PADB-logoLSSR - PepMap molecular information by study

Study ID 21616181
Species mouse
Disease lumican knock-out
Tissue / Source cornea
Compartment 

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A8087UAP1L1UDP-N-acetylhexosamine pyrophosphorylase-like protein 1GI:84794548AAAAGALAPGPLPDLAAR1746.99936 (observed)  
A5090POSTN, OSF2, OSF-2Periostin, osteoblast specific factorGI:7657429AAAITSDLLESLGR1560.877 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431AAALEFLNR1148.65544 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431AAALEFLNR1148.65959 (observed)  
A0218CTNND1, TXNDC14Catenin delta-1GI:146219835;GI:146219830;GI:146219849;GI:146231979AAALVLQTIWGYK1722.02634 (observed)  
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaGI:82795783;GI:51704904;GI:110625979AAAPAPEEEMDECEQALAAEPK2634.20505 (observed)  
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaGI:82795783;GI:51704904;GI:110625979AAAPAPEEEMDECEQALAAEPK2634.20084 (observed)  
A4795EVPLEnvoplakinGI:111185907AAAVEHLQPGQQAPAGSAPADPQGQTLLSQMTQLDGDLGQIER4539.2695 (observed)  
A681CHDLBP, HBP, VGLVigilinGI:19527028AACLESAQEPAGAWSNK2066.98808 (observed)  
A3205TPM3Tropomyosin alpha 3 chainGI:40254525AADAEAEVASLNR1460.74761 (observed)  
A3205TPM3Tropomyosin alpha 3 chainGI:40254525AADAEAEVASLNR1460.74639 (observed)  
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2GI:7106381AADAVEDLR1103.58232 (observed)  
A0446CSE1L, CAS, XPO2Exportin-2GI:12963737AADEEAFEDNSEEYIR2031.8853 (observed)  
A0446CSE1L, CAS, XPO2Exportin-2GI:12963737AADEEAFEDNSEEYIR2031.88848 (observed)  
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase AGI:150456419AAECNIVVTQPR1490.75847 (observed)  
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1GI:28395023AAEDLFVNIR1291.71758 (observed)  
A0122CLTAClathrin light chain AGI:122939192;GI:122939196AAEEAFVNDIDESSPGTEWER2496.13335 (observed)  
A0122CLTAClathrin light chain AGI:122939192;GI:122939196AAEEAFVNDIDESSPGTEWER2496.12358 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277;GI:157168326AAEILAR887.54686 (observed)  
A5073PPLPeriplakinGI:112421039AAELEVQR1059.59465 (observed)  
A127E2210016F16RikPutative uncharacterized proteinGI:254675232AAELLLPAAAAWR1496.87358 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127AAELQAQWER1345.7011 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127AAELQAQWER1345.70183 (observed)  
A0778MAP4Microtubule-associated protein 4GI:148747189AAEQMSTLPIDAPSPLENLEQK2670.39255 (observed)  
A0237COPB2Coatomer beta' subunitGI:29789080AAESLADPTEYENLFPGLK2353.22037 (observed)  
A0237COPB2Coatomer beta' subunitGI:29789080AAESLADPTEYENLFPGLK2353.21872 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906AAFDDAIAELDTLSEESYK2376.17412 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906AAFDDAIAELDTLSEESYK2376.1796 (observed)  
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:117606335AAFEWNEEGAGSSPSPGLQPVR2430.18583 (observed)  
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:117606335AAFEWNEEGAGSSPSPGLQPVR2430.18766 (observed)  
A1489ITGA3, MSK18Integrin alpha-3 precursorGI:7305189AAFLSEQLQPLSR1603.89873 (observed)  
A1489ITGA3, MSK18Integrin alpha-3 precursorGI:7305189AAFLSEQLQPLSR1603.89604 (observed)  
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:6753036AAFQLGSPWR1276.69707 (observed)  
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:6753036AAFQLGSPWR1276.69158 (observed)  
A7852SRM, SPS1, SRML1Spermidine synthaseGI:6678131AAFVLPEFTR1294.73113 (observed)  
A7852SRM, SPS1, SRML1Spermidine synthaseGI:6678131AAFVLPEFTR1294.72783 (observed)  
A2262ANGPTL7, CDT6, UNQ313/PRO356Angiopoietin-related protein 7GI:88196773AAGCCEEMR1205.43523 (observed)  
A2262ANGPTL7, CDT6, UNQ313/PRO356Angiopoietin-related protein 7GI:88196773AAGCCEEMR1205.43559 (observed)  
A1374LMNA, LMN1Lamin A/CGI:162287370AAGGAGAQVGGSISSGSSASSVTVTR2366.20694 (observed)  
A9941IGBP1, IBP1Immunoglobulin-binding protein 1GI:255982594AAGMLSQLDLFSR1552.83281 (observed)  
A9941IGBP1, IBP1Immunoglobulin-binding protein 1GI:255982594AAGMLSQLDLFSR1552.82878 (observed)  
A9579RPLP1, RRP160S acidic ribosomal protein P1GI:94371594;GI:149252277;GI:94381084;GI:149259080;GI:9256519AAGVSVEPFWPGLFAK1964.09087 (observed)  
A9579RPLP1, RRP160S acidic ribosomal protein P1GI:94371594;GI:149252277;GI:94381084;GI:149259080;GI:9256519AAGVSVEPFWPGLFAK1964.08965 (observed)  
A0669RUVBL2, INO80J, TIP48RuvB-like 2GI:6755382AAGVVLEMIR1202.70574 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:13385472AAIAAAAAAAAAK1329.80527 (observed)  
A5772Akr1b7Aldose reductase-related protein 1GI:160415215;GI:6679791AAIDAGYR980.52928 (observed)  
A6658GRHPR, GLXR, MSTP035Glyoxylate reductaseGI:17933768AALAQAADCEVEQWNSDDPIPR2589.19187 (observed)  
A6658GRHPR, GLXR, MSTP035Glyoxylate reductaseGI:17933768AALAQAADCEVEQWNSDDPIPR2589.19333 (observed)  
A999ASF3B1, SAP155Splicing factor 3B subunit 1GI:153791358AALDEAQGVGLDSTGYYDQEIYGGSDSR3081.39731 (observed)  
A999ASF3B1, SAP155Splicing factor 3B subunit 1GI:153791358AALDEAQGVGLDSTGYYDQEIYGGSDSR3081.40427 (observed)  
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseGI:21312520AALDGTPGMIGYGMAK1840.95488 (observed)  
A3787KRT19, K19Keratin, type I cytoskeletal 19GI:6680606AALEGTLAETEAR1475.78398 (observed)  
A1625C8AComplement component C8 alpha chain precursorGI:22122667AALGYNILTQEEAQSVYDAK2472.29239 (observed)  
A9763VMA21, MEAX, XMEAVacuolar ATPase assembly integral membrane protein VMA21GI:124486867AALNALQPPEFR1470.82012 (observed)  
A9763VMA21, MEAX, XMEAVacuolar ATPase assembly integral membrane protein VMA21GI:124486867AALNALQPPEFR1470.8178 (observed)  
A8408DFFA, DFF1, DFF45DNA fragmentation factor alpha subunitGI:70608119;GI:70608144AALSEELDAVDTGVGR1746.9019 (observed)  
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1GI:124494256AALSGANVLTLIEK1688.02886 (observed)  
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1GI:124494256AALSGANVLTLIEK1688.02732 (observed)  
A9735OLFML3, UNQ663/PRO1294, HNOEL-isoOlfactomedin-like protein 3 precursorGI:86439989AALSYFPR1068.59746 (observed)  
A9735OLFML3, UNQ663/PRO1294, HNOEL-isoOlfactomedin-like protein 3 precursorGI:86439989AALSYFPR1068.59685 (observed)  
A3718HSD17B2, EDH17B2Estradiol 17 beta-dehydrogenase 2GI:123173870AALTMFSTIIR1367.78423 (observed)  
A0112CTNNB1, CTNNB, PRO2286Beta-cateninGI:6671684AAMFPETLDEGMQIPSTQFDAAHPTNVQR3346.59848 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205AANEAGYFNEEMAPIEVK2287.11893 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205AANEAGYFNEEMAPIEVK2271.12651 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205AANEAGYFNEEMAPIEVK2271.12261 (observed)  
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:13385006AANNGALPPDLSYIVR1815.97807 (observed)  
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:27754065AAPFTLEYR1211.65788 (observed)  
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:27754065AAPFTLEYR1211.65764 (observed)  
A1672COL4A4Collagen alpha 4(IV) chain precursorGI:34328045AAPFVECQGR1267.60442 (observed)  
A1672COL4A4Collagen alpha 4(IV) chain precursorGI:34328045AAPFVECQGR1267.60527 (observed)  
A6727HINT2HIT-17kDaGI:110625719AAPGGASPTIFSR1375.74614 (observed)  
A5139SPON1, VSGPSpondin-1 precursorGI:21704174AAPSAEFSVDR1293.65654 (observed)  
A5139SPON1, VSGPSpondin-1 precursorGI:21704174AAPSAEFSVDR1293.65581 (observed)  
A871BCHMP4C, SHAX3, Shax3SNF7-3GI:149250564AAPSAQEALAR1228.67742 (observed)  
A871BCHMP4C, SHAX3, Shax3SNF7-3GI:149250564AAPSAQEALAR1228.67754 (observed)  
A0752UTRN, UTRNB, DMDLUtrophinGI:110431378AAQASLNALNDPIAVEQALQEK2582.41404 (observed)  
A9562RPL32, PP993260S ribosomal protein L32GI:25742730;GI:148225566AAQLAIR886.55718 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:41152517;GI:283945572;GI:283945575;GI:283945579AASADSTTEGTPTDGFTVLSTK2445.22685 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:41152517;GI:283945572;GI:283945575;GI:283945579AASADSTTEGTPTDGFTVLSTK2445.22344 (observed)  
A7226CROT, COTPeroxisomal carnitine octanoyltransferaseGI:17157983AASDLQIAASTFTSFGK2003.07657 (observed)  
A4575ANXA4, PIG28, ANX4Annexin A4GI:161016799AASGFNATEDAQTLR1695.84905 (observed)  
A4575ANXA4, PIG28, ANX4Annexin A4GI:161016799AASGFNATEDAQTLR1695.84526 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966AASISAVSLEVAQPGPSSGPR2125.14054 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966AASISAVSLEVAQPGPSSGPR2125.13926 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587AASSLLANLWQYSK1840.02225 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587AASSLLANLWQYSK1840.02536 (observed)  
A5571Nucb2, NUCB2, NEFANucleobindin 2 precursorGI:153792449;GI:194440700AATADLEQYDR1396.68486 (observed)  
A5571Nucb2, NUCB2, NEFANucleobindin 2 precursorGI:153792449;GI:194440700AATADLEQYDR1396.6862 (observed)  
A7261PYCRLPyrroline-5-carboxylate reductase 3GI:119508439AATMSAVEAATCR1471.68364 (observed)  
A4795EVPLEnvoplakinGI:111185907AATQELALLISR1429.85271 (observed)  
A4795EVPLEnvoplakinGI:111185907AATQELALLISR1429.85454 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917AATSPALFNR1191.65923 (observed)  
A4595TGFBI, BIGH3Transforming growth factor-beta induced protein IG-H3 precursorGI:6678321AAVAASGLNTVLEGDGQFTLLAPTNEAFEK3322.74277 (observed)  
A4595TGFBI, BIGH3Transforming growth factor-beta induced protein IG-H3 precursorGI:6678321AAVAASGLNTVLEGDGQFTLLAPTNEAFEK3322.74314 (observed)  
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:227500281AAVDAGFVPNDMQVGQTGK2193.12558 (observed)  
A043CKPNB1, NTF97Importin beta-1 subunitGI:88014720AAVENLPTFLVELSR1803.01653 (observed)  
A043CKPNB1, NTF97Importin beta-1 subunitGI:88014720AAVENLPTFLVELSR1803.01885 (observed)  
A3568PSMD126S proteasome non-ATPase regulatory subunit 1GI:74315975AAVESLGFILFR1466.8521 (observed)  
A3568PSMD126S proteasome non-ATPase regulatory subunit 1GI:74315975AAVESLGFILFR1466.85344 (observed)  
A8431ITIH1, IGHEP1, PRO2769Inter-alpha (globulin) inhibitor H1GI:124249351AAVLGESAGLVR1286.75713 (observed)  
A5731ADH7Alcohol dehydrogenase class IV mu/sigma chainGI:31560625AAVLWGVNQPFSIEEIEVAPPK2682.48337 (observed)  
