLNucleolin55956788GLSEDTTEETLK   
A2536NCLNucleolin55956788GLSEDTTEETLKESFDGSVR   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113GLSEDVSISK   
A4815FLNC, ABPL, FLN2Filamin C116805322GLSEGHTFQVAEFIVDTR   
A0369LDHBL-lactate dehydrogenase B chain4557032GLTSVINQK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425GLVASLISVK   
A1941PLEC1, PLECPlectin41322910GLVEDTLR   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171GLVLDHGAR   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidase41393561GLVLGIYSK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475GLVLGPIHK   
A996ASF3A1, SAP114Splicing factor 3 subunit 15032087GLVPEDDTKEK   
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor19923748GLVVPVIR   
A7763RTCB, HSPC117UPF0027 protein C22ORF287657015GMAAAGNYAWVNR   
A1927DNM2, DYN2Dynamin 256549119GMEELIPLVNK   
A0808MSNMoesin4505257GMLREDAVLEYLK   
A6620GLYR1, HIBDL, NP60Putative oxidoreductase GLYR140556376GMMAGPMAAFK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984GMSLNLEPDNVGVVVFGNDK   
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein154354962GMSVSDLADK   
A4687CNN3Calponin 34502923GMSVYGLGR   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206GMTLVTPLQLLLFASK   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206GMTLVTPLQLLLFASKK   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042GNAAWQEQLK   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096GNAIYNLLPDIISR   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475GNDMQVGTYIEK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113GNEEAQIFRPLK   
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein M14141152GNFGGSFAGSFGGAGGHAPGVAR   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156GNFLEIK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847GNIIISTPEK   
A6086CNDP1, CN1, CPGL2Beta-Ala-His dipeptidase precursor7023109GNILIPGINEAVAAVTEEEHK   
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoform4506725GNKPWISLPR   
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T155749577GNLANVIR   
A0396SLC25A5, ANT2ADP/ATP translocase 2156071459GNLANVIR   
A668AMATR3Matrin 362750354GNLGAGNGNLQGPR   
A3615ENO1, ENO1L1, MBPB1Alpha enolase4503571GNPTVEVDLFTSK   
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 27657347GNSLFFR   
A681CHDLBP, HBP, VGLVigilin42716280GNSLQEILER   
A602CTHOC2THO complex subunit 220799318GNSSNGNSGSNSNK   
A3807RPLP060S acidic ribosomal protein P016933546GNVGFVFTK   
A763BSLC1A5, ASCT2, M7V1Neutral amino acid transporter B(0)5032093GPAGDATVASEK   
A371ETAGLN2, CDABP0035Transgelin 24507357GPAYGLSR   
A3808RPL4, RPL160S ribosomal protein L416579885GPCIIYNEDNGIIKAFR   
A421AFAM98BFamily with sequence similarity 98, member B109452589GPEPGPQPTMEGDVLDTLEALGYK   
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 18659555GPFLLGIK   
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A94721250GPFTDVVTTNLK   
A3938VAPB, UNQ484/PRO983Vesicle-associated membrane protein-associated protein B/C4759302GPFTDVVTTNLK   
A5391NDNL2, HCA4, MAGEG1Melanoma-associated antigen G120162572GPGGSQGSQGPSPQGAR   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426GPGNPVPGPLAPLPDYMSEEK   
A668AMATR3Matrin 362750354GPGPLQER   
A0152RAN, ARA24, TC4GTP-binding nuclear protein RAN5453555GPIKFNVWDTAGQEK   
A421AFAM98BFamily with sequence similarity 98, member B109452589GPLLEEQALTK   
A3804EEF2, EF2Elongation factor 24503483GPLMMYISK   
A9035RTN4, NOGOC, NOGOReticulon 424431933GPLPAAPPVAPER   
A668AMATR3Matrin 362750354GPLPLSSQHR   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715GPPPPPTASEPTR   
A3945SEC23AProtein transport protein Sec23A38202214GPQVQQPPPSNR   
A4687CNN3Calponin 34502923GPSYGLSAEVK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954GPTVGGGLPGIGVQGLEGNLQMPGIK   
A8008TOP1DNA topoisomerase-111225260GPVFAPPYEPLPENVK   
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetase21361368GPVGLEGLLTTK   
A6287DDX6, HLR2, RCKProbable ATP-dependent RNA helicase DDX6189053803GPVKPTGGPGGGGTQTQQQMNQLK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847GPVLEALVAR   
A549BNRM, NRM29, UNQ555/PRO1112Multispanning nuclear envelope membrane protein NURIM25282391GPVLWEAR   
A969ASNRPB2U2 small nuclear ribonucleoprotein B"38149981GQAFVIFK   
A960APDCD11RRP5 protein homolog70980549GQEEVEMPSK   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481GQELAFPLSPDWQVDYESYTWR   
A4815FLNC, ABPL, FLN2Filamin C116805322GQHVPGSPFQFTVGPLGEGGAHK   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330GQLEQITGK   
A629AMKI67Antigen KI-67103472005GQNLLQTQDHAK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475GQSEDPGSLLSLFR   
A1609CALR, CRTCCalreticulin precursor4757900GQTLVVQFTVK   
A2104GRWD1, GRWD, WDR28Glutamate-rich WD-repeat-containing protein 122760272GQVEVFALR   
A2591SSB, SS-B/LaLupus La protein10835067GQVLNIQMR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323GRDWNVDLIPK   
A3804EEF2, EF2Elongation factor 24503483GRFYAFGR   
A5617MPG, AAG, ANPGDNA-3-methyladenine glycosylase62632769GRIVETEAYLGPEDEAAHSR   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475GRLDYLSSLK   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241GRLLILMEAR   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065GRMGSSLVIEISEEEVNK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidase41393561GSDEPPVFLEIHYK   
A4315DNAJC9, RCDNAJ9DNAJ homolog subfamily C member 927597059GSEEELADIK   
A7922IARS, PRO0785Isoleucyl-tRNA synthetase, cytoplasmic94721241GSELEITLTR   
A127BTHRAP3, TRAP150Thyroid hormone receptor-associated protein 3119627785GSFSDTGLGDGK   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973GSFSEQGINEFLR   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603GSGNLEAIHIIK   
A3213SMC3, BAM, BMHStructural maintenance of chromosome 34885399GSGSQSSVPSVDQFTGVGIR   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418GSGTAEVELK   
A2591SSB, SS-B/LaLupus La protein10835067GSIFVVFDSIESAK   
A0029ANXA6, ANX6Annexin A671773415GSIHDFPGFDPNQDAEALYTAMK   
A909BCPNE3, CPN3Copine III4503015GSITISAEEIK   
A561AHP1BP3, HP1-BP74Heterochromatin protein 1-binding protein 356676330GSKPAPKVSAAQR   
A8964PSMD1226S proteasome non-ATPase regulatory subunit 124506221GSLESPATDVFGSTEEGEKR   
A4240TBRG4, CPR2, FASTKD4Cell cycle progression 2 protein40217810GSLEVATQYGWVLDAEVLLDSDGEFLPVR   
A595CTCOF1Treacle protein57164975GSLGSQGAKDEPEEELQK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305GSNEEDTDTPLFIGK   
A362AEBNA1BP2, EBP2EBNA1 binding protein 21835786GSNKRPGK   
A0446CSE1L, CAS, XPO2Exportin-229029559GSNTIASAAADKIPGLLGVFQK   
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrial50592988GSNTTSHLHQAVAK   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029GSPMEISLPIALSK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000GSPQQIDHAK   
A6986MCM5, CDC46DNA replication licensing factor MCM523510448GSSAAGLTASVMR   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753GSSEQAESDNMDVPPEDDSK   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753GSSEQAESDNMDVPPEDDSKEGAGEQK   
A1303MCM7, CDC47, MCM2DNA replication licensing factor MCM733469968GSSGVGLTAAVLR   
A2184SSRP1, FACT80Structure-specific recognition protein 14507241GSSSKSSSR   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973GSTAPVGGGAFPTIVER   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932GSTDNLMDDIER   
A5683APEH, D3F15S2, D3S48EAcylamino-acid-releasing enzyme23510451GSTGFGQDSILSLPGNVGHQDVK   
A3671GLS, GLS1Glutaminase, kidney isoform, mitochondrial precursor156104878GSTHPQPGVSPPAAPAAPGPK   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793GSTTATFAAVVLYVENER   
A4527TOMM40, PEREC1, TOM40Mitochondrial import receptor subunit TOM40 homolog193083122GSVDSNWIVGATLEK   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435GSYGDLGGPIITTQVTIPK   
A9546RPL1960S ribosomal protein L194506609GTANARMPEK   
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursor5802974GTAVVNGEFK   
A6264DDX17ATP-dependent RNA helicase DDX17148613856GTAYTFFTPGNLK   
A3549SSR1, TRAPATranslocon-associated protein, alpha subunit precursor551638GTEDFIVESLDASFR   
A0668RUVBL1, INO80H, NMP238RuvB-like 14506753GTEDITSPHGIPLDLLDR   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023GTEVQVDDIKR   
A470AHIST1H1C, H1F2Histone H1.24885375GTGASGSFK   
A473AHIST1H1B, H1F5Histone H1.54885381GTGASGSFK   
A470AHIST1H1C, H1F2Histone H1.24885375GTGASGSFKLNK   
A473AHIST1H1B, H1F5Histone H1.54885381GTGASGSFKLNK   
A3815RPS2, rps2, RPS440S ribosomal protein S215055539GTGIVSAPVPK   
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5148727247GTGLQPGEEELPDIAPPLVTPDEPK   
A7923LARS, HSPC192, PIG44Leucyl-tRNA synthetase, cytoplasmic108773810GTGVVTSVPSDSPDDIAALR   
A3807RPLP060S acidic ribosomal protein P016933546GTIEILSDVQLIK   
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenase23308577GTIQVITQGTSLK   
A4573ANXA11, ANX11Annexin A1122165433GTITDAPGFDPLR   
A9484SRPRSignal recognition particle receptor alpha subunit23308697GTLGGMFGMLK   
A0452CANXCalnexin precursor66933005GTLSGWILSK   
A8017TPP2Tripeptidyl-peptidase II339880GTLTEAFPVLGGK   
A596AILF2, NF45, PRO3063Interleukin enhancer binding factor 2, 45kD24234747GTMTTGHNVADLVVILK   
A3584FASN, FASFatty acid synthase41872631GTPLISPLIK   
A1941PLEC1, PLECPlectin41322910GTQGAEEVLR   
A552CSRP72Signal recognition particle 72 kDa protein109638749GTQGATAGASSELDASK   
A376AEIF3B, EIF3S9Eukaryotic translation initiation factor 3 subunit 983367072GTQGVVTNFEIFR   
A1420RFC4Replication factor C subunit 431881687GTSISTKPPLTK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023GTSYQSPHGIPIDLLDR   
A965ASNRPN, HCERN3, SMNSmall nuclear ribonucleoprotein associated protein N13027650GTVAAAAVAATASIAGAPTQYPPGRGTPPPPVGR   
A574AIGF2BP2, IMP2, VICKZ2Insulin-like growth factor 2 mRNA-binding protein 256118219GTVEACASAEIEIMK   
A0029ANXA6, ANX6Annexin A671773415GTVRPANDFNPDADAK   
A4576ANXA5, ANX5, ENX2Annexin A54502107GTVTDFPGFDER   
A370ATUFMElongation factor Tu, mitochondrial precursor34147630GTVVTGTLER   
A9547RPL2160S ribosomal protein L2118104948GTWVQLK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426GTYFPTWEGLFWEK   
A376AEIF3B, EIF3S9Eukaryotic translation initiation factor 3 subunit 983367072GTYLATFHQR   
A3750SLC25A1, SLC20A3Tricarboxylate transport protein, mitochondrial precursor21389315GTYQGLTATVLK   
A0097TLN1, TLNTalin 116753233GVAALTSDPAVQAIVLDTASDVLDK   
A4815FLNC, ABPL, FLN2Filamin C116805322GVAGVPAEFSIWTR   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529GVAINMVTEEDKR   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595GVAPLWMR   
A0234ACTR3, ARP3Actin-like protein 35031573GVDDLDFFIGDEAIEKPTYATK   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388GVDEVTIVNILTNR   
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homolog18379349GVDIVMDPLGGSDTAK   
A330CRAB5C, RABLRas-related protein Rab-5C41393614GVDLQENNPASR   
A326ACSTF3Cleavage stimulation factor 77kDa subunit4557495GVEAVGSYAENQR   
A8828PDAP1, HASPP2828 kDa heat- and acid-stable phosphoprotein7657441GVEGLIDIENPNR   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995GVEITGFPEAQALGLEVFHAGTALK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847GVESVFDIMEMEDEER   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256GVFNVQMEPK   
A0097TLN1, TLNTalin 116753233GVGAAATAVTQALNELLQHVK   
A8207XRN25'-3' exoribonuclease 218860916GVGAEPLLPWNR   
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursor21361181GVGIISEGNETVEDIAAR   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259GVIDMGNSLIER   
A8957PSMC126S protease regulatory subunit 424430151GVILYGPPGTGK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939GVIVDKDFSHPQMPK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidase41393561GVLFASGQNLAR   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787GVLLEIEDLQVNQFK   
A8960PSMC2, MSS126S protease regulatory subunit 74506209GVLLFGPPGTGK   
A6987MCM6DNA replication licensing factor MCM67427519GVLLMLFGGVPK   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625GVNLDPLGK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418GVNLPGAAVDLPAVSEKDIQDLK   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027GVPPPPTVR   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392GVPQQIEVAR   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264GVPTGFILPIR   
A968BFAM120A, OSSAConstitutive coactivator of PPAR-gamma-like protein 139652628GVQGFQDYIEK   
A3804EEF2, EF2Elongation factor 24503483GVQYLNEIK   
A3804EEF2, EF2Elongation factor 24503483GVQYLNEIKDSVVAGFQWATK   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715GVSAFSTWEK   
A6267DDX21Nucleolar RNA helicase 250659095GVTFLFPIQAK   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 114251209GVTFNVTTVDTK   
A494AH2AFY, MACROH2A1Core histone macro-H2A.193141020GVTIASGGVLPNIHPELLAK   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983GVVDSEDIPLNLSR   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191GVVDSEDLPLNISR   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594GVVDSEDLPLNISR   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741GVVEVTHDLQK   
A3803EEF1D, EF1DElongation factor 1-delta194239731GVVQELQQAISK   
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein154354962GVYSEETLR   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129GWAAAVTFHPR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847GWAQLTDK   
A4323FKBP3, FKBP25FK506-binding protein 34503727GWDEALLTMSK   
A2536NCLNucleolin55956788GYAFIEFASFEDAK   
A2589RALY, HNRPCL2, P542RNA-binding protein Raly8051631GYAFVQYSNER   
A3584FASN, FASFatty acid synthase41872631GYAVLGGER   
A6276DDX46Probable ATP-dependent RNA helicase DDX4641327773GYAYTFITEDQAR   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529GYDVIAQAQSGTGK   
A3584FASN, FASFatty acid synthase41872631GYDYGPHFQGILEASLEGDSGR   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883GYFEYIEENK   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883GYFEYIEENKYSR   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 14507879GYGFGLIK   
A3479VDAC3Voltage-dependent anion-selective channel protein 325188179GYGFGMVK   
A0583PUF60, FIR, ROBPIPoly-U binding splicing factor PUF6017298690GYGFIEYEK   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787GYGFVHFETQEAAER   
A2515TIAL1Nucleolysin TIAR4507499GYGFVSFYNK   
A1021CSRP1, CSRP, CYRPCysteine-rich protein 14758086GYGYGQGAGTLSTDK   
A1021CSRP1, CSRP, CYRPCysteine-rich protein 14758086GYGYGQGAGTLSTDKGESLGIK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256GYIDLSK   
A376AEIF3B, EIF3S9Eukaryotic translation initiation factor 3 subunit 983367072GYIFLEYASPAHAVDAVK   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793GYLDDPTVPR   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794GYLISGSSYAR   
A451ETXNDC5, MUTED, TLP46Thioredoxin domain containing protein 5 precursor119575627GYPTLLWFR   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885GYSFTTTAER   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315GYSLVSGGTDNHLVLVDLRPK   
A0370LDHA, PIG19L-lactate dehydrogenase A chain5031857GYTSWAIGLSVADLAESIMK   
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursor10864011GYWGGPAFLR   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315HADIVTTTTHK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984HALIIYDDLSK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256HAVSDPSILDSLDLNEDER   
A8968PSMD326S proteasome non-ATPase regulatory subunit 325777612HDADGQATLLNLLLR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012HDVVFLITK   
A2341ACTN1Alpha-actinin 14501891HEAFESDLAAHQDR   
A2344ACTN4Alpha-actinin 412025678HEAFESDLAAHQDR   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091HEGLGAFYK   
A3286LRRC59, PRO1855Leucine-rich repeat-containing protein 5940254924HEILQWVLQTDSQQ   
A2083WDR57, SNRNP40, PRP8BPU5 snRNP-specific 40 kDa protein115298668HELLLGAGSGPGAGQQQATPGALLQAGPPR   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254HELLQPFNVLYEK   
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating40068518HEMLPASLIQAQR   
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A94721250HEQILVLDPPTDLK   
A8017TPP2Tripeptidyl-peptidase II339880HEQISDLER   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435HESGASIK   