A5731ADH7Alcohol dehydrogenase class IV mu/sigma chainGI:31560625AAVLWGVNQPFSIEEIEVAPPK2682.48594 (observed)  
A7084APIP, CGI-29, MMRP19Methylthioribulose-1-phosphate dehydrataseGI:258613873AAVMATLLFPGQEFK1911.07798 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149249466;GI:149253386;GI:149259350;GI:6679651;GI:7305027AAVPSGASTGIYEALELR1949.05071 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149249466;GI:149253386;GI:149259350;GI:6679651;GI:7305027AAVPSGASTGIYEALELR1949.05058 (observed)  
A6011CBR3Carbonyl reductase [NADPH] 3GI:27413160AAVQQLQAEGLSPR1611.89543 (observed)  
A6011CBR3Carbonyl reductase [NADPH] 3GI:27413160AAVQQLQAEGLSPR1611.89433 (observed)  
A5073PPLPeriplakinGI:112421039AAYDEYCSGYNR1601.65154 (observed)  
A5073PPLPeriplakinGI:112421039AAYDEYCSGYNR1601.64922 (observed)  
A1374LMNA, LMN1Lamin A/CGI:162287370;GI:161760667AAYEAELGDAR1309.65227 (observed)  
A1374LMNA, LMN1Lamin A/CGI:162287370;GI:161760667AAYEAELGDAR1309.653 (observed)  
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:22094075AAYFGIYDTAK1507.80754 (observed)  
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:148747424AAYFGVYDTAK1493.78801 (observed)  
A7931RARSArginyl-tRNA synthetaseGI:262118273AAYPDLENPPLIVTPSQQPK2466.34769 (observed)  
A7931RARSArginyl-tRNA synthetaseGI:262118273AAYPDLENPPLIVTPSQQPK2466.34732 (observed)  
A8170UK114, HRSP12, PSPRibonuclease UK114GI:40807498AAYQVAALPR1203.69731 (observed)  
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GI:6680045ACADATLSQITNNIDPVGR2149.0521 (observed)  
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GI:6680045ACADATLSQITNNIDPVGR2149.05229 (observed)  
A5772Akr1b7Aldose reductase-related protein 1GI:160415215ACDLLDAR1066.51531 (observed)  
A5772Akr1b7Aldose reductase-related protein 1GI:160415215ACDLLDAR1066.5136 (observed)  
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GI:13937391ACGDSTLTQITAGLDPVGR2065.01592 (observed)  
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GI:13937391ACGDSTLTQITAGLDPVGR2065.01811 (observed)  
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologGI:33859662ACGLNFADLMGR1457.68425 (observed)  
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologGI:33859662ACGLNFADLMGR1457.68242 (observed)  
A7556PAICS, ADE2, AIRCMultifunctional protein ADE2GI:13385434ACGNFGIPCELR1515.66948 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802ACLISLGYDVENDR1757.83501 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802ACLISLGYDVENDR1757.83452 (observed)  
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitGI:6753320ACTILLR979.55571 (observed)  
A2127DYNC1I2, DNCI2, DNCIC2Dynein intermediate chain 2, cytosolicGI:6753658ADAEEEAATR1206.57488 (observed)  
A0097TLN1, TLNTalin 1GI:227116327ADAEGESDLENSR1536.6939 (observed)  
A5868ATG3, APG3, APG3LAutophagy-related protein 3GI:13385890ADAGGEDAILQTR1460.74809 (observed)  
A5868ATG3, APG3, APG3LAutophagy-related protein 3GI:13385890ADAGGEDAILQTR1460.74834 (observed)  
A670CVAMP3, SYB3Vesicle-associated membrane protein 3GI:6678551;GI:6678553ADALQAGASQFETSAAK1954.01548 (observed)  
A4845GORASP2, GOLPH6Golgi reassembly-stacking protein 2GI:224967109ADASSLTVDVTSPASK1836.98076 (observed)  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorGI:226531047;GI:226531069ADAVQEATFQVELPR1817.952 (observed)  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorGI:226531047;GI:226531069ADAVQEATFQVELPR1817.9509 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845ADDPSSYMEVVQAANASGNWEELVK2998.4379 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845ADDPSSYMEVVQAANASGNWEELVK2998.43406 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845ADDPSSYMEVVQAANASGNWEELVK3014.43967 (observed)  
A0960TCEB2Transcription elongation factor B polypeptide 2GI:13385800ADDTFEALR1181.59294 (observed)  
A0960TCEB2Transcription elongation factor B polypeptide 2GI:13385800ADDTFEALR1181.59258 (observed)  
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:94400195;GI:149267887;GI:6754976ADEGISFR1038.53447 (observed)  
A3662PCPyruvate carboxylase, mitochondrial precursorGI:251823978;GI:251823980ADFAQACQDAGVR1541.69829 (observed)  
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 2GI:255069795ADFPAGIPECGTDALR1822.86553 (observed)  
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 2GI:255069795ADFPAGIPECGTDALR1822.86125 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:82905443;GI:51770420;GI:82994829;GI:149270876ADHQPLTEASYVNLPTIALCNTDSPLR3129.55552 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:82905443;GI:51770420;GI:82994829;GI:149270876ADHQPLTEASYVNLPTIALCNTDSPLR3129.55405 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:82905443;GI:51770420;GI:82994829;GI:149270876ADHQPLTEASYVNLPTIALCNTDSPLR3129.55552 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:82905443;GI:51770420;GI:82994829;GI:149270876ADHQPLTEASYVNLPTIALCNTDSPLR3129.55405 (observed)  
A4267ABCE1, RLI, RNASEL1ATP-binding cassette sub-family E member 1GI:114205431ADIFMFDEPSSYLDVK2165.08225 (observed)  
A4267ABCE1, RLI, RNASEL1ATP-binding cassette sub-family E member 1GI:114205431ADIFMFDEPSSYLDVK2165.07895 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277ADIGVAMGIVGSDVSK1806.98655 (observed)  
A1954GSTM1, GST1Glutathione S-transferase Mu 1GI:6754084ADIVENQVMDTR1534.76323 (observed)  
A1954GSTM1, GST1Glutathione S-transferase Mu 1GI:6754084ADIVENQVMDTR1550.76152 (observed)  
A1954GSTM1, GST1Glutathione S-transferase Mu 1GI:6754084ADIVENQVMDTR1550.76421 (observed)  
A1954GSTM1, GST1Glutathione S-transferase Mu 1GI:6754084ADIVENQVMDTR1534.76543 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529ADIVFLTDASWSIGDDNFNK2516.25986 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529ADIVFLTDASWSIGDDNFNK2516.2564 (observed)  
A7067MST4, RP6-213H19.1, STK3Serine/threonine protein kinase MASKGI:89337277;GI:21703922;GI:19526920ADIWSLGITAIELAK1889.10349 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981ADLEAQLETLTEELAYMK2356.22222 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981ADLEAQLETLTEELAYMK2372.22489 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981ADLEAQLETLTEELAYMK2372.22342 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981ADLEAQLETLTEELAYMK2356.22466 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:40556608;GI:6754254ADLINNLGTIAK1530.9113 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:40556608;GI:6754254ADLINNLGTIAK1530.90996 (observed)  
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1GI:40556608;GI:6754254ADLINNLGTIAK1530.9113 (observed)  
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1GI:40556608;GI:6754254ADLINNLGTIAK1530.90996 (observed)  
A1090CDC42EP4, BORG4, CEP4Cdc42 effector protein 4GI:9910142ADLTAEMISAPLGDFR1850.94939 (observed)  
A1090CDC42EP4, BORG4, CEP4Cdc42 effector protein 4GI:9910142ADLTAEMISAPLGDFR1850.95513 (observed)  
A8790FLII, FLILFlightless-I protein homologGI:11528490ADLTALFLPR1260.74712 (observed)  
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseGI:255069715ADMGGAATICSAIVSAAK1970.99631 (observed)  
A1391EHD2, PAST2EH-domain containing protein 2GI:55742711ADMVETQQLMR1465.72478 (observed)  
A1391EHD2, PAST2EH-domain containing protein 2GI:55742711ADMVETQQLMR1465.72576 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811ADMVIEAVFEDLGVK1940.03519 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811ADMVIEAVFEDLGVK1940.03116 (observed)  
A1051UBA2, SAE2, UBLE1BAnthracycline-associated resistance ARXGI:7709986ADPEAAWEPTEAEAR1786.83647 (observed)  
A1051UBA2, SAE2, UBLE1BAnthracycline-associated resistance ARXGI:7709986ADPEAAWEPTEAEAR1786.8394 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484ADPSQDVR1031.52507 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484ADPSQDVR1031.52519 (observed)  
A1319EHD1, PAST, PAST1EH-domain containing protein 1GI:215983062;GI:7106303ADQIETQQLMR1476.76262 (observed)  
A1319EHD1, PAST, PAST1EH-domain containing protein 1GI:215983062;GI:7106303ADQIETQQLMR1476.76482 (observed)  
A1331EHD3, EHD2, PAST3EH-domain containing protein 3GI:215983062;GI:7106303ADQIETQQLMR1476.76262 (observed)  
A1331EHD3, EHD2, PAST3EH-domain containing protein 3GI:215983062;GI:7106303ADQIETQQLMR1476.76482 (observed)  
A1390EHD4, HCA10, HCA11EH-domain containing protein 4GI:31981592ADQVDTQQLMR1448.72966 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:113195684ADSLADEINFLR1507.79228 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:113195684ADSLADEINFLR1507.79167 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ADSLTDDINFLR1523.78135 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ADSLTDDINFLR1523.78583 (observed)  
A1646TRIM29, ATDCTripartite motif-containing protein 29GI:160333881ADSSLLAR976.55828 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961ADVDASLPEVEGGVK1773.9522 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961ADVDASLPEVEGGVK1773.95354 (observed)  
A4380PSMD926S proteasome non-ATPase regulatory subunit 9GI:119508441ADVDLYQVR1222.65581 (observed)  
A709CWFS1WolframinGI:6755997ADVEIPFEEVLEK1805.98772 (observed)  
A709CWFS1WolframinGI:6755997ADVEIPFEEVLEK1805.9854 (observed)  
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-betaGI:170295840ADVQSIIGLQR1343.77825 (observed)  
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-betaGI:170295840ADVQSIIGLQR1343.7769 (observed)  
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformGI:31560731ADYAQLLEDMQNAFR1928.93204 (observed)  
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformGI:31560731ADYAQLLEDMQNAFR1928.93047 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587ADYDTLSLR1197.62407 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AEAELCSEAEETR1627.70549 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AEAELCSEAEETR1627.70635 (observed)  
A1668RPS1040S ribosomal protein S10GI:13399310AEAGAGSATEFQFR1585.77324 (observed)  
A1668RPS1040S ribosomal protein S10GI:13399310AEAGAGSATEFQFR1585.77373 (observed)  
A1528ITGA6Integrin alpha-6GI:31982236AEALPLQR1041.61992 (observed)  