A581AEIF5B, IF2Eukaryotic translation initiation factor 5B84043963HFEATDILVSK   
A3584FASN, FASFatty acid synthase41872631HFLLEEDKPEEPTAHAFVSTLTR   
A6905LTA4H, LTA4Leukotriene A-4 hydrolase4505029HFNALGGWGELQNSVK   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932HFSGLEEAVYR   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932HFSGLEEAVYRNIQACK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191HFSVEGQLEFR   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594HFSVEGQLEFR   
A6551GPIGlucose-6-phosphate isomerase18201905HFVALSTNTTK   
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursor10864011HFYQPIWTLVGAGAK   
A7920HARS, HRSHistidyl-tRNA synthetase, cytoplasmic6996014HGAEVIDTPVFELK   
A008BSIN3APaired amphipathic helix protein Sin3a223941785HGGGTESLFFDKVR   
A9545RPL18A60S ribosomal protein L18A169163931HGGRAHSIQIMK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995HGIPTAQWK   
A0234ACTR3, ARP3Actin-like protein 35031573HGIVEDWDLMER   
A6339dkc1, DKC1, NOLA4Dyskerin4503337HGKPTDSTPATWKQEYVDYSESAK   
A3584FASN, FASFatty acid synthase41872631HGLYLPTR   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034HGRGGQSALR   
A9559RPL3, rpl3, ASC-160S ribosomal protein L34506649HGSLGFLPR   
A9547RPL2160S ribosomal protein L2118104948HGVVPLATYMR   
A9654RPS940S ribosomal protein S914141193HIDFSLR   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827HIDLVEGDEGR   
A7910CARSCysteinyl-tRNA synthetase62240992HIEALLGSPCGK   
A0777XRCC5, G22P2, KARP-1X-ray repair cross-complementing protein 510863945HIEIFTDLSSR   
A5201TPT1, HDCMB21Tumor protein, translationally-controlled 14507669HILANFK   
A4684CGI-99, CLE7UPF0568 protein C14ORF1667706322HILGFDTGDAVLNEAAQILR   
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 34503507HILILQNK   
A1222RPL5, MSTP03060S ribosomal protein L514591909HIMGQNVADYMR   
A4815FLNC, ABPL, FLN2Filamin C116805322HIPGSPFTAK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191HIYYITGETK   
A8192VRK1Serine/threonine protein kinase VRK14507903HLAEQFAVGEIITDMAK   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741HLAGLGLTEAIDK   
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursor32454741HLAGLGLTEAIDKNK   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129HLAVMPHPER   
A3588PYGBGlycogen phosphorylase, brain form21361370HLDHVAALFPGDVDR   
A369CRRBP1Ribosome-binding protein 1110611220HLEEIVEK   
A3588PYGBGlycogen phosphorylase, brain form21361370HLEIIYAINQR   
A172CMYO1CUnconventional myosin-Ic124494238HLGYKPEEYKMGR   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847HLILPEK   
A0280YWHAE14-3-3 protein epsilon5803225HLIPAANTGESK   
A482EWDR18WD-repeat containing protein 1856243583HLLGAEHGDEPR   
A3586ACLYATP-citrate synthase38569421HLLVHAPEDK   
A245CNUP155Nuclear pore complex protein Nup1554758844HLLVSNVGGDGEEIER   
A8008TOP1DNA topoisomerase-111225260HLQDLMEGLTAK   
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.a19557656HLQLAIR   
A4176ORC4L, ORC4Origin recognition complex subunit 4-like32454750HLSELLK   
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursor5802974HLSVNDLPVGR   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747HLTDAYFK   
A0152RAN, ARA24, TC4GTP-binding nuclear protein RAN5453555HLTGEFEK   
A6217CSNK2A2, CK2A2Casein kinase II, alpha' chain4503097HLVSPEALDLLDK   
A3579CYFIP1Cytoplasmic FMR1 interacting protein 124307969HMLLKVMGFGLYLMDGSVSNIYK   
A0295PPP2R1ASerine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoform21361399HMLPTVLR   
A0967CUL2Cullin homolog 219482174HNALIQEVISQSR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012HNIMDFAMPYFIQVMK   
A8812TXNL2, GLRX3, PICOTGlutaredoxin-395113651HNIQFSSFDIFSDEEVR   
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursor20070125HNQLPLVIEFTEQTAPK   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947HPDADSLYVEK   
A1379HMGB2, HMG2High mobility group protein B2194688135HPDSSVNFAEFSK   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968HPDVEVDGFSELR   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968HPDVEVDGFSELRWDDQQK   
A3586ACLYATP-citrate synthase38569421HPWDDISYVLPEHMSM   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747HQEGEIFDTEK   
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L667189747HQEGEIFDTEKEK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885HQGVMVGMGQK   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881HQGVMVGMGQK   
A1135PTBP1, PTBPolypyrimidine tract-binding protein 14506243HQNVQLPR   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926HQSFVLVGETGSGK   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771HQVQLLGR   
A3211CKAP4, P63P63 protein19920317HSEAFEALQQK   
A9541RPL1260S ribosomal protein L124506597HSGNITFDEIVNIAR   
A0208RANGAP1, SDRan GTPase-activating protein 14506411HSLLQTLYK   
A7526PSMB1, PSC5Proteasome subunit beta type 14506193HSNNKAMTTGAIAAMLSTILYSR   
A3584FASN, FASFatty acid synthase41872631HSQDLAFLSMLNDIAAVPATAMPFR   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096HSQELPAILDDTTLSGSDR   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191HSQFIGYPITLFVEK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594HSQFIGYPITLYLEK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000HSVGVVIGR   
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT166005757HTDVQFYTEVGEITTDLGK   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256HVAEVLEYTK   
A639CTpr, tpr, TPRNuclear pore complex-associated protein TPR114155142HVEDLLTK   
A0433TPI1, TPI, TIMTriosephosphate isomerase 14507645HVFGESDELIGQK   
A5087PLS3Plastin 3209862851HVIPMNPNTDDLFK   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947HVLFPLK   
A6663GSSGlutathione synthetase4504169HVLSVLSK   
A3579CYFIP1Cytoplasmic FMR1 interacting protein 124307969HVQLLGR   
A9653RPS740S ribosomal protein S74506741HVVFIAQR   
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7a4506661HWGGNVLGPK   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa protein5729877HWPFMVVNDAGRPK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892HWPFQVINDGDKPK   
A712CXPO1, CRM1CRM1 protein4507943HWPTFISDIVGASR   
A1489ITGA3, MSK18Integrin alpha-3 precursor6006011HWVTSWQTRDQYY   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950HYGPGWVSMANAGK   
A6374ADAR, ADAR1, DSRADDouble-stranded RNA-specific adenosine deaminase70166852HYPVFENPK   
A2188SMARCE1, BAF57SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily E, member 121264355IAAEIAQAEEQAR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012IAAYLFK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677IADDKYNDTFWK   
A0117NSFVesicle-fusing ATPase156564401IAEESNFPFIK   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796IAEIEAEMAR   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor46593007IAEVDASVVR   
A8165GDH, ugd, UGDHUDP-glucose 6-dehydrogenase4507813IAILGFAFK   
A1135PTBP1, PTBPolypyrimidine tract-binding protein 14506243IAIPGLAGAGNSVLLVSNLNPER   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715IAKNLDSEK   
A0326VIL2, EZREzrin161702986IALLEEAR   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301IALTDNALIAR   
A7375PGM1Phosphoglucomutase 121361621IALYETPTGWK   
A1407MRE11A, HNGS1, MRE11Double-strand break repair protein MRE11A5031923IALYGLGSIPDER   
A9531PCBP1Poly(rC)-binding protein 1460771IANPVEGSSGR   
A9532PCBP2Poly(rC)-binding protein 214141168IANPVEGSTDR   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103IAPLAEGALPYNLAELQR   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581IAPLEEGTLPFNLAEAQR   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968IAPPEAPVTGYMFG   
A573AIGF2BP1, IMP-1, CRDBPInsulin-like growth factor 2 mRNA-binding protein 156237027IAPPETPDSK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216IAPVHIDSEAISALVK   
A0326VIL2, EZREzrin161702986IAQDLEMYGINYFEIK   
A0808MSNMoesin4505257IAQDLEMYGVNYFSIK   
A1303MCM7, CDC47, MCM2DNA replication licensing factor MCM733469968IAQPGDHVSVTGIFLPILR   
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunit4504041IAQSDYIPTQQDVLR   
A3803EEF1D, EF1DElongation factor 1-delta194239731IASLEVENQSLR   
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1B11034845IASLPQEVQDVSLLEK   
A031FRPRD1A, P15RSRegulation of nuclear pre-mRNA domain-containing protein 1A21361709IASLPVEVQEVSLLDK   
A8173UMPSUridine 5'-monophosphate synthase4507835IASWADLVNAHVVPGSGVVK   
A290CPLIN3, M6PRBP1, TIP47Perilipin-368846601IATSLDGFDVASVQQQR   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113IAVEPVNPSELPK   
A7115NAT10, ALP, UPF0202N-acetyltransferase 1010433597IAVHPDYQGMGYGSR   
A1745EPHA2, ECKEphrin type-A receptor 2 precursor32967311IAYSLLGLK   
A4146TMPO, LAP2Thymopoietin, isoform alpha4507555IDASELSFPFHESILK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414IDASKNEEDEGHSNSSPR   
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursor4758304IDATSASVLASR   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250IDDIFER   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor46593007IDDMMFVLQGQWMR   
A1609CALR, CRTCCalreticulin precursor4757900IDDPTDSKPEDWDKPEHIPDPDAK   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435IDEPLEGSEDR   
A385AEIF3L, EIF3EIP, EIF3S6IPEukaryotic translation initiation factor 3 subunit 6 interacting protein7705433IDESIHLQLR   
A385AEIF3L, EIF3EIP, EIF3S6IPEukaryotic translation initiation factor 3 subunit 6 interacting protein7705433IDESIHLQLREK   
A0242CAV1, CAV, MSTP085Caveolin-115451856IDFEDVIAEPEGTHSFDGIWK   
A328ESMCHD1Structural maintenance of chromosomes flexible hinge domain-containing protein 1148839305IDFLPHYDTLVK   
A994ASETSET protein338039IDFYFDENPYFENK   
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain154759259IDGITIQAR   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675IDHILDAL   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594IDIIPNPQER   
A5087PLS3Plastin 3209862851IDINMSGFNETDDLKR   
A0368RPL13A, RPL13a60S ribosomal protein L13a6912634IDKYTEVLK   
A681CHDLBP, HBP, VGLVigilin42716280IDLPAENSNSETIIITGK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794IDLRPVLGEGVPILASFLR   
A3945SEC23AProtein transport protein Sec23A38202214IDMNLTDLLGELQR   
A884APSIP1, DFS70, LEDGFLens epithelium-derived growth factor190014588IDNLDVNR   
A027FPAF1, PD2RNA polymerase II-associated factor 1 homolog42476169IDPNVLLDPADEK   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796IDQISIEELDIIYK   
A2341ACTN1Alpha-actinin 14501891IDQLEGDHQLIQEALIFDNK   
A6029CDK9, CDC2L4, TAKCell division protein kinase 94502747IDSDDALNHDFFWSDPMPSDLK   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505IDSEGGVSANHTSR   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392IDSIPHLNNSTPLVDPSVYGYGVQK   
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B114043072IDTIEIITDR   
A7943YARSTyrosyl-tRNA synthetase, cytoplasmic4507947IDVGEAEPR   
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 24504505IDVVVNNAGILR   
A9654RPS940S ribosomal protein S914141193IEDFLER   
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunit163965364IEDLSQQAQLAAAEK   
A001BSF3B2, SAP145Splicing factor 3B subunit 255749531IEEAMDGSETPQLFTVLPEK   
A3615ENO1, ENO1L1, MBPB1Alpha enolase4503571IEEELGSK   
A7176NRD1Nardilysin precursor156071450IEEFLSSFEEK   
A668AMATR3Matrin 362750354IEELDQENEAALENGIK   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771IEESDQGPYAIILAPTR   
A3808RPL4, RPL160S ribosomal protein L416579885IEEVPELPLVVEDK   
A3808RPL4, RPL160S ribosomal protein L416579885IEEVPELPLVVEDKVEGYK   
A8960PSMC2, MSS126S protease regulatory subunit 74506209IEFSLPDLEGR   
A681CHDLBP, HBP, VGLVigilin42716280IEGDPQGVQQAK   
A895BARCN1, COPDCoatomer delta subunit11863154IEGLLAAFPK   
A895BARCN1, COPDCoatomer delta subunit11863154IEGLLAAFPKLMNTGK   
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 74506013IEGLQNLVNLR   
A7176NRD1Nardilysin precursor156071450IENLTEEAFNTQVTALIK   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335IESDVQEPTEPEDDLDIMLGNK   
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 394757926IESIQLMMDSETGR   
A0430LMNB1, LMN2, LMNBLamin B15031877IESLSSQLSNLQK   
A4181PDS5A, PDS5, PIG54PDS5, regulator of cohesion maintenance, homolog A155030216IETDLPQIR   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329IETIEVMEDR   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158IETMLGDVAVAVHPK   
A3211CKAP4, P63P63 protein19920317IETNENNLESAK   
A640ALEO1, RDLRNA polymerase-associated protein LEO120270337IEVEIPK   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950IEVEKPFAIAK   
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursor4758950IEVEKPFAIAKE   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1169164476IEVIEIMTDR   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445IEVIEIMTDR   
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 142544159IEVPLYSLLEQTHLK   
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursor9910280IEYQFFEDR   
A744ANCBP1, CBP80, NCBP80 kDa nuclear cap binding protein4505343IFANTESYLK   
A9545RPL18A60S ribosomal protein L18A169163931IFAPNHVVAK   
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM233356547IFASIAPSIYGHEDIKR   
A0924TOP2A, TOP2DNA topoisomerase 219913406IFDEILVNAADNK   
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 beta19913408IFDEILVNAADNK   
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 229826335IFDIDEAEEGVK   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762IFDSEEILAGYK   
A326ACSTF3Cleavage stimulation factor 77kDa subunit4557495IFELGLK   
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide II117020IFEMGPVFTL   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926IFEPPPPK   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926IFEPPPPKK   
A4783EMD, EDMD, STAEmerin4557553IFEYETQR   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793IFGPIWNR   
A3696MDH2Malate dehydrogenase, mitochondrial precursor21735621IFGVTTLDIVR   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264IFHELTQTDK   
A3805EIF3D, EIF3S7Eukaryotic translation initiation factor 3 subunit 74503523IFHTVTTTDDPVIR   
A965ASNRPN, HCERN3, SMNSmall nuclear ribonucleoprotein associated protein N13027650IFIGTFK   
A4220SMC4L1, SMC4, CAPCStructural maintenance of chromosomes protein 450658065IFNLSGGEK   
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursor32307144IFQNLDGALDEVVLK   
A1164IPO5, KPNB3, RANBP5Importin 524797086IFSIIAEGEMHEAIK   
A7920HARS, HRSHistidyl-tRNA synthetase, cytoplasmic6996014IFSIVEQR   
A047CIPO9, IMP9, RANBP9Importin-921361659IFTMAEVYGIR   
A3793PHBProhibitin4505773IFTSIGEDYDER   
A0978PYGLGlycogen phosphorylase, liver form71037379IFVDIEK   
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A14504445IFVGGIKEDTEEHHLR   
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A334740329IFVGGIKEDTEEYNLR   
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/B55956919IFVGGLNPEATEEK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414IFVGGLSPDTPEEK   
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D014110414IFVGGLSPDTPEEKIR   
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 324234753IFVNDDR   
A6271DDX27, RHLP, HSPC259Probable ATP-dependent RNA helicase DDX2719743937IFVNSNTDVAPFLR   
A6324DHX29, DDX29ATP-dependent RNA helicase DHX2967782362IGACELNEPK   
A0669RUVBL2, INO80J, TIP48RuvB-like 25730023IGAHSHIR   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762IGALEGYR   
A2030MORF4L1, MRG15, FWP006Transcription factor-like protein MRG155803102IGAMLAYTPLDEK   
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain61744475IGDLQAFQGHGAGNLAGLK   
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1115387104IGDPLLEDTR   
A0430LMNB1, LMN2, LMNBLamin B15031877IGDTSVSYK   
A996ASF3A1, SAP114Splicing factor 3 subunit 15032087IGEEEIQKPEEK   
A3588PYGBGlycogen phosphorylase, brain form21361370IGEEFLTDLSQLK   
A3588PYGBGlycogen phosphorylase, brain form21361370IGEEFLTDLSQLKK   
A1477RBBP7, RBAP46Histone acetyltransferase type B subunit 24506439IGEEQSAEDAEDGPPELLFIHGGHTAK   
A0448CDK1, CDC2, CDC28ACrll division cycle 24502709IGEGTYGVVYK   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794IGEYLEK   
A199AABCF1, ABC50ATP-binding cassette sub-family F (GCN20) member 169354671IGFFNQQYAEQLR   