A867BCHMP2A, BC2, CHMP2BC-2 proteinGI:21312151AEATASALADADADLEER1962.94011 (observed)  
A867BCHMP2A, BC2, CHMP2BC-2 proteinGI:21312151AEATASALADADADLEER1962.94388 (observed)  
A1585NID1, NIDNidogen-1GI:94394792;GI:171543883AECLNPAQPGR1345.64836 (observed)  
A0872PARD3, PAR3, PAR3APartitioning-defective 3 homologGI:171184413;GI:61888844;GI:171184415;GI:61888842AEDEDVVLTPDGTR1660.83245 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913AEDGSVIDYELIDQDAR2052.99028 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913AEDGSVIDYELIDQDAR2052.98686 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AEDMAELTCLNEASVLHNLR2419.15189 (observed)  
A1377PCNAProliferating cell nuclear antigenGI:149270621;GI:149270623;GI:7242171AEDNADTLALVFEAPNQEK2363.20292 (observed)  
A8391CD109, CPAMD7Activated T-cell marker CD109GI:23346525AEEALNLLMQR1431.77605 (observed)  
A1515LAMA2, LAMMLaminin alpha-2 chain precursorGI:117647249AEECYYDETVASR1725.72405 (observed)  
A4745DBNL, CMAP, SH3P7Cervical SH3P7GI:7304993;GI:226423871;GI:226423873AEEDVEPECIMEK1855.83757 (observed)  
A9506TOMM22, TOM22, MST065Mitochondrial import receptor subunit TOM22 homologGI:31982091AEEELEEDDDDELDETLSER2525.0687 (observed)  
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalGI:18700004;GI:22122797AEELGLPILGVLR1523.92986 (observed)  
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalGI:18700004;GI:22122797AEELGLPILGVLR1523.93047 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AEELLAQLGR1243.71587 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AEELLAQLGR1243.71672 (observed)  
A807DPLEKHA6, PEPP3Pleckstrin homology domain containing, family A member 6GI:237681204;GI:33636693AEEPGGQAYETPR1548.747 (observed)  
A807DPLEKHA6, PEPP3Pleckstrin homology domain containing, family A member 6GI:237681204;GI:33636693AEEPGGQAYETPR1548.74468 (observed)  
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:112181167AEEQEPELTSTPNFVVEVTK2535.31107 (observed)  
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:112181167AEEQEPELTSTPNFVVEVTK2535.31675 (observed)  
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GI:31982030AEEYEFLTPMEEAPK2072.01592 (observed)  
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GI:31982030AEEYEFLTPMEEAPK2072.01396 (observed)  
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GI:31982030AEEYEFLTPMEEAPK2088.00957 (observed)  
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GI:31982030AEEYEFLTPMEEAPK2088.01279 (observed)  
A416AEXOSC8, OIP2, RRP43Exosome complex exonuclease RRP43GI:254692991;GI:254675240AEFAAPPVDAPDR1499.76055 (observed)  
A6426ENOPH1, MASA, MSTP145Enolase-phosphatase E1GI:251823872AEFFADVVPAVR1464.79827 (observed)  
A5792RNPEP, APBAminopeptidase BGI:227499103;GI:227499234AEFGPPGPGPGSR1369.69853 (observed)  
A5792RNPEP, APBAminopeptidase BGI:227499103;GI:227499234AEFGPPGPGPGSR1369.69902 (observed)  
A9785BCL2L13, MIL1, CD003Bcl-2-like protein 13GI:23943828AEGAAQLSEER1304.65911 (observed)  
A2551SRSF4, SFRS4, SRP75Serine/arginine-rich splicing factor 4GI:165377173AEGESEAPNPEPR1526.72429 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961AEGPEVDVNLPK1555.86308 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961AEGPEVDVNLPK1555.86028 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562AEGSDVANAVLDGADCIMLSGETAK2771.3167 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562AEGSDVANAVLDGADCIMLSGETAK2771.31992 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562AEGSDVANAVLDGADCIMLSGETAK2787.31125 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562AEGSDVANAVLDGADCIMLSGETAK2787.31729 (observed)  
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1GI:124494256AEGSEYQVLYIADDNEIR2229.08457 (observed)  
A5869ATG7, APG7L, GSA7Autophagy-related protein 7GI:149275267;GI:22550098AEGVTALPYFLFK1744.00273 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AEIINQDLFEQLER1861.98308 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AEIINQDLFEQLER1861.97942 (observed)  
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorGI:188035858AEILSNWNMFVGSQATNYGEDLTR2860.37821 (observed)  
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorGI:188035858AEILSNWNMFVGSQATNYGEDLTR2876.3765 (observed)  
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorGI:188035858AEILSNWNMFVGSQATNYGEDLTR2860.37418 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AEISFEDR1110.55754 (observed)  
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35GI:13928670AELAELPLR1155.68596 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AELEALLSSK1348.80083 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AELELELGR1173.66057 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334AELFTQSCADLDK1774.86333 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917AELGEYIR1094.5938 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AELIAQPELK1399.84233 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AELIAQPELK1399.84856 (observed)  
A3816RPS340S ribosomal protein S3GI:6755372AELNEFLTR1236.6718 (observed)  
A3816RPS340S ribosomal protein S3GI:6755372AELNEFLTR1236.67082 (observed)  
A7935TARSThreonyl-tRNA synthetase, cytoplasmicGI:27229277AELNPWPEYINTR1746.89702 (observed)  
A7935TARSThreonyl-tRNA synthetase, cytoplasmicGI:27229277AELNPWPEYINTR1746.89751 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AELSSLQTSR1235.67424 (observed)  
A8907NUB1, NYREN18NEDD8 ultimate buster-1GI:119360354AEMVVDPETMPYLDIANQTGR2494.2092 (observed)  
A0231ARPC4, ARC20, ARPC4-TTLL3Actin-related protein 2/3 complex subunit 4GI:13386054;GI:281427244;GI:281427242AENFFILR1153.6508 (observed)  
A0231ARPC4, ARC20, ARPC4-TTLL3Actin-related protein 2/3 complex subunit 4GI:13386054AENFFILR1153.65215 (observed)  
A928C Uncharacterized protein C2ORF54GI:229576965AENILLTVLER1414.84319 (observed)  
A686BTM9SF4Transmembrane 9 superfamily protein member 4GI:31542095AENLGEVLR1144.64226 (observed)  
A669AMYBBP1A, P160MYB-binding protein 1AGI:31982724AEPATPAEAAQSDR1557.76665 (observed)  
A669AMYBBP1A, P160MYB-binding protein 1AGI:31982724AEPATPAEAAQSDR1557.76787 (observed)  
A4884KERA, SLRR2BKeratocan precursorGI:6680554AEQDAFIHGPQLSYLR1989.0311 (observed)  
A4884KERA, SLRR2BKeratocan precursorGI:6680554AEQDAFIHGPQLSYLR1989.03257 (observed)  
A4639CCDC6, D10S170, TST1Coiled-coil domain-containing protein 6GI:82933348AEQEEEFISNTLFK1973.0167 (observed)  
A5073PPLPeriplakinGI:112421039AESEVANLR1132.60918 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961AESPEMEVNLPK1631.8615 (observed)  
A6034CDS2Phosphatidate cytidylyltransferase 2GI:20149726AETAPLPTSVDDTPEVLNR2169.11748 (observed)  
A3867EPB41L1Band 4.1-like protein 1GI:7305029;GI:54873604AETMTVSSLAIR1422.77434 (observed)  
A8094UBA3, UBE1CUbiquitin-activating enzyme 3GI:162135936;GI:162287057AEVAAEFLNDR1378.71184 (observed)  
A8094UBA3, UBE1CUbiquitin-activating enzyme 3GI:162135936;GI:162287057AEVAAEFLNDR1378.71123 (observed)  
A997BGET4, CEE, TRC35UPF0363 protein C7ORF20GI:27229052;GI:254281178AEVDVADELLENLAK1917.05234 (observed)  
A789ANOP58, NOL5, NOP5Nucleolar protein 58GI:120407050AEVEEEMEEEEAEEEQVVEEEPTVK3237.46469 (observed)  
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialGI:168229148AEVGSPL816.45892 (observed)  
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialGI:168229148AEVGSPL816.45709 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AEVGVPAEFGIWTR1675.89678 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AEVGVPAEFGIWTR1675.89495 (observed)  
A264ABZW1, BZAP45, ORFBasic leucine zipper and W2 domain-containing protein 1GI:13385296AEVLSEEPILK1515.88664 (observed)  
A0089CTNNA1Alpha-1 cateninGI:6753294AEVQNLGGELVVSGVDSAMSLIQAAK2874.54673 (observed)  
A5073PPLPeriplakinGI:112421039AEVTAFTNSIDAELR1780.92461 (observed)  
A5073PPLPeriplakinGI:112421039AEVTAFTNSIDAELR1780.92558 (observed)  
A6839CAMK1D, CAMKID, CKLIK BETACalcium/calmodulin-dependent protein kinase type 1DGI:19527140;GI:79750129AEYEFDSPYWDDISDSAK2426.10166 (observed)  
A6839CAMK1D, CAMKID, CKLIK BETACalcium/calmodulin-dependent protein kinase type 1DGI:19527140;GI:79750129AEYEFDSPYWDDISDSAK2426.08976 (observed)  
A2468ENPP3, PDNP3Ectonucleotide pyrophosphatase/phosphodiesterase 3GI:154240724AEYLQTWSTLLPNINK2179.21067 (observed)  
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1GI:9790167AFAEAAGSAETLSVEK1868.99309 (observed)  
A5008NID2Nidogen-2GI:84370361AFALYSEDEGVLR1613.83452 (observed)  
A5008NID2Nidogen-2GI:84370361AFALYSEDEGVLR1613.83464 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:149253040;GI:183979966AFAYLQVPER1337.73284 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AFCGFEDPR1231.53789 (observed)  
A943ELOC100046074PREDICTED: hypothetical proteinGI:149253498AFDAGLR893.49933 (observed)  
A7989TKT, TKT1TransketolaseGI:6678359;GI:148287022;GI:125347421AFDQIR893.49933 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809AFDSGIIPMEFVNK1855.99443 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809AFDSGIIPMEFVNK1871.98771 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809AFDSGIIPMEFVNK1855.98992 (observed)  
A7366PGAP1, UNQ3024/PRO9822, UNQ3024GPI inositol-deacylaseGI:149233991AFFDLIDADTK1543.8311 (observed)  
A5792RNPEP, APBAminopeptidase BGI:227499103;GI:227499234AFFPCFDTPAVK1676.8436 (observed)  
A5792RNPEP, APBAminopeptidase BGI:227499103;GI:227499234AFFPCFDTPAVK1676.84648 (observed)  
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4GI:6755100AFFSEVER1128.58183 (observed)  
A8886MUC4Mucin 4GI:167736365AFFSNSLVELIR1539.86882 (observed)  
A8886MUC4Mucin 4GI:167736365AFFSNSLVELIR1539.86614 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2687.3461 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2703.33139 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2688.33872 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2703.32718 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2687.33061 (observed)  
A5816ASPRV1, SASPRetroviral-like aspartic protease 1 precursorGI:130502130AFGAPGEAFSEPEEILFANSMGK2687.34281 (observed)  
A4356NPLOC4, NPL4Nuclear protein localization protein 4 homologGI:41054974AFGAPNVVEDEIDQYLSK2283.17905 (observed)  
A9145VWA5A, BCSC1, LOH11CR2AVon Willebrand factor A domain-containing protein 5AGI:225543183AFGENAVVQLISLQK1905.10801 (observed)  
A9145VWA5A, BCSC1, LOH11CR2AVon Willebrand factor A domain-containing protein 5AGI:225543183AFGENAVVQLISLQK1905.11075 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AFGPGLQGGNAGSPAR1600.83586 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AFGPGLQGGNAGSPAR1600.83525 (observed)  
A2584SFRS3, SRP20, SRSF3Serine/arginine-rich splicing factor 3GI:8567402;GI:149251459;GI:149266618AFGYYGPLR1187.63335 (observed)  
A2584SFRS3, SRP20, SRSF3Serine/arginine-rich splicing factor 3GI:8567402;GI:149251459;GI:149266618AFGYYGPLR1187.6331 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AFIGFEGVK1255.73979 (observed)  
A222CNECAP2Adaptin EAR-binding coat-associated protein 2GI:13384758AFIGLGFGDR1196.65776 (observed)  
A222CNECAP2Adaptin EAR-binding coat-associated protein 2GI:13384758AFIGLGFGDR1196.65691 (observed)  
A7557ADSL, AMPSAdenylosuccinate lyaseGI:29788764AFIITGQTYTR1414.78252 (observed)  
A7557ADSL, AMPSAdenylosuccinate lyaseGI:29788764AFIITGQTYTR1414.78264 (observed)  
A6775IDEInsulin-degrading enzymeGI:121583922AFIPQLLSR1188.7227 (observed)  
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein MGI:21313308;GI:158186704AFITNIPFDVK1552.90813 (observed)  
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein MGI:21313308;GI:158186704AFITNIPFDVK1552.90495 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94383772;GI:6671569AFLADPSAFAAAAPAAAATTAAPAAAAAPAK2984.61051 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94383772;GI:6671569AFLADPSAFAAAAPAAAATTAAPAAAAAPAK2984.61582 (observed)  
A0289PPP5C, PPP5Serine/threonine protein phosphatase 5GI:199559777AFLEENQLDYIIR1767.94548 (observed)  
A0289PPP5C, PPP5Serine/threonine protein phosphatase 5GI:199559777AFLEENQLDYIIR1767.94695 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529AFLEVLAK1178.73747 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529AFLEVLAK1178.73296 (observed)  
A3718HSD17B2, EDH17B2Estradiol 17 beta-dehydrogenase 2GI:123173870AFLPLLR973.6342 (observed)  
A3718HSD17B2, EDH17B2Estradiol 17 beta-dehydrogenase 2GI:123173870AFLPLLR973.63561 (observed)  
A3707UNQ207, RETSDR2, DHRS8Estradiol 17-beta-dehydrogenase 11GI:16716597AFLPVMMK1224.70415 (observed)  
A0658DCTN1Dynactin 1GI:118601017AFLQGGQEATDIALLLR1960.10392 (observed)  
A0658DCTN1Dynactin 1GI:118601017AFLQGGQEATDIALLLR1960.10227 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AFLSVMASPQSLCGLR1869.95598 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AFLSVMASPQSLCGLR1885.94609 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AFLSVMASPQSLCGLR1869.95452 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AFLSVMASPQSLCGLR1885.95049 (observed)  
A0621RAB10Ras-related protein Rab-10GI:7710086AFLTLAEDILR1405.82219 (observed)  
A0621RAB10Ras-related protein Rab-10GI:7710086AFLTLAEDILR1405.8217 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845AFMTADLPNELIELLEK2251.21927 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845AFMTADLPNELIELLEK2251.21762 (observed)  
A7888STEAP4, STAMP2, TNFAIP9Metalloreductase STEAP4GI:31981509AFNTISAWALQSGTLDASR2153.11301 (observed)  
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorGI:19527258AFPAWADTSILSR1578.84429 (observed)  
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorGI:19527258AFPAWADTSILSR1578.8438 (observed)  
A767AFAM129A, NIBAN, GIG39Family with sequence similarity 129, member AGI:241982745AFPVYLWQPYLR1696.93926 (observed)  
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinGI:31982089AFQGLLDSYSVR1499.80046 (observed)  
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinGI:31982089AFQGLLDSYSVR1499.79827 (observed)  
A2489GNSN-acetylglucosamine-6-sulfatase precursorGI:29789239AFQNVIAPR1159.66973 (observed)  
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDaGI:112293266AFSDPFVEAEK1527.79619 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781AFSGLTQNPESIELR1805.95513 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781AFSGLTQNPESIELR1805.95378 (observed)  
A2583SFRS7, SRSF7, 9g8Splicing factor, arginine/serine-rich 7GI:22122585AFSYYGPLR1217.64568 (observed)  
A2583SFRS7, SRSF7, 9g8Splicing factor, arginine/serine-rich 7GI:22122585AFSYYGPLR1217.64604 (observed)  
A4795EVPLEnvoplakinGI:111185907AFTGIEDPVTR1349.72234 (observed)  
A4795EVPLEnvoplakinGI:111185907AFTGIEDPVTR1349.71916 (observed)  
A8503SERPINB6, PI6, PTISerpin B6GI:6678097;GI:255759941AFVEVNEEGTEAAAATAGMMTVR2499.20725 (observed)  
A8503SERPINB6, PI6, PTISerpin B6GI:6678097;GI:255759941AFVEVNEEGTEAAAATAGMMTVR2499.20322 (observed)  
A7223OATOrnithine aminotransferase, mitochondrial precursorGI:8393866AFYNNVLGEYEEYITK2241.14023 (observed)  
A7223OATOrnithine aminotransferase, mitochondrial precursorGI:8393866AFYNNVLGEYEEYITK2241.1417 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838AFYPEEISSMVLTK1903.02243 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838AFYPEEISSMVLTK1919.01322 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838AFYPEEISSMVLTK1903.01548 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838AFYPEEISSMVLTK1919.01487 (observed)  
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:31982186AGAGSATLSMAYAGAR1598.80742 (observed)  
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:31982186AGAGSATLSMAYAGAR1614.80474 (observed)  
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:31982186AGAGSATLSMAYAGAR1598.80962 (observed)  
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:31982186AGAGSATLSMAYAGAR1614.80071 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94383772;GI:6671569AGAIAPCEVTVPAQNTGLGPEK2457.27178 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94383772;GI:6671569AGAIAPCEVTVPAQNTGLGPEK2457.27079 (observed)  
A6317DHRS1Dehydrogenase/reductase SDR family member 1GI:31980844AGATVYITGR1152.65178 (observed)  
A6317DHRS1Dehydrogenase/reductase SDR family member 1GI:31980844AGATVYITGR1152.64897 (observed)  
A5177TNKS1BP1, TAB182182 kDa tankyrase 1-binding proteinGI:124486923AGAVDWTDQLGLR1545.81853 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.15586 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.15586 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.15586 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.16007 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.16007 (observed)  
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainGI:85362742;GI:70906477;GI:18158420;GI:85362729;GI:28916677;GI:149265235;GI:70906479;GI:75991700;GI:226693349AGAYDFPSPEWDTVTPEAK2369.16007 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485AGCQVVAPSDMMDGR1726.75054 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485AGCQVVAPSDMMDGR1726.74895 (observed)  
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainGI:31982511AGDTVIPLYIPQCGECK2187.05693 (observed)  
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainGI:31982511AGDTVIPLYIPQCGECK2187.06131 (observed)  
A408AEWSR1, EWSRNA-binding protein EWSGI:88853581AGDWQCPNPGCGNQNFAWR2356.96048 (observed)  
A9636RPS18, D6S218E40S ribosomal protein S18GI:6755368;GI:149252587;GI:149263957;GI:94395028;GI:94395371;GI:149264584;GI:149264635AGELTEDEVER1391.67803 (observed)  
A9636RPS18, D6S218E40S ribosomal protein S18GI:149259085AGELTQDEVER1391.67803 (observed)  
A9709ECM29Proteasome-associated protein ECM29 homologGI:37718970AGEQLAPFLPQLVPR1780.02898 (observed)  
A9709ECM29Proteasome-associated protein ECM29 homologGI:37718970AGEQLAPFLPQLVPR1780.03008 (observed)  
A0098VCLVinculinGI:31543942AGEVINQPMMMAAR1662.82744 (observed)  
A0098VCLVinculinGI:31543942AGEVINQPMMMAAR1662.82536 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240AGFAGDDAPR1120.55132 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240AGFAGDDAPR1120.55425 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628AGFYFDGISR1276.64446 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628AGFYFDGISR1276.64556 (observed)  
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:18266680AGGAGVPAFYTSTGYGTLVQEGGSPIK2873.49405 (observed)  
A4725COTL1, CLPCoactosin-like proteinGI:19482160AGGANYDAQSE1226.54375 (observed)  
A4725COTL1, CLPCoactosin-like proteinGI:19482160AGGANYDAQSE1226.54289 (observed)  
A444DFAM84A, NSE1, PP11517NSE1 proteinGI:31543345AGGEVPAGTQPPQQQYYLK2320.22019 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220AGGGSFGGGSLYGGGGSR1644.78484 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220AGGGSFGGGSLYGGGGSR1644.78484 (observed)  
A447AFUBP3, FBP3Far upstream element binding protein 3GI:224922832AGGGSIEVSVPR1272.70354 (observed)  
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDaGI:112293266AGGIETIANEYSDR1639.80535 (observed)  
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDaGI:112293266AGGIETIANEYSDR1639.8062 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587AGGLDWPEATEGPPSR1783.87505 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587AGGLDWPEATEGPPSR1783.87432 (observed)  
A448ETTLL12Tubulin-tyrosine ligase-like protein 12GI:269954711AGGPEGPPWLPR1377.74053 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AGGSASAMLQPLLDNQVGFK2292.23325 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AGGSASAMLQPLLDNQVGFK2308.22531 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AGGSASAMLQPLLDNQVGFK2292.22867 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AGGSASAMLQPLLDNQVGFK2308.22898 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482AGIIASAR902.5551 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482AGIIASAR902.5551 (observed)  
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseGI:68226731AGIISTVEVLK1417.89202 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915AGLAPLEVR1069.65276 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220AGLENSLAEVECR1580.75469 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220AGLENSLAEVECR1580.75298 (observed)  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13GI:6754480AGLESTLAETECR1569.73772 (observed)  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13GI:6754480AGLESTLAETECR1569.73699 (observed)  