A0099ITGB1, FNRB, MDF2Integrin beta-1 precursor19743823IGFGSFVEK   
A0326VIL2, EZREzrin161702986IGFPWSEIR   
A0808MSNMoesin4505257IGFPWSEIR   
A0819RDXRadixin4506467IGFPWSEIR   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796IGFVGFPSVGK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000IGGDAATTVNNSTPDFGFGGQK   
A446AFUBP1Far upstream element binding protein 117402900IGGDAGTSLNSNDYGYGGQK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000IGGGIDVPVPR   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471IGGIGTVPVGR   
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 24503475IGGIGTVPVGR   
A446AFUBP1Far upstream element binding protein 117402900IGGNEGIDVPIPR   
A0439PHB2, BAP, REAProhibitin 2221307584IGGVQQDTILAEGLHFR   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 132455266IGHPAPNFK   
A583DCLUHPutative eukaryotic translation initiation factor 3 subunit87162455IGIGELITR   
A8047TXNRD1, TR, TR1Thioredoxin reductase 133519430IGLETVGVK   
A5087PLS3Plastin 3209862851IGLFADIELSR   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394IGLFGGAGVGK   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768IGLIQGNR   
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 394757926IGLPHSIK   
A086BTCEA1, GTF2S, TFIISTranscription elongation factor A protein 15803191IGMSVNAIR   
A0492STIP1Stress-induced-phosphoprotein 15803181IGNSYFK   
A3586ACLYATP-citrate synthase38569421IGNTGGMLDNILASK   
A0295PPP2R1ASerine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoform21361399IGPILDNSTLQSEVKPILEK   
A1308BLMHBleomycin hydrolase4557367IGPITPLEFYR   
A9541RPL1260S ribosomal protein L124506597IGPLGLSPK   
A6029CDK9, CDC2L4, TAKCell division protein kinase 94502747IGQGTFGEVFK   
A9559RPL3, rpl3, ASC-160S ribosomal protein L34506649IGQGYLIK   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000IGQQPQQPGAPPQQDYTK   
A1562GPIa, ITGA2, CD49BIntegrin alpha-2 precursor116295258IGQTSSSVSFK   
A9651RPS540S ribosomal protein S513904870IGRAGTVR   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091IGTFERFISGSMAGATAQTFIYPMEVMK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519IGVDLIMK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519IGVDLIMKTCFSPNR   
A6732HMGCS1, HMGCSHydroxymethylglutaryl-CoA synthase, cytoplasmic148298764IGVFSYGSGLAATLYSLK   
A2037CHD4Chromodomain-helicase-DNA-binding protein 451599156IGVMSLIR   
A6267DDX21Nucleolar RNA helicase 250659095IGVPSATEIIK   
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 14503471IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK   
A5200TUBG2Tubulin gamma-2 chain7706751IHEDIFDIIDR   
A339ADEKDEK oncogene (DNA binding)4503249IHFFLSK   
A5178TUBA1A, TUBA3Tubulin alpha-1A chain17986283IHFPLATYAPVISAEK   
A5180TUBA1C, TUBA6Tubulin alpha-1C chain14389309IHFPLATYAPVISAEK   
A0369LDHBL-lactate dehydrogenase B chain4557032IHPVSTMVK   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960IHTEPQLSAALEYVR   
A3531KTN1, CG1, PDIA6Kinectin118498356IHVSYQETQQMQMKFQQVR   
A173BWDR82, WDR82A, UNQ9342/PRO34047WD repeat-containing protein 82147904340IHVWNGESGIK   
A009ANCLNNicalin precursor51873031IIAEALTR   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursor4885281IIAEGANGPTTPEADKIFLER   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904IIAHFLIQQYLK   
A7989TKT, TKT1Transketolase205277463IIALDGDTK   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885IIAPPER   
A4555ACTA1, ACTAActin, alpha skeletal muscle4501881IIAPPER   
A7260PYCR2, P5CR2Pyrroline 5-carboxylate reductase21361454IIASSPEMNLPTVSALR   
A1418LLDBP, RFC1, RFC140Replication factor C subunit 132528306IIDEDGLLNLIR   
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 protein30581135IIDETMAQLQDLK   
A1396MSH6, GTBPDNA mismatch repair protein MSH64504191IIDFLSALEGFK   
A024FDDX42ATP-dependent RNA helicase DDX4245446747IIDPLPPIDHSEIDYPPFEK   
A8165GDH, ugd, UGDHUDP-glucose 6-dehydrogenase4507813IIDSLFNTVTDK   
A3823RPS840S ribosomal protein S84506743IIDVVYNASNNELVR   
A2591SSB, SS-B/LaLupus La protein10835067IIEDQQESLNK   
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunit23238211IIEETLALK   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796IIENELEGFGIR   
A1420RFC4Replication factor C subunit 431881687IIEPLTSR   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601IIEVVDAIMTTAQSHQR   
A1381CBX3, CCDC32Chromobox protein homolog 320544151IIGATDSSGELMFLMK   
A887APTRF, FKSG13Polymerase I and transcript release factor42734430IIGAVDQIQLTQAQLEER   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000IIGDPYK   
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursor155722983IIGQFGVGFYSAFMVADRVEVYSR   
A1419RFC2, RFC40Replication factor C subunit 231563534IIILDEADSMTDGAQQALR   
A0446CSE1L, CAS, XPO2Exportin-229029559IIIPEIQK   
A478BGLG1, CFR1, ESL1Golgi apparatus protein 1 precursor54633312IIIQESALDYR   
A0183PRPF40A, FBP11, FLAF1Pre-mRNA-processing factor 40 homolog A151301228IIKDILK   
A6984MCM3, HCC5DNA replication licensing factor MCM36631095IIKPVLTQESATYIAEEYSR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435IILDLISESPIK   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932IILLFDAHK   
A1390EHD4, HCA10, HCA11EH-domain containing protein 421264315IILLFDAHK   
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursor4506675IILPEGAKNIEIDSPYEISR   
A991BKHSRP, FUBP2Far upstream element binding protein 2154355000IINDLLQSLR   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa protein5729877IINEPTAAAIAYGLDK   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa protein5729877IINEPTAAAIAYGLDKK   
A0451HSPA5, GRP78Heat shock 70kDa protein 516507237IINEPTAAAIAYGLDKR   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892IINEPTAAAIAYGLDR   
A1319EHD1, PAST, PAST1EH-domain containing protein 130240932IINTPEVVR   
A1426RFC5Replication factor C subunit 56677723IIPALQSR   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926IIPLYSTLPPQQQQR   
A3807RPLP060S acidic ribosomal protein P016933546IIQLLDDYPK   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306IISAASEGGANVFTVSYFK   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841IISSDRDLLAVVFYGTEK   
A0280YWHAE14-3-3 protein epsilon5803225IISSIEQK   
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunit58331171IITEGFEAAK   
A308CQKI, HKQ, QUAKINGQuaking45827706IITGPAPVLPPAALR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein K14165435IITITGTQDQIQNAQYLLQNSVK   
A9532PCBP2Poly(rC)-binding protein 214141168IITLAGPTNAIFK   
A9531PCBP1Poly(rC)-binding protein 1460771IITLTGPTNAIFK   
A7183NSUN2, SAKI, TRM4tRNA (cytosine-5-)-methyltransferase NSUN239995082IITVSMEDVK   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447IIVDELK   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447IIVDELKQEVISTSSK   
A6548G6PDGlucose-6-phosphate 1-dehydrogenase108773793IIVEKPFGR   
A8957PSMC126S protease regulatory subunit 424430151IKDYLLMEEEFIR   
A1095HMGB1, HMG1, FM1High mobility group protein B120138433IKGEHPGLSIGDVAK   
A6306DAKBifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)20149621IKMATADEIVK   
A3804EEF2, EF2Elongation factor 24503483IKPVLMMNKMDR   
A1379HMGB2, HMG2High mobility group protein B2194688135IKSEHPGLSIGDTAK   
A4356NPLOC4, NPL4Nuclear protein localization protein 4 homolog157426879IKSGCEGHLPWPNGICTK   
A5087PLS3Plastin 3209862851IKVPVDWSK   
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunit4506003IKYPENFFLLR   
A0213IQGAP1Ras GTPase-activating-like protein IQGAP14506787ILAIGLINEALDEGDAQK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113ILAQVVGDVDTSLPR   
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursor9910280ILASPVELALVVMK   
A3541TCP1, CCT1, CCTAT-complex protein 1, alpha subunit57863257ILATGANVILTTGGIDDMCLK   
A7989TKT, TKT1Transketolase205277463ILATPPQEDAPSVDIANIR   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113ILDAVVAQEPLHR   
A3515SEPT2, DIFF6, NEDD5Septin-256549640ILDEIEEHNIK   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625ILDMCCAPGGKTSYMAQLMK   
A0208RANGAP1, SDRan GTPase-activating protein 14506411ILDPNTGEPAPVLSSPPPADVSTFLAFPSPEK   