A6366DPP3Dipeptidyl peptidase 3GI:244791124AGLLALEFYTPEAANWR2066.08354 (observed)  
A482AHIST1H2AH, HIST1H2AIHistone H2A type 1-HGI:30061399;GI:94394730;GI:30089710;GI:30061353;GI:7949045;GI:94378041;GI:28316756;GI:29244126;GI:119433657;GI:30061327;GI:30061379;GI:30061371;GI:7106331;GI:256773209AGLQFPVGR1088.63318 (observed)  
A482AHIST1H2AH, HIST1H2AIHistone H2A type 1-HGI:30061399;GI:94394730;GI:30089710;GI:30061353;GI:7949045;GI:94378041;GI:28316756;GI:29244126;GI:119433657;GI:30061327;GI:30061379;GI:30061371;GI:7106331;GI:256773209AGLQFPVGR1088.63469 (observed)  
A493AH2AFX, H2AXHistone H2A.xGI:30061399;GI:94394730;GI:30089710;GI:30061353;GI:7949045;GI:94378041;GI:28316756;GI:29244126;GI:119433657;GI:30061327;GI:30061379;GI:30061371;GI:7106331;GI:256773209AGLQFPVGR1088.63318 (observed)  
A493AH2AFX, H2AXHistone H2A.xGI:30061399;GI:94394730;GI:30089710;GI:30061353;GI:7949045;GI:94378041;GI:28316756;GI:29244126;GI:119433657;GI:30061327;GI:30061379;GI:30061371;GI:7106331;GI:256773209AGLQFPVGR1088.63469 (observed)  
A643DLAS1L, MSTP060LAS1-like proteinGI:71979675AGLQLF793.45769 (observed)  
A643DLAS1L, MSTP060LAS1-like proteinGI:71979675AGLQLF793.45854 (observed)  
A6917LPCAT4, AGPAT7, AYTL3Lysophospholipid acyltransferase LPCAT4GI:46402175AGLSPGFVDMGAEPGR1704.85137 (observed)  
A7673pNORF1, UPF1, RENT1Regulator of nonsense transcripts 1GI:170784813;GI:170784811AGLSQSLFER1251.68291 (observed)  
A7673pNORF1, UPF1, RENT1Regulator of nonsense transcripts 1GI:170784813;GI:170784811AGLSQSLFER1251.68047 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:149253040;GI:183979966AGLSSGFVGCVR1342.67485 (observed)  
A5134SNTB2, D16S2531E, SNT2B2Beta-2-syntrophinGI:149259328;GI:6678059AGLVELLLR1127.73186 (observed)  
A5134SNTB2, D16S2531E, SNT2B2Beta-2-syntrophinGI:149259328;GI:6678059AGLVELLLR1127.72539 (observed)  
A9548RPL22, RPL22L260S ribosomal protein L22GI:149256880AGNLGGGVVTIER1386.78508 (observed)  
A9548RPL22, RPL22L260S ribosomal protein L22GI:149256880AGNLGGGVVTIER1386.78252 (observed)  
A1517LAMB2, LAMSLaminin beta-2 chain precursorGI:31982223AGNSLAASTAEETAGSAQSR2022.98105 (observed)  
A0278PTPN1, PTP1BProtein-tyrosine phosphatase, non-receptor type 1GI:133505845AGNWAAIYQDIR1521.79924 (observed)  
A0278PTPN1, PTP1BProtein-tyrosine phosphatase, non-receptor type 1GI:133505845AGNWAAIYQDIR1521.79949 (observed)  
A567APPP1R13L, IASPP, NKIP1Protein phosphatase 1, regulatory (inhibitor) subunit 13 likeGI:94379918;GI:58082069AGPPAPAPPAPIPPPAPPQSSPPEQPQSMEMR3368.68979 (observed)  
A4559SCINAdseverinGI:226246550;GI:226246552AGQQAGLQVWR1357.74687 (observed)  
A3502AAK1AP2 associated kinase 1GI:73695877;GI:91992157AGQTQPNPGILPIQPALTPR2213.25469 (observed)  
A7897STT3B, SIMPDolichyl-diphosphooligosaccharide--protein gycosyltransferase subunit STT3BGI:61651673AGSPTLLNCLMYK1744.89933 (observed)  
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseGI:52353955AGTGVDNVDLEAATR1632.83257 (observed)  
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseGI:52353955AGTGVDNVDLEAATR1632.83281 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AGTLSITEFADMLSGNAGGFR2259.1209 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AGTLSITEFADMLSGNAGGFR2275.11765 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229AGTQELDDQIQANLPDEK2273.15293 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229AGTQELDDQIQANLPDEK2273.16043 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802AGTQIENIDEDFR1651.80742 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802AGTQIENIDEDFR1651.80303 (observed)  
A1490ITGAV, MSK8, VNRAIntegrin alpha-V precursorGI:154240716AGTQLLAGLR1143.69817 (observed)  
A1490ITGAV, MSK8, VNRAIntegrin alpha-V precursorGI:154240716AGTQLLAGLR1143.69853 (observed)  
A3952SFXN3Sideroflexin 3GI:16716499AGVATPGLTEDQLWR1757.93376 (observed)  
A3952SFXN3Sideroflexin 3GI:16716499AGVATPGLTEDQLWR1757.93279 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AGVGAPVTQVTLQSTQR1857.03545 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AGVGAPVTQVTLQSTQR1857.03142 (observed)  
A492AH2AFY2, MACROH2A2Core histone macro-H2A.2GI:46250738;GI:41152517;GI:283945572;GI:283945575;GI:283945579AGVIFPVGR1059.64519 (observed)  
A492AH2AFY2, MACROH2A2Core histone macro-H2A.2GI:46250738;GI:41152517;GI:283945572;GI:283945575;GI:283945579AGVIFPVGR1059.64018 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:46250738;GI:41152517;GI:283945572;GI:283945575;GI:283945579AGVIFPVGR1059.64519 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:46250738;GI:41152517;GI:283945572;GI:283945575;GI:283945579AGVIFPVGR1059.64018 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AGVLAQLEEER1358.74199 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AGVLAQLEEER1358.74077 (observed)  
A4684CGI-99, CLE7UPF0568 protein C14ORF166GI:13386026AGVMALANLLQIQR1641.96575 (observed)  
A4684CGI-99, CLE7UPF0568 protein C14ORF166GI:13386026AGVMALANLLQIQR1641.9644 (observed)  
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aGI:82801057;GI:149257810;GI:149259749;GI:149260113;GI:94386298;GI:82930638;GI:82949769;GI:82956648;GI:149268884AGVNTVTTLVENK1633.93851 (observed)  
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorGI:110624798AGYFGDPLAPNPADK1820.9417 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149253386AGYTDQVVIGMDVAASEFYR2336.13457 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149253386AGYTDQVVIGMDVAASEFYR2336.14165 (observed)  
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21AGI:157823695;GI:157823731;GI:157823795;GI:157823761AHNLQDGQLSDTGDLGEDIASN2414.11979 (observed)  
A9391LRP1B, LRPDITLow-density lipoprotein receptor-related protein 1B precursorGI:153792247AIAADPIAGK1214.73528 (observed)  
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:31980648AIAELGIYPAVDPLDSTSR2132.14141 (observed)  
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:31980648AIAELGIYPAVDPLDSTSR2132.1375 (observed)  
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1GI:39652626AIAGIINQPYYNYQAGPDAALGR2580.33817 (observed)  
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1GI:39652626AIAGIINQPYYNYQAGPDAALGR2580.34238 (observed)  
A4579ANXA9, ANX31Annexin A9GI:145864475AIAGQGVDYDTIVDVLTNR2164.14072 (observed)  
A4579ANXA9, ANX31Annexin A9GI:145864475AIAGQGVDYDTIVDVLTNR2164.14482 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011AIANECQANFISIK1855.96587 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011AIANECQANFISIK1855.96587 (observed)  
A0261PFKM, PFKX6-phosphofructokinase, muscle typeGI:254553346AIAVLTSGGDAQGMNAAVR1946.02349 (observed)  
A0265MAPK3, ERK1, PRKM3Mitogen-activated protein kinase 3GI:21489933;GI:33468949AIDILDR959.5634 (observed)  
A0596NAPA, SNAPAAlpha-soluble NSF attachment proteinGI:13385392AIDIYEQVGTSAMDSPLLK2339.24594 (observed)  
A0596NAPA, SNAPAAlpha-soluble NSF attachment proteinGI:13385392AIDIYEQVGTSAMDSPLLK2355.23435 (observed)  
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13GI:19526912AIDLFTDAIK1394.81914 (observed)  
A4313DNAJC7, TPR2, TTC2DNAJ (HSP40) homolog, subfamily C, member 7GI:31980994AIDMCPNNASYYGNR1878.80351 (observed)  
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4GI:76253779AIEEGTLEEIEEEVR1889.94963 (observed)  
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4GI:76253779AIEEGTLEEIEEEVR1889.9476 (observed)  
A4391SGTA, SGT, SGT1Small glutamine-rich tetratricopeptide repeat-containing protein AGI:21313588AIELNPANAVYFCNR1884.92363 (observed)  
A4391SGTA, SGT, SGT1Small glutamine-rich tetratricopeptide repeat-containing protein AGI:21313588AIELNPANAVYFCNR1884.92388 (observed)  
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 7GI:12963569AIENIDTLTNLESLFLGK2279.27964 (observed)  
A0691AP1S1, AP19, CLAPS1Adapter-related protein complex 1 sigma 1A subunitGI:6671559AIEQADLLQEEDESPR1986.97649 (observed)  
A0691AP1S1, AP19, CLAPS1Adapter-related protein complex 1 sigma 1A subunitGI:6671559AIEQADLLQEEDESPR1986.97185 (observed)  
A5840ASPHJunctinGI:125628659AIETYQEAADLPDAPTDLVK2448.27959 (observed)  
A5840ASPHJunctinGI:125628659AIETYQEAADLPDAPTDLVK2448.27153 (observed)  
A7193NTPCRNucleoside-triphosphatease C1ORF57GI:13385098AIEVLQSSGLPVDGFYTQEVR2452.28501 (observed)  
A2142CORO1C, CRNN4, CRN2Coronin 1CGI:94394941;GI:31542413AIFLADGNVFTTGFSR1859.98223 (observed)  
A2142CORO1C, CRNN4, CRN2Coronin 1CGI:94394941;GI:31542413AIFLADGNVFTTGFSR1859.98052 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556AIGAVPLIQGEYMIPCEK2266.19455 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556AIGAVPLIQGEYMIPCEK2266.19071 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556AIGAVPLIQGEYMIPCEK2282.19413 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556AIGAVPLIQGEYMIPCEK2282.19175 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:54607171;GI:113195684AIGGGLSSSGGLSSSTIK1867.04033 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:54607171;GI:113195684AIGGGLSSSGGLSSSTIK1867.03972 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171;GI:113195684AIGGGLSSSGGLSSSTIK1867.04033 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171;GI:113195684AIGGGLSSSGGLSSSTIK1867.03972 (observed)  
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorGI:21312316AIGLVTVISK1288.85185 (observed)  
A1925PFKLPhosphofructokinase, liverGI:9790051;GI:31560653AIGVLTSGGDAQGMNAAVR1932.00737 (observed)  
A1925PFKLPhosphofructokinase, liverGI:9790051;GI:31560653AIGVLTSGGDAQGMNAAVR1932.00408 (observed)  
A712CXPO1, CRM1CRM1 proteinGI:38604071AIIASNIMYIVGQYPR1953.07834 (observed)  
A712CXPO1, CRM1CRM1 proteinGI:38604071AIIASNIMYIVGQYPR1969.06638 (observed)  
A712CXPO1, CRM1CRM1 proteinGI:38604071AIIASNIMYIVGQYPR1953.08054 (observed)  
A9653RPS740S ribosomal protein S7GI:6755376;GI:149270446;GI:83004243AIIIFVPVPQLK1626.0645 (observed)  
A9653RPS740S ribosomal protein S7GI:6755376;GI:149270446;GI:83004243AIIIFVPVPQLK1626.06406 (observed)  
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:6679261AILAELTGR1087.66045 (observed)  
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:6679261AILAELTGR1087.66045 (observed)  
A1646TRIM29, ATDCTripartite motif-containing protein 29GI:160333881AILEQNFR1134.64214 (observed)  
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1GI:9790167AILGPMLLDQPLDGVTTSLPSPEQLK3021.68753 (observed)  
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1GI:9790167AILGPMLLDQPLDGVTTSLPSPEQLK3037.6818 (observed)  
A4154MAD1L1, MAD1, TXBP181Mitotic checkpoint proteinGI:88014564AILGSYDSELTQTEYSTQLTQR2648.32322 (observed)  
A4154MAD1L1, MAD1, TXBP181Mitotic checkpoint proteinGI:88014564AILGSYDSELTQTEYSTQLTQR2648.32505 (observed)  
A901BCOPZ1, COPZ, CGI-120Coatomer zeta-1 subunitGI:9789913AILILDNDGDR1358.74004 (observed)  
A901BCOPZ1, COPZ, CGI-120Coatomer zeta-1 subunitGI:9789913AILILDNDGDR1358.74175 (observed)  
A1950GSTA3Glutathione S-transferase A3-3GI:31981724AILNYIASK1280.78813 (observed)  
A6666GSTA2, GST2Glutathione S-transferase A2GI:149259801;GI:149260087;GI:169808401;GI:50263046;GI:154350202AILNYIATK1294.80425 (observed)  
A6905LTA4H, LTA4Leukotriene A-4 hydrolaseGI:116734870AILPCQDTPSVK1605.85832 (observed)  
A1951GSTA4Glutathione S-transferase A4-4GI:160298217AILSYLAAK1237.78093 (observed)  
A1951GSTA4Glutathione S-transferase A4-4GI:160298217AILSYLAAK1237.78337 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94097 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94121 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.93534 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.9373 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94097 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94121 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.93534 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.9373 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94097 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1759.94121 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.93534 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:33859488;GI:7106439;GI:21746161;GI:12963615AILVDLEPGTMDSVR1775.9373 (observed)  
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorGI:224922803AIMNLDVEQYR1495.77153 (observed)  
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorGI:224922803AIMNLDVEQYR1495.76811 (observed)  
A7522PSMA6, PROS27Proteasome subunit alpha type 6GI:6755198AINQGGLTSVAVR1429.82585 (observed)  
A7522PSMA6, PROS27Proteasome subunit alpha type 6GI:6755198AINQGGLTSVAVR1429.82646 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529AINTFPYR1126.60198 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529AINTFPYR1125.62004 (observed)  
A0098VCLVinculinGI:31543942AIPDLTAPVAAVQAAVSNLVR2220.28928 (observed)  
A0098VCLVinculinGI:31543942AIPDLTAPVAAVQAAVSNLVR2220.28836 (observed)  
A7996TMPRSS11A, ECRG1, HATL1Transmembrane protease, serine 11AGI:84794609AIPLIANR1011.6447 (observed)  
A7996TMPRSS11A, ECRG1, HATL1Transmembrane protease, serine 11AGI:84794609AIPLIANR1011.64488 (observed)  
A1927DNM2, DYN2Dynamin 2GI:87299637AIPNQGEILVIR1466.88408 (observed)  
A1927DNM2, DYN2Dynamin 2GI:87299637AIPNQGEILVIR1466.8864 (observed)  
A8968PSMD326S proteasome non-ATPase regulatory subunit 3GI:19705424AIQLEYSEAR1323.70305 (observed)  
A8968PSMD326S proteasome non-ATPase regulatory subunit 3GI:19705424AIQLEYSEAR1323.70281 (observed)  
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GIGI:56699432;GI:56699434AISEPNFSVAYANMCR1962.90886 (observed)  
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorGI:19527258AISFVGSNQAGEYIFER2032.02861 (observed)  
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorGI:19527258AISFVGSNQAGEYIFER2032.02776 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:41152517;GI:283945572;GI:283945575;GI:283945579AISSYFVSTMSSSIK1896.00908 (observed)  
A494AH2AFY, MACROH2A1Core histone macro-H2A.1GI:41152517;GI:283945572;GI:283945575;GI:283945579AISSYFVSTMSSSIK1896.00473 (observed)  
A2520ELAVL1, HURELAV-like protein 1GI:31542602AISTLNGLR1089.63945 (observed)  
A2520ELAVL1, HURELAV-like protein 1GI:31542602AISTLNGLR1089.6386 (observed)  
A035APDCL3, VIAF1, PhLP2APhosducin-like protein 3GI:31560120AISTTCIPNYPDR1640.78996 (observed)  
A360BERMARDTransmembrane protein C6ORF70GI:183074533;GI:183074530;GI:183074537AITDRVR974.5772 (observed)  
A9552RPL2460S ribosomal protein L24GI:18250296;GI:94386657AITGASLADIMAK1549.8886 (observed)  
A9552RPL2460S ribosomal protein L24GI:18250296;GI:94386657AITGASLADIMAK1549.89104 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AITGFDDPFSGK1542.80901 (observed)  
A9531PCBP1Poly(rC)-binding protein 1GI:6754994AITIAGVPQSVTECVK1950.07158 (observed)  
A9531PCBP1Poly(rC)-binding protein 1GI:6754994AITIAGVPQSVTECVK1950.06963 (observed)  
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:31980840;GI:6679583;GI:31980838AITSAYYR1088.5866 (observed)  
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:31980840;GI:6679583;GI:31980838AITSAYYR1088.58391 (observed)  
A319CRAB25, CATX8, CATX-8Ras-related protein Rab-25GI:31980840;GI:6679583;GI:31980838AITSAYYR1088.5866 (observed)  
A319CRAB25, CATX8, CATX-8Ras-related protein Rab-25GI:31980840;GI:6679583;GI:31980838AITSAYYR1088.58391 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AITYLNTGYQR1444.75652 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039AITYLNTGYQR1443.77019 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:51766344;GI:149264394;GI:51770420;GI:82994829;GI:149270876AIVAIENPADVSVISSR1885.05315 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:51766344;GI:149264394;GI:51770420;GI:82994829;GI:149270876AIVAIENPADVSVISSR1885.05412 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:51766344;GI:149264394;GI:51770420;GI:82994829;GI:149270876AIVAIENPADVSVISSR1885.05315 (observed)  
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAGI:149251929;GI:63514363;GI:51766344;GI:149264394;GI:51770420;GI:82994829;GI:149270876AIVAIENPADVSVISSR1885.05412 (observed)  
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:27754065AIVDALPPPCESACSLPTDVDK2621.26169 (observed)  
A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrialGI:16905127AIVTTASLVPEVESVASECPDLK2692.41245 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809AIVWGMQTR1205.66142 (observed)  
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:31980762AIWNVINWENVTER1887.98589 (observed)  
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:31980762AIWNVINWENVTER1887.98296 (observed)  
A7530PSMB5, LMPX, MB1Proteasome subunit beta type 5 precursorGI:6755204AIYQATYR1129.61064 (observed)  
A470AHIST1H1C, H1F2Histone H1.2GI:13430890;GI:9845257;GI:112807207;GI:254588110ALAAAGYDVEK1395.77458 (observed)  
A470AHIST1H1C, H1F2Histone H1.2GI:13430890;GI:9845257;GI:112807207;GI:254588110ALAAAGYDVEK1395.77617 (observed)  
A472AHIST1H1E, H1F4Histone H1.4GI:13430890;GI:9845257;GI:112807207;GI:254588110ALAAAGYDVEK1395.77458 (observed)  
A472AHIST1H1E, H1F4Histone H1.4GI:13430890;GI:9845257;GI:112807207;GI:254588110ALAAAGYDVEK1395.77617 (observed)  
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitGI:224809382ALAAGGVGSIVR1214.73418 (observed)  
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitGI:224809382ALAAGGVGSIVR1214.73467 (observed)  
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorGI:13277394ALADTENLR1146.62334 (observed)  
A0419GSNGelsolin precursor, plasmaGI:28916693ALAELAA802.48169 (observed)  
A0419GSNGelsolin precursor, plasmaGI:28916693ALAELAA802.4829 (observed)  
A091ARHEB, RHEB2GTP-binding protein RhebGI:149253589;GI:28626508ALAESWNAAFLESSAK1983.04497 (observed)  
A7947TALH, TALDO1, TALTransaldolaseGI:33859640ALAGCDFLTISPK1669.89653 (observed)  
A7947TALH, TALDO1, TALTransaldolaseGI:33859640ALAGCDFLTISPK1669.89629 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529ALALGALQNIR1283.79224 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529ALALGALQNIR1283.79187 (observed)  
A9579RPLP1, RRP160S acidic ribosomal protein P1GI:9256519ALANVNIGSLICNVGAGGPAPAAGAAPAGGAAPSTAAAPAEEK4060.08803 (observed)  
A9579RPLP1, RRP160S acidic ribosomal protein P1GI:9256519ALANVNIGSLICNVGAGGPAPAAGAAPAGGAAPSTAAAPAEEK4060.09463 (observed)  
A7856SPRSepiapterin reductaseGI:160333789ALAPQLAR983.61046 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769ALASNLR888.54016 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769ALASNLR888.54051 (observed)  
A5731ADH7Alcohol dehydrogenase class IV mu/sigma chainGI:31560625ALAVGATECISPK1593.86308 (observed)  
A5731ADH7Alcohol dehydrogenase class IV mu/sigma chainGI:31560625ALAVGATECISPK1593.86394 (observed)  
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like proteinGI:21312654ALAVGGLGSIIR1270.79936 (observed)  
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like proteinGI:21312654ALAVGGLGSIIR1270.7968 (observed)  
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinGI:42476274ALCADLSPR1135.56987 (observed)  
A2341ACTN1Alpha-actinin 1GI:61097906;GI:11230802;GI:7304855ALDFIASK1152.67937 (observed)  
A2344ACTN4Alpha-actinin 4GI:61097906;GI:11230802;GI:7304855ALDFIASK1152.67937 (observed)  
A0097TLN1, TLNTalin 1GI:227116327ALDGDFTEENR1410.66472 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1703.86308 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1735.84861 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1703.86174 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1703.86308 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1735.84861 (observed)  
A7773AHCY, SAHHAdenosylhomocysteinaseGI:149267883;GI:262263372ALDIAENEMPGLMR1703.86174 (observed)  
A351CRBP2, CRBP2Retinol-binding protein II, cellularGI:255759938ALDIDFATR1165.63323 (observed)  
A351CRBP2, CRBP2Retinol-binding protein II, cellularGI:255759938ALDIDFATR1165.63432 (observed)  
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorGI:149262992;GI:58037267ALDLFSDNAPPPELLEIINEDIAK2925.57694 (observed)  
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorGI:149262992;GI:58037267ALDLFSDNAPPPELLEIINEDIAK2925.5795 (observed)  
A669AMYBBP1A, P160MYB-binding protein 1AGI:31982724ALDLIEVLVTK1501.95305 (observed)  