A4317ERP29, ERP28Endoplasmic reticulum resident protein 295803013ILDQGEDFPASEMTR   
A1036TNPO1, KPNB2, MIP1Importin beta-2 subunit23510381ILDSNKR   
A6265DDX18ATP-dependent RNA helicase DDX1838327634ILDVGFEEELK   
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursor20070125ILEFFGLK   
A6268DDX23DEAD/DEAH box helicase domain containing protein 2341327771ILEHMPVSNQKPDTDEAEDPEK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121ILELLRPDPNTGK   
A3159DPF2, BAF45D, REQZinc-finger protein ubi-d45454004ILEPDDFLDDLDDEDYEEDTPK   
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-27305503ILEPGLNILIPVLDR   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564ILEQEEEEEQAGKPGEPSK   
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursor9910280ILETTTFFQR   
A2551SRSF4, SFRS4, SRP75Serine/arginine-rich splicing factor 421361282ILEVDLK   
A3793PHBProhibitin4505773ILFRPVASQLPR   
A0446CSE1L, CAS, XPO2Exportin-229029559ILFSSLILISK   
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursor50345984ILGADTSVDLEETGR   
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gamma4503481ILGLLDAYLK   
A3813RPL10A, NEDD660S ribosomal protein L10a15431288ILGPGLNK   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027ILGPQGNTIK   
A3542CCT8, CCTQT-complex protein 1, theta subunit48762932ILGSGISSSSVLHGMVFK   
A897BCOPG, COPG1Coatomer gamma subunit11559929ILHLLGQEGPK   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunit5453603ILIANTGMDTDK   
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursor48255889ILIEDWK   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159ILIGSSFPLSGGR   
A3586ACLYATP-citrate synthase38569421ILIIGGSIANFTNVAATFK   
A596AILF2, NF45, PRO3063Interleukin enhancer binding factor 2, 45kD24234747ILITTVPPNLR   
A0850VIMVimentin62414289ILLAELEQLK   
A6551GPIGlucose-6-phosphate isomerase18201905ILLANFLAQTEALMR   
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like protein11067747ILLGGYQSR   
A6579AGL, GDEGlycogen debranching enzyme116734860ILLLNEMEK   
A7183NSUN2, SAKI, TRM4tRNA (cytosine-5-)-methyltransferase NSUN239995082ILLTQENPFFR   
A1166XPOTExportin T8051636ILMAIDSELVDR   
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidase127799173ILMDKPEMNVVLK   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623ILNDVQDR   
A9493TFRCTransferrin receptor protein 1224192ILNIFGVIK   
A6277DDX47, E4-DBP, MST162DEAD box protein 4720149629ILNMDFETEVDK   
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursor4757732ILPEYLSNWTMEK   
A596AILF2, NF45, PRO3063Interleukin enhancer binding factor 2, 45kD24234747ILPTLEAVAALGNK   
A0145PRKACA, PKACA, KIN27cAMP-dependent protein kinase, alpha-catalytic subunit4506055ILQAVNFPFLVK   
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenase23308577ILQDGGLQVVEK   
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor33519475ILQDIASGSHPFSQVLK   
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like protein11067747ILQEAQNLMALTNVDTPLK   
A3977EMC2, TTC35ER membrane protein complex subunit 27661910ILQEDPTNTAAR   
A7930QARS, PRO2195Glutaminyl-tRNA synthetase4826960ILQLVATGAVR   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995ILSGPFVQK   
A596AILF2, NF45, PRO3063Interleukin enhancer binding factor 2, 45kD24234747ILSHGGFR   
A7274PADI2, PDI2Peptidylarginine deiminase type 2122939159ILSNESLVQENLYFQR   
A9544RPL1860S ribosomal protein L184506607ILTFDQLALDSPK   
A4379PSMD526S proteasome non-ATPase regulatory subunit 54826952ILTLSQIGR   
A9484SRPRSignal recognition particle receptor alpha subunit23308697ILTLTYVDK   
A2411SMC2, CAPE, SMC2L1Structural maintenance of chromosomes protein 2110347425ILTTIEDLDQK   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371ILVATNLFGR   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623ILVATNLFGR   
A002AMYOF, FER1L3Myoferlin7305053ILVELATFLEK   
A4815FLNC, ABPL, FLN2Filamin C116805322ILVGPSEIGDASK   
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 3517999541ILVGTNLVR   
A574AIGF2BP2, IMP2, VICKZ2Insulin-like growth factor 2 mRNA-binding protein 256118219ILVPTQFVGAIIGK   
A897BCOPG, COPG1Coatomer gamma subunit11559929ILYLINQGEHLGTTEATEAFFAMTK   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034ILYLTPEQEK   
A0773ETF1, ERF1, RF1Eukaryotic peptide chain release factor subunit 14759034ILYLTPEQEKDK   
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide II117020ILYMTDEVNDPSLTIK   
A7449PNKP, DEM1Polynucleotide kinase-3'-phosphatase31543419ILYPEIPR   
A2044SMARCA5, SNF2H, WCRF135SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily A, member 521071058IMAQIER   
A3657PYCR1, PIG45Pyrroline-5-carboxylate reductase24797095IMASSPDMDLATVSALR   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841IMATPEQVGK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394IMDPNIVGSEHYDVAR   
A0261PFKM, PFKX6-phosphofructokinase, muscle type266453768IMEIVDAITTTAQSHQR   
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolic22547186IMGLDLPDGGHLTHGFMTDK   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315IMGLDLPDGGHLTHGYMSDVK   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117IMGNLGAADIDHK   
A3804EEF2, EF2Elongation factor 24503483IMGPNYTPGK   
A4103CUL4BCullin-4B121114298IMIIFRFIYGK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594IMKAQALR   
A8963PSMD1126S proteasome non-ATPase regulatory subunit 1128872725IMLNTPEDVQALVSGK   
A6339dkc1, DKC1, NOLA4Dyskerin4503337IMLPGVLR   
A3816RPS340S ribosomal protein S315718687IMLPWDPTGK   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091IMMQVHGSK   
A3770SLC25A24, APC1, MCSC1Solute carrier family 25 member 24148491091IMMQVHGSKSDK   
A094BTCERG1, CA150, TAF2STranscription elongation regulator 121327715IMQAKEDFK   
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursor9295347IMQEEGQPLKLPDTK   
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunit4506003IMRPTDVPDQGLLCDLLWSDPDK   
A468CSEC22B, SEC22L1Vesicle trafficking protein SEC22B94429050IMVANIEEVLQR   
A5973CAPN2, CANPL2Calpain-2 catalytic subunit157389005IMVDMLDSDGSGK   
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursor10864011IMYLSEAYFR   
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein M14141152INEILSNALKR   
A9532PCBP2Poly(rC)-binding protein 214141168INEIRQMSGAQIK   
A5866ATAD3AATPase family, AAA domain containing, protein 3A21749446INEMVHFDLPGQEER   
A1057RBBP4, RBAP48Retinoblastoma-binding protein 45032027INHEGEVNRAR   
A681CHDLBP, HBP, VGLVigilin42716280INIPPPSVNR   
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 138327552INIPPQR   
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 14758256INLIAPPR   
A3588PYGBGlycogen phosphorylase, brain form21361370INPSSMFDVHVK   
A7375PGM1Phosphoglucomutase 121361621INQDPQVMLAPLISIALK   
A0782NuMA, NUMA1, NUMANuMA protein71361682INQLSEENGDLSFK   
A3678PMPCA, INPP5E, MPPAMitochondrial processing peptidase alpha subunit, mitochondrial precursor24308013INREVLHSYLR   
A351ESRBD1S1 RNA-binding domain-containing protein 1193786457INSFLEK   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847INVLLQAFISQLK   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735INVYYNEATGGK   
A002AMYOF, FER1L3Myoferlin7305053IPAHQVLYSTSGENASGK   
A613CTIMM50, TIM50, PRO1512Import inner membrane translocase subunit TIM50L mitochondrial precursor48526509IPDEFDNDPILVQQLR   
A0452CANXCalnexin precursor66933005IPDPEAVKPDDWDEDAPAK   
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursor98986464IPDQLVILDMK   
A201AACTL6A, BAF53, BAF53AActin-like protein 6A4757718IPEGLFDPSNVK   
A9493TFRCTransferrin receptor protein 1224192IPELNKVAR   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305IPENIYR   
A6579AGL, GDEGlycogen debranching enzyme116734860IPFASLASR   
A6986MCM5, CDC46DNA replication licensing factor MCM523510448IPGIIIAASAVR   
A0446CSE1L, CAS, XPO2Exportin-229029559IPGLLGVFQK   
A3584FASN, FASFatty acid synthase41872631IPGLLSPHPLLQLSYTATDR   
A581AEIF5B, IF2Eukaryotic translation initiation factor 5B84043963IPGMLIIDTPGHESFSNLR   
A8804GDI2, RABGDIBRab GDP dissociation inhibitor beta6598323IPGSPPESMGR   