A1625C8AComplement component C8 alpha chain precursorGI:22122667ALDQYLMEFNACR1763.81059 (observed)  
A1625C8AComplement component C8 alpha chain precursorGI:22122667ALDQYLMEFNACR1763.80901 (observed)  
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1GI:6754972;GI:31560656;GI:255652857ALDTMNFDVIK1554.8488 (observed)  
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1GI:6754972;GI:31560656;GI:255652857ALDTMNFDVIK1554.85637 (observed)  
A9073STIM1, GOKStromal interaction molecule 1 precursorGI:149257881ALDTVLFGPPLLTR1656.98491 (observed)  
A9073STIM1, GOKStromal interaction molecule 1 precursorGI:149257881ALDTVLFGPPLLTR1656.98601 (observed)  
A7403PCMT1Protein-L-isoaspartate (D-aspartate) O-methyltransferaseGI:226530884ALDVGSGSGILTACFAR1827.93096 (observed)  
A350CRBP1, CRBP1Retinol-binding protein I, cellularGI:149260240ALDVNVALR1114.6729 (observed)  
A350CRBP1, CRBP1Retinol-binding protein I, cellularGI:149260240ALDVNVALR1114.67327 (observed)  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13GI:6754480ALEAANADLEVK1531.86052 (observed)  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13GI:6754480ALEAANADLEVK1531.86479 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026ALEAEAAGLR1144.64507 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026ALEAEAAGLR1144.64385 (observed)  
A108BGTF3C3Transcription factor IIIC102GI:75677510ALEALEPMYDPDTLAQDANAAQQELK3133.56406 (observed)  
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicGI:162417975ALEDVCIETIEAGFMTK2204.0947 (observed)  
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicGI:162417975ALEDVCIETIEAGFMTK2220.08677 (observed)  
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicGI:162417975ALEDVCIETIEAGFMTK2204.09232 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:7106335;GI:21489935ALEEANTELEVK1633.88896 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:7106335;GI:21489935ALEEANTELEVK1633.8958 (observed)  
A1626C8BComplement component C8 beta chain precursorGI:33563297ALEEFQSEVSSCR1674.76067 (observed)  
A1626C8BComplement component C8 beta chain precursorGI:33563297ALEEFQSEVSSCR1674.75859 (observed)  
A3824KRT10, KPPKeratin, type I cytoskeletal 10GI:112983636ALEESNYELEGK1669.85173 (observed)  
A3824KRT10, KPPKeratin, type I cytoskeletal 10GI:112983636ALEESNYELEGK1669.85234 (observed)  
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunitGI:238814391ALEIIPR955.60631 (observed)  
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunitGI:238814391ALEIIPR955.60558 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446ALELDSNLYR1337.71916 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404ALELEQELR1244.69792 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404ALELEQELR1244.6928 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220ALEQANTELEVK1632.9135 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220ALEQANTELEVK1632.90569 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264ALEQFLQEYFDGNLK2103.10552 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264ALEQFLQEYFDGNLK2103.10782 (observed)  
A0669RUVBL2, INO80J, TIP48RuvB-like 2GI:6755382ALESDMAPVLIMATNR1875.98454 (observed)  
A0669RUVBL2, INO80J, TIP48RuvB-like 2GI:6755382ALESDMAPVLIMATNR1891.98026 (observed)  
A0668RUVBL1, INO80H, NMP238RuvB-like 1GI:9790083ALESSIAPIVIFASNR1832.04233 (observed)  
A0668RUVBL1, INO80H, NMP238RuvB-like 1GI:9790083ALESSIAPIVIFASNR1832.04197 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966ALEVEECR1138.53618 (observed)  
A2601SART3, TIP110Squamous cell carcinoma antigen recognized by T-cells 3GI:8394239ALEYLQQEVEER1650.84795 (observed)  
A2601SART3, TIP110Squamous cell carcinoma antigen recognized by T-cells 3GI:8394239ALEYLQQEVEER1650.84587 (observed)  
A3213SMC3, BAM, BMHStructural maintenance of chromosome 3GI:36031035ALEYTIYNQELNETR2001.00371 (observed)  
A3213SMC3, BAM, BMHStructural maintenance of chromosome 3GI:36031035ALEYTIYNQELNETR2001.00249 (observed)  
A0177MAP4K4, HGK, NIKMitogen-activated protein kinase kinase kinase kinase 4GI:114052416;GI:114052522;GI:114052442;GI:114052104;GI:145279237ALFLIPR973.63213 (observed)  
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1GI:114052416;GI:114052522;GI:114052442;GI:114052104;GI:145279237ALFLIPR973.63213 (observed)  
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorGI:240120117;GI:240120119ALGGASGGYTTGPEPLVSLLR2160.179 (observed)  
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorGI:240120117;GI:240120119ALGGASGGYTTGPEPLVSLLR2160.18169 (observed)  
A6010Cbr2Carbonyl reductase [NADPH] 2GI:6671688ALGGIGPVDLLVNNAALVIMQPFLEVTK3196.83803 (observed)  
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]GI:149252910;GI:10946870ALGLSNFNSR1222.66692 (observed)  
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]GI:149252910;GI:10946870ALGLSNFNSR1222.67143 (observed)  
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6GI:33620739;GI:94363353;GI:94383790;GI:26986555ALGQNPTNAEVLK1642.94036 (observed)  
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6GI:33620739;GI:94363353;GI:94383790;GI:26986555ALGQNPTNAEVLK1642.93682 (observed)  
A7831SLK, STK2, HSLKCTCL tumor antigen se20-9GI:257467552;GI:257467554ALGSEGEAAATEVDLER1861.92734 (observed)  
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaGI:82795783;GI:51704904;GI:110625979ALIAAQYSGAQVR1491.84197 (observed)  
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaGI:82795783;GI:51704904;GI:110625979ALIAAQYSGAQVR1491.84075 (observed)  
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitGI:6753322ALIAGGGAPEIELALR1694.9959 (observed)  
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitGI:6753322ALIAGGGAPEIELALR1694.99455 (observed)  
A096BTDRD1Tudor domain containing protein 1GI:268607544ALIDSGFAIK1322.79241 (observed)  
A0127ABI1, SSH3BP, SSH3BP1Spectrin SH3 binding proteinGI:116089343;GI:116089341;GI:116089345;GI:116089351;GI:116089347ALIESYQNLTR1451.80046 (observed)  
A0127ABI1, SSH3BP, SSH3BP1Spectrin SH3 binding proteinGI:116089343;GI:116089341;GI:116089345;GI:116089351;GI:116089347ALIESYQNLTR1451.80132 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850ALINADELANDVAGAEALLDR2298.21054 (observed)  
A257CNUP93Nuclear pore complex protein Nup93GI:149272563;GI:27369533ALITFAGMIPYR1496.84526 (observed)  
A4633CAP1, CAPAdenylyl cyclase-associated protein 1GI:157951604ALLATASQCQQPAGNK1935.00273 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ALLAYAFALAGNQDTK1955.09014 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ALLAYAFALAGNQDTK1955.0894 (observed)  
A1602CFB, BF, BFDComplement factor B precursorGI:218156291;GI:218156289ALLDIGR901.554 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115ALLEEIER1116.63896 (observed)  
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1GI:40556608ALLFIPR973.63365 (observed)  
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1GI:40556608ALLFIPR973.63603 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:6754254ALLFVPR959.61913 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:6754254ALLFVPR959.61559 (observed)  
A5374KBPKIF1-binding proteinGI:72384371ALLGPAPEDEDEPAADDGPGDQALGAGEPR3074.43418 (observed)  
A5374KBPKIF1-binding proteinGI:72384371ALLGPAPEDEDEPAADDGPGDQALGAGEPR3074.43454 (observed)  
A1491COL1A1Collagen alpha-1(I) chainGI:34328108ALLLQGSNEIELR1599.92351 (observed)  
A1491COL1A1Collagen alpha-1(I) chainGI:34328108ALLLQGSNEIELR1599.92156 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086ALLQAILQTEDMLK1875.09189 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086ALLQAILQTEDMLK1875.09464 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086ALLQAILQTEDMLK1891.08391 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086ALLQAILQTEDMLK1891.08414 (observed)  
A5827ASL, LP3236Argininosuccinate lyaseGI:19526986ALLQAQEP1013.57543 (observed)  
A5827ASL, LP3236Argininosuccinate lyaseGI:19526986ALLQAQEP1013.57445 (observed)  
A7092MUTYH, MYHbeta, hMYHA/G-specific adenine DNA glycosylaseGI:227330621ALLQELQR1116.63762 (observed)  
A7092MUTYH, MYHbeta, hMYHA/G-specific adenine DNA glycosylaseGI:227330621ALLQELQR1116.64006 (observed)  
A9626TROVE2, RO60, SSA2TROVE domain family, member 2GI:7305523ALLQEMPLTALLR1628.95891 (observed)  
A0089CTNNA1Alpha-1 cateninGI:6753294;GI:157951729;GI:157951727ALLSAVTR974.61479 (observed)  
A1914CTNNA2, CAPRCatenin alpha-2GI:6753294;GI:157951729;GI:157951727ALLSAVTR974.61479 (observed)  
A6167Cyp3a41aCytochrome P450 3A41GI:149274500;GI:28893549;GI:6681115ALLSPTFTSGR1293.72991 (observed)  
A6167Cyp3a41aCytochrome P450 3A41GI:149274500;GI:28893549;GI:6681115ALLSPTFTSGR1293.72612 (observed)  
A6176Cyp3a13Cytochrome P450 3A13GI:149274500;GI:28893549;GI:6681115ALLSPTFTSGR1293.72991 (observed)  
A6176Cyp3a13Cytochrome P450 3A13GI:149274500;GI:28893549;GI:6681115ALLSPTFTSGR1293.72612 (observed)  
A8385ANXA3, ANX3Annexin A3GI:149254235;GI:160707925ALLTLADGR1073.64409 (observed)  
A8385ANXA3, ANX3Annexin A3GI:149254235;GI:160707925ALLTLADGR1073.64507 (observed)  
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGI:149258655;GI:160298213ALLTPVAIAAGR1296.81499 (observed)  
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGI:149258655;GI:160298213ALLTPVAIAAGR1296.81682 (observed)  
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGI:149258655;GI:160298213ALLTPVAIAAGR1296.81499 (observed)  
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGI:149258655;GI:160298213ALLTPVAIAAGR1296.81682 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:6996913ALLYLCGGDD1373.67339 (observed)  
A4403TOMM34, URCC3Mitochondrial import receptor subunit TOM34GI:13385500ALMDSLGPEWR1418.72417 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811ALMGLYNGQVLCK1744.90727 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811ALMGLYNGQVLCK1744.90776 (observed)  
A0324JUP, CTNNG, DP3Junction plakoglobinGI:28395018ALMGSPQLVAAVVR1571.91094 (observed)  
A0324JUP, CTNNG, DP3Junction plakoglobinGI:28395018ALMGSPQLVAAVVR1555.91728 (observed)  
A0324JUP, CTNNG, DP3Junction plakoglobinGI:28395018ALMGSPQLVAAVVR1571.9113 (observed)  