A7460POP1Ribonucleases P/MRP protein subunit POP115079366IPILLIQQPGK   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursor46593007IPLAEWESR   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursor29725609IPLENLQIIR   
A1562GPIa, ITGA2, CD49BIntegrin alpha-2 precursor116295258IPLLYDAEIHLTR   
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursor4504957IPLNDLFR   
A6441LSS, OSCLanosterol synthase47933397IPLPAGYREEIVR   
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursor91199540IPNIYAIGDVVAGPMLAHK   
A326ACSTF3Cleavage stimulation factor 77kDa subunit4557495IPNTVEEAVR   
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursor6681764IPQAIAQLSK   
A0098VCLVinculin4507877IPTISTQLK   
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 3517999541IPVDTYNNILTVLK   
A5653ACAD9Acyl-CoA dehydrogenase family member 9, mitochondrial precursor21361497IPVENILGEVGDGFK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursor32189394IPVGPETLGR   
A8047TXNRD1, TR, TR1Thioredoxin reductase 133519430IPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGR   
A0439PHB2, BAP, REAProhibitin 2221307584IPWFQYPIIYDIR   
A2184SSRP1, FACT80Structure-specific recognition protein 14507241IPYTTVLR   
A7569CTPS1, CTPSCTP synthase 1148491070IQAIAWAR   
A5224TPM4Tropomyosin alpha 4 chain4507651IQALQQQADEAEDR   
A371ETAGLN2, CDABP0035Transgelin 24507357IQASTMAFK   
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 54503519IQDALSTVLQYAEDVLSGK   
A7169NOP2, NOL1Putative ribosomal RNA methyltransferase NOP276150625IQDIVGILR   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor13559030IQDKEGIPPDQQR   
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursor208022622IQDKEGIPPDQQR   
A4684CGI-99, CLE7UPF0568 protein C14ORF1667706322IQDRQEAIDWLLGLAVR   
A3696MDH2Malate dehydrogenase, mitochondrial precursor21735621IQEAGTEVVK   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305IQEENVIPR   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursor41399285IQEIIEQLDVTTSEYEK   
A0430LMNB1, LMN2, LMNBLamin B15031877IQELEDLLAK   
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4192807312IQELENLPGSLAGDLR   
A447AFUBP3, FBP3Far upstream element binding protein 3100816392IQFKPDDGISPER   
A446AFUBP1Far upstream element binding protein 117402900IQFKPDDGTTPER   
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 74506013IQHAVQLATEPLEK   
A7910CARSCysteinyl-tRNA synthetase62240992IQHAVQLATEPLEK   
A446AFUBP1Far upstream element binding protein 117402900IQIAPDSGGLPER   
A6277DDX47, E4-DBP, MST162DEAD box protein 4720149629IQIEAIPLALQGR   
A3966KIF2A, KIF2, KNS2Kinesin-like protein KIF2A148612849IQIGIYVEIK   
A681CHDLBP, HBP, VGLVigilin42716280IQIPRPDDPSNQIK   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763IQLINNMLDK   
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 14758796IQLLDLPGIIEGAK   
A385AEIF3L, EIF3EIP, EIF3S6IPEukaryotic translation initiation factor 3 subunit 6 interacting protein7705433IQLLVFK   
A3205TPM3Tropomyosin alpha 3 chain24119203IQLVEEELDR   
A3965TPM1, TMSATropomyosin 1 alpha chain27597085IQLVEEELDR   
A5222TPM2, TMSB, TPM2bTropomyosin beta chain47519616IQLVEEELDR   
A5224TPM4Tropomyosin alpha 4 chain4507651IQLVEEELDR   
A278ACCAR1, CARP1, DISCell division cycle and apoptosis regulator protein 146852388IQTLPNQNQSQTQPLLK   
A3776SLC25A3, PHCSolute carrier family 25 member 347132595IQTQPGYANTLR   
A4636CAPZA1F-actin capping protein alpha-1 subunit5453597IQVHYYEDGNVQLVSHK   
A9493TFRCTransferrin receptor protein 1224192IQVKDSAQNSVIIVDK   
A3205TPM3Tropomyosin alpha 3 chain24119203IQVLQQQADDAEER   
A0716XRCC6, G22P1X-ray repair cross-complementing protein 64503841IQVTPPGFQLVFLPFADDK   
A0326VIL2, EZREzrin161702986IQVWHAEHR   
A0326VIL2, EZREzrin161702986IQVWHAEHRGMLK   
A0808MSNMoesin4505257IQVWHEEHR   
A640ALEO1, RDLRNA polymerase-associated protein LEO120270337IRILPMAGR   
A7917FARSB, FRSB, FARSLBPhenylalanyl-tRNA synthetase beta chain124028525IRPFAVAAVLR   
A6322DHX15, DBP1, DDX15Putative pre-mRNA splicing factor RNA helicase DHX1568509926IRVESLLVTAISK   
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alpha154146191IRYESLTDPSK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594IRYESLTDPSK   
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolic22547186ISATSIFFESMPYK   
A6619SHMT2Serine hydroxymethyltransferase, mitochondrial precursor19923315ISATSIFFESMPYK   
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase A100913206ISAVSVAER   
A6265DDX18ATP-dependent RNA helicase DDX1838327634ISDIQSQLEK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunit24307939ISDSVLVDIKDTEPLIQTAK   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chain5174735ISEQFTAMFR   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785ISEQFTAMFR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012ISGETIFVTAPHEATAGIIGVNR   
A9652RPS6, PNAS-2040S ribosomal protein S617158044ISGGNDKQGFPMK   
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H477539758ISGLIYEETR   
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 121361794ISGSILNELIGLVR   
A051BSRRT, ARS2, ASR2Arsenite-resistance protein 251094564ISHGEVLEWQK   
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM233356547ISHLPLVEELR   
A9540RPL1160S ribosomal protein L1115431290ISKEEAMR   
A4315DNAJC9, RCDNAJ9DNAJ homolog subfamily C member 927597059ISLEDIQAFEK   
A001BSF3B2, SAP145Splicing factor 3B subunit 255749531ISLGMPVGPNAHK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426ISLIQIFR   
A0850VIMVimentin62414289ISLPLPNFSSLNLR   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954ISMPDIDLNLTGPK   
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAK61743954ISMPDVDLHLK   
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing protein31621305ISNQFDWALMR   
A8738CACYBP, S100A6BP, SIPCalcyclin binding protein7656952ISNYGWDQSDK   
A0808MSNMoesin4505257ISQLEMAR   
A4575ANXA4, PIG28, ANX4Annexin A44502105ISQTYQQQYGR   
A7989TKT, TKT1Transketolase205277463ISSDLDGHPVPK   
A3823RPS840S ribosomal protein S84506743ISSLLEEQFQQGK   
A7666RECQL, RECQ1, RECQL1ATP-dependent DNA helicase Q114591904ISSMVVMENVGQQK   
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial31711992ISVNDFIIK   
A002AMYOF, FER1L3Myoferlin7305053ISVYDYDTFTR   
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chain29788785ISVYYNEATGGK   
A6348DNMT1, AIM, CXXC9DNA (cytosine-5)-methyltransferase 14503351ISWVGEAVK   
A9534PRPF8, PRPC8, HPRP8Pre-mRNA-processing-splicing factor 891208426ITDAYLDQYLWYEADK   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursor29725609ITDFGLAK   
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1112382250ITDLYTDLR   
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursor98986464ITDSAGHILYSK   
A4815FLNC, ABPL, FLN2Filamin C116805322ITESDLSQLTASIR   
A1164IPO5, KPNB3, RANBP5Importin 524797086ITFLLQAIR   
A557AHNRNPF, HNRPFHeterogeneous nuclear ribonucleoprotein F148470406ITGEAFVQFASQELAEK   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264ITIGQAPTEK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozyme33286418ITLDNAYMEK   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763ITLPVDFVTADK   
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 14505763ITLPVDFVTADKFDENAK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113ITMIAEPLEK   
A9769API5, MIG8, AAC11Apoptosis inhibitor 55729730ITNNINVLIK   
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 25454158ITPAHDQNDYEVGQR   
A3663HK1-tc, HK1-tb, HK1-taHexokinase 115991827ITPELLTR   
A668AMATR3Matrin 362750354ITPENLPQILLQLK   
A0451HSPA5, GRP78Heat shock 70kDa protein 516507237ITPSYVAFTPEGER   
A7925MARSMethionyl-tRNA synthetase, cytoplasmic14043022ITQDIFQQLLK   
A2127DYNC1I2, DNCI2, DNCIC2Dynein intermediate chain 2, cytosolic24307879ITQVDFPPR   
A8684ATXN10, SCA10, E46LAtaxin-107106299ITSDEPLTKDDIPVFLR   
A983ASARNP, HCC1, HSPC316SAP domain-containing ribonucleoprotein32129199ITSEIPQTER   
A4009CKAP5, ch-TOGCytoskeleton-associated protein 557164942ITSELVSK   
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4124494254ITSGPFEPDLYK   
A5742AFG3L2AFG3-like protein 25802970ITTGAQDDLR   
A5866ATAD3AATPase family, AAA domain containing, protein 3A21749446ITVLEALR   
A774AGTPBP4, CRFG, NOG1GTP binding protein 455953087ITVVPSAK   
A0369LDHBL-lactate dehydrogenase B chain4557032IVADKDYSVTANSK   
A663CUSO1, VDPGeneral vesicular transport factor p1154505541IVAFENAFER   
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicase40217847IVALSSSLSNAK   
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 146367787IVATKPLYVALAQR   
A0452CANXCalnexin precursor66933005IVDDWANDGWGLK   
A0452CANXCalnexin precursor66933005IVDDWANDGWGLKK   
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p684758138IVDQIRPDR   
A6264DDX17ATP-dependent RNA helicase DDX17148613856IVDQIRPDR   
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursor21361181IVEIPFNSTNK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301IVEPYIAWGYPNLK   
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3X87196351IVEQDTMPPK   
A2555RBMX, HNRPG, RBMXP1Heterogeneous nuclear ribonucleoprotein G56699409IVEVLLMK   
A681CHDLBP, HBP, VGLVigilin42716280IVGELEQMVSEDVPLDHR   
A3961MYH10, SmembMyosin-1041406064IVGLDQVTGMTETAFGSAYK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121IVILEYQPSK   
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5148727247IVILPDYLEIAR   
A2153SKIV2L2, Mtr4Superkiller viralicidic activity 2-like 234364907IVIPNEESVVIYYK   
A906ARBBP5, RBQ3Retinoblastoma-binding protein 553759148IVIWDFLTR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012IVLDNSVFSEHR   
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-24503377IVLEDGTLHVTEGSGR   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486IVLLDSSLEYK   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 1840354195IVLQIDNAR   
A3588PYGBGlycogen phosphorylase, brain form21361370IVNGWQVEEADDWLR   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121IVPGQFLAVDPK   
A002BSF3B3, SAP130Splicing factor 3B subunit 354112121IVPGQFLAVDPKGR   
A0439PHB2, BAP, REAProhibitin 2221307584IVQAEGEAEAAK   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103IVQLLAGVADQTK   
A8165GDH, ugd, UGDHUDP-glucose 6-dehydrogenase4507813IVQNSNGYKIVTEK   
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 34503507IVSLFAEHNDLQYAAPGGLIGVGTK   
A3918VCPTransitional endoplasmic reticulum ATPase6005942IVSQLLTLMDGLK   
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunit58761486IVSRPEELREDDVGTGAGLLEIK   
A0787FKBP4, FKBP52FK506-binding protein 44503729IVSWLEYESSFSNEEAQK   
A308CQKI, HKQ, QUAKINGQuaking45827706IVTADRAATGN   
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolic22547186IVTGGSDNHLILVDLR   
A7932RARS2, RARSLArginyl-tRNA synthetase 2, mitochondrial14714568IVVEFSSPNVAK   
A0369LDHBL-lactate dehydrogenase B chain4557032IVVVTAGVR   
A0429ACO2Aconitate hydratase, mitochondrial precursor4501867IVYGHLDDPASQEIER   
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.35174447IWDLEGK   
A148BEFTUD2, SNRP116, U5-116KDElongation factor TU GTP binding domain containing protein 212803113IYADTFGDINYQEFAK   
A4182PDS5B, APRIN, AS3Sister chromatid cohesion protein PSD homolog B7657269IYAPEAPYTSPDK   
A7931RARSArginyl-tRNA synthetase15149476IYDALDVSLIER   
A3520SEPT7, CDC10Septin-7148352329IYEFPETDDEEENK   
A3520SEPT7, CDC10Septin-7148352329IYEFPETDDEEENKLVK   
A2004HSP90B1, GRP94, TRA1Endoplasmin precursor4507677IYFMAGSSR   
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmic119601264IYGADDIELLPEAQHK   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255IYGISFPDPK   
A712CXPO1, CRM1CRM1 protein4507943IYLDMLNVYK   
A0439PHB2, BAP, REAProhibitin 2221307584IYLTADNLVLNLQDESFTR   
A999ASF3B1, SAP155Splicing factor 3B subunit 154112117IYNDDKNTYIR   
A002AMYOF, FER1L3Myoferlin7305053IYPLPDDPSVPAPPR   
A0805NCAPD2, CAPD2, CNAP1Condensin complex subunit 120380096IYQLLAK   
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3209869995IYSHSLLPVLR   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103IYSTLAGTR   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581IYSTLAGTR   
A0583PUF60, FIR, ROBPIPoly-U binding splicing factor PUF6017298690IYVASVHQDLSDDDIK   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076IYVGNLPPDIR   
A1129SRSF9, SFRS9, SRP30CSerine/arginine-rich splicing factor 94506903IYVGNLPTDVR   
A7912DARS, PIG40Aspartyl-tRNA synthetase45439306IYVISLAEPR   
A0492STIP1Stress-induced-phosphoprotein 15803181KAAALEFLNR   
A470AHIST1H1C, H1F2Histone H1.24885375KAAGGATPK   
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein U74136883KAEGGGGGGRPGAPAAGDGK   
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L715431301KAGNFYVPAEPK   
A710AMINA, MDIG, MINA53Myc-induced nuclear antigen23346418KAKPTGSGK   
A470AHIST1H1C, H1F2Histone H1.24885375KALAAAGYDVEK   
A471AHIST1H1D, H1F3Histone H1.34885377KALAAAGYDVEK   
A473AHIST1H1B, H1F5Histone H1.54885381KALAAGGYDVEK   
A3166MYH9Myosin heavy chain 9, non-muscle12667788KANLQIDQINTDLNLER   
A0326VIL2, EZREzrin161702986KAPDFVFYAPR   
A0808MSNMoesin4505257KAPDFVFYAPR   
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunit12408656KAPSDLYQIILK   
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursor4504327KAQDEGLLSDVVPFK   
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like protein11067747KAQDVLVQEMEVVK   
A470AHIST1H1C, H1F2Histone H1.24885375KASGPPVSELITK   
A471AHIST1H1D, H1F3Histone H1.34885377KASGPPVSELITK   
A473AHIST1H1B, H1F5Histone H1.54885381KATGPPVSELITK   
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein154354962KAVDEAADALLK   
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 15730027KDDEENYLDLFSHK   
A248CNUP205Nuclear pore complex protein Nup20557634534KDLPSADSVQYR   
A2541HNRNPDL, HNRPDL, JKTBPJKTBP214110407KDLTEYLSR   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 14501885KDLYANTVLSGGTTMYPGIADR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012KDPELWGSVLLESNPYR   
A7849SPCS2, SPC25Signal peptidase complex subunit 2133777120KDPTGMDPDDIWQLSSSLK   
A1418LLDBP, RFC1, RFC140Replication factor C subunit 132528306KDTEAGETFSSVQANLSK   
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar121361103KDVEVTK   
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar27657581KDVEVTK   
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursor5031973KDVIELTDDSFDK   
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3A4506723KDWYDVK   
A825ASERBP1, PAIRBP1, CGI-55PAI-1 mRNA-binding protein66346679KEAGGGGVGGPGAK   
A4783EMD, EDMD, STAEmerin4557553KEDALLYQSK   
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmic4758762KEDGTFYEFGEDIPEAPER   
A3804EEF2, EF2Elongation factor 24503483KEDLYLKPIQR   
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 15902076KEDMTYAVR   
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunit13654237KEEENASVIDSAELQAYPALVVEK   
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-I4503529KEELTLEGIR   
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetase62241042KEENLADWYSQVITK   
A7555PFASPhosphoribosylformylglycinamidine synthase31657129KEFFLQR   
A0537ANXA2, ANX2, ANX2L4Annexin A250845388KELASALK   
A0326VIL2, EZREzrin161702986KENPLQFK   
A4633CAP1, CAPAdenylyl cyclase-associated protein 1157649073KEPAVLELEGK   
A0492STIP1Stress-induced-phosphoprotein 15803181KETKPEPMEEDLPENK   
A7935TARSThreonyl-tRNA synthetase, cytoplasmic38202255KETLLAMFK   
A478BGLG1, CFR1, ESL1Golgi apparatus protein 1 precursor54633312KEVLNMLK   
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type C11321601KEWSGLLEELAR   
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 14758012KFDVNTSAVQVLIEHIGNLDR   
A0433TPI1, TPI, TIMTriosephosphate isomerase 14507645KFFVGGNWK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 14529892KFGDPVVQSDMK   
A2536NCLNucleolin55956788KFGYVDFESAEDLEK   
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat118375623KFMQDPMEIFVDDETK   
A6397DDX39, DDX39AATP dependent RNA helicase DDX3921040371KFMQDPMEVFVDDETK   
A3816RPS340S ribosomal protein S315718687KFVADGIFK   
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 120149594KFYEAFSK   
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1156523968KFYPLEIDYGQDEEAVK   
A3918VCPTransitional endoplasmic reticulum ATPase6005942KGDIFLVR