A0324JUP, CTNNG, DP3Junction plakoglobinGI:28395018ALMGSPQLVAAVVR1555.91448 (observed)  
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:149270048;GI:183396771ALMLQGVDLLADAVAVTMGPK2417.34793 (observed)  
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:149270048;GI:183396771ALMLQGVDLLADAVAVTMGPK2401.35367 (observed)  
A0291DSG1, CDHF4Desmoglein-1GI:169234958;GI:32129201;GI:32129205ALNAQGQDLENPLELR1925.02104 (observed)  
A0291DSG1, CDHF4Desmoglein-1GI:169234958;GI:32129201;GI:32129205ALNAQGQDLENPLELR1925.0258 (observed)  
A4755Dsg1bDesmoglein-1-betaGI:169234958;GI:32129201;GI:32129205ALNAQGQDLENPLELR1925.02104 (observed)  
A4755Dsg1bDesmoglein-1-betaGI:169234958;GI:32129201;GI:32129205ALNAQGQDLENPLELR1925.0258 (observed)  
A7852SRM, SPS1, SRML1Spermidine synthaseGI:6678131ALNDIS776.42603 (observed)  
A7304PARP4, ADPRTL1, PARPLPoly [ADP]-ribose polymerase 4GI:281485553ALNENLQDTVETIR1759.93303 (observed)  
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 2GI:255069795ALNPLEDWLR1370.7531 (observed)  
A7363PGAM1, PGAMAPhosphoglycerate mutase 1GI:114326546ALPFWNEEIVPQIK1972.11357 (observed)  
A7363PGAM1, PGAMAPhosphoglycerate mutase 1GI:114326546ALPFWNEEIVPQIK1972.12259 (observed)  
A718BTMTC3, SMILETransmembrane and TPR repeat-containing protein 3GI:158517929ALPILEELLK1426.91619 (observed)  
A718BTMTC3, SMILETransmembrane and TPR repeat-containing protein 3GI:158517929ALPILEELLK1426.92571 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115ALQALDELR1172.67583 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115ALQALDELR1172.67607 (observed)  
A0428ALDOC, ALDCFructose-bisphosphate aldolase CGI:60687506ALQASALNAWR1344.75517 (observed)  
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1BGI:34328077ALQDLENAASGDATVR1774.90911 (observed)  
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1BGI:34328077ALQDLENAASGDATVR1774.90544 (observed)  
A1929DNM1L, DLP1, DRP1Dynamin-like proteinGI:71061458;GI:71061455ALQGASQIIAEIR1513.88762 (observed)  
A8470RECK, ST15Reversion-inducing cysteine-rich protein with Kazal motifs precursorGI:172072643ALQIEACNK1323.70281 (observed)  
A0326VIL2, EZREzrinGI:149266483ALQLEEER1131.61614 (observed)  
A0326VIL2, EZREzrinGI:149266483ALQLEEER1131.61406 (observed)  
A6410DCI, ECI13,2-trans-enoyl-CoA isomerase, mitochondrial precursorGI:31981810ALQLGTLFSPAEALK1847.09781 (observed)  
A6410DCI, ECI13,2-trans-enoyl-CoA isomerase, mitochondrial precursorGI:31981810ALQLGTLFSPAEALK1847.09502 (observed)  
A8956PSMC6, SUG226S protease regulatory subunit S10BGI:27754103ALQSVGQIVGEVLK1729.05686 (observed)  
A9785BCL2L13, MIL1, CD003Bcl-2-like protein 13GI:23943828ALQTILSQPVTYEAYR1997.08463 (observed)  
A9785BCL2L13, MIL1, CD003Bcl-2-like protein 13GI:23943828ALQTILSQPVTYEAYR1997.08609 (observed)  
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1GI:240120054ALQTTYGTNAPR1436.76079 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431ALSAGNIDDALQCYSEAIK2316.15012 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431ALSAGNIDDALQCYSEAIK2316.14433 (observed)  
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:229892318ALSEIAGITLPYDTLDQVR2219.20914 (observed)  
A078CKLC3, KLC2, KLC2LKinesin light chain 3GI:22122725ALSIYEALGGPQDPNVAK2131.16874 (observed)  
A078CKLC3, KLC2, KLC2LKinesin light chain 3GI:22122725ALSIYEALGGPQDPNVAK2131.16892 (observed)  
A5239UBQLN1, DA41, PLIC1Ubiquilin 1GI:22726191ALSNLESIPGGYNALR1818.98625 (observed)  
A7722RNASEH1, RNH1Ribonuclease H1GI:31981748;GI:285402638;GI:285402659ALSQPDTVLR1243.71379 (observed)  
A7722RNASEH1, RNH1Ribonuclease H1GI:31981748;GI:285402638;GI:285402659ALSQPDTVLR1243.71343 (observed)  
A8965PSMD13, HSPC02726S proteasome non-ATPase regulatory subunit 13GI:6755210ALSVGLVR958.61595 (observed)  
A3928SCFD1, STXBP1L2, FKSG23SEC1 family domain containing protein 1GI:58037481ALTDAGCNLSPLQYIK2041.07187 (observed)  
A3707UNQ207, RETSDR2, DHRS8Estradiol 17-beta-dehydrogenase 11GI:16716597ALTDELAALGR1273.72893 (observed)  
A7542PTGR1, LTB4DHProstaglandin reductase 1GI:13385466ALTELMNWVSEGK1765.94602 (observed)  
A7542PTGR1, LTB4DHProstaglandin reductase 1GI:13385466ALTELMNWVSEGK1765.94529 (observed)  
A7175NQO2, NMOR2NRH dehydrogenase [quinone] 2GI:9937970;GI:253795455;GI:253795451ALTSDIFEEQR1452.75127 (observed)  
A7175NQO2, NMOR2NRH dehydrogenase [quinone] 2GI:9937970;GI:253795455;GI:253795451ALTSDIFEEQR1452.74419 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07114 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07622 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07781 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07517 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07114 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07622 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07781 (observed)  
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07517 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07114 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07622 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07781 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07517 (observed)  
A5196TUBB6, TUBB-5Tubulin, beta 6GI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07114 (observed)  
A5196TUBB6, TUBB-5Tubulin, beta 6GI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07622 (observed)  
A5196TUBB6, TUBB-5Tubulin, beta 6GI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1980.07781 (observed)  
A5196TUBB6, TUBB-5Tubulin, beta 6GI:31981939;GI:22165384;GI:149253488;GI:149253527;GI:83030206;GI:27754056;GI:12963615ALTVPELTQQMFDAK1996.07517 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:21746161ALTVPELTQQMFDSK1996.07572 (observed)  
A5190TUBB2BTubulin beta-2B chainGI:33859488;GI:21746161ALTVPELTQQMFDSK1996.07297 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:7106439ALTVPELTQQVFDAK1948.10538 (observed)  
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:7106439ALTVPELTQQVFDAK1948.10454 (observed)  
A8717CNPY2, MSAP, TMEM4Protein Canopy homolog 2GI:9903607ALVDELEWEIAR1587.85271 (observed)  
A8717CNPY2, MSAP, TMEM4Protein Canopy homolog 2GI:9903607ALVDELEWEIAR1587.8499 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472ALVDGPCTR1121.55705 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472ALVDGPCTR1121.55705 (observed)  
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinGI:31982089ALVDSLSAR1075.6237 (observed)  
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinGI:31982089ALVDSLSAR1075.62468 (observed)  
A728DMST024, MYG1UPF0160 protein MYG1, mitochondrialGI:11096332ALVEEALAQR1243.71391 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047ALVEYSCR1130.5446 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047ALVEYSCR1130.54692 (observed)  
A7300PARK7, DJ-1RNA-binding protein regulatory subunitGI:55741460ALVILAK1015.72191 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115ALVPAAELLDSGVISHELYQQLQR2794.53312 (observed)  
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorGI:110347473ALVQQLEQFR1375.7863 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765ALVSSVR875.54753 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765ALVSSVR875.54625 (observed)  
A0046GNA13Guanine nucleotide-binding protein, alpha-13 subunitGI:89001109ALWEDSGIQNAYDR1781.85906 (observed)  
A0046GNA13Guanine nucleotide-binding protein, alpha-13 subunitGI:89001109ALWEDSGIQNAYDR1781.86357 (observed)  
A0256SH3GL2, CNSA2, SH3D2AEndophilin-A1GI:31560792ALYDFEPENEGELGFK2146.0607 (observed)  
A0256SH3GL2, CNSA2, SH3D2AEndophilin-A1GI:31560792ALYDFEPENEGELGFK2146.06308 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ALYEAELSQMQTHISDTSVVLSMDNNR3212.54148 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ALYEAELSQMQTHISDTSVVLSMDNNR3196.53623 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ALYEAELSQMQTHISDTSVVLSMDNNR3196.53916 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ALYEAELSQMQTHISDTSVVLSMDNNR3212.53745 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171ALYEAELSQMQTHISDTSVVLSMDNNR3228.53501 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663ALYEAGER1052.55229 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663ALYEAGER1052.55168 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589ALYETELADAR1395.72624 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589ALYETELADAR1395.7249 (observed)  
A6042CPCeruloplasmin precursorGI:110347564;GI:110815853ALYFEYTDGTFSK1829.92143 (observed)  
A0176PAK1, PAK1BSerine/threonine-protein kinase PAK 1GI:112181194;GI:46559406ALYLIATNGTPELQNPEK2261.22873 (observed)  
A0176PAK1, PAK1BSerine/threonine-protein kinase PAK 1GI:112181194;GI:46559406ALYLIATNGTPELQNPEK2261.23001 (observed)  
A7280PAK2Serine/threonine-protein kinase PAK 2GI:112181194;GI:46559406ALYLIATNGTPELQNPEK2261.22873 (observed)  
A7280PAK2Serine/threonine-protein kinase PAK 2GI:112181194;GI:46559406ALYLIATNGTPELQNPEK2261.23001 (observed)  
A8494Serpina3nSerine protease inhibitor A3NGI:130503301ALYQAEAFTADFQQPR2000.00077 (observed)  
A8494Serpina3nSerine protease inhibitor A3NGI:130503301ALYQAEAFTADFQQPR1999.99875 (observed)  
A8492Serpina3kSerine protease inhibitor A3KGI:148747546ALYQTEAFTADFQQPTEAK2447.23807 (observed)  
A8492Serpina3kSerine protease inhibitor A3KGI:148747546ALYQTEAFTADFQQPTEAK2447.24541 (observed)  
A678DLRRC47Leucine-rich repeat-containing protein 47GI:149258501;GI:19526818ALYSNILGEENTYLWR2086.07549 (observed)  
A678DLRRC47Leucine-rich repeat-containing protein 47GI:149258501;GI:19526818ALYSNILGEENTYLWR2086.07182 (observed)  
A028AOSTF1Osteoclast stimulating factor 1GI:22267440ALYTFEPR1140.61833 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431AMADPEVQQIMSDPAMR2033.96013 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431AMADPEVQQIMSDPAMR2033.95818 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431AMADPEVQQIMSDPAMR2081.94742 (observed)  
A9977LRBA, BGL, CDC4LLipopolysaccharide-responsive and beige-like anchor proteinGI:117956399AMALSFDQR1182.60393 (observed)  
A3570COPS3, CSN3, SGN3COP9 signalosome complex subunit 3GI:6753488AMDQEITVNPQFVQK2036.0706 (observed)  
A8151UGT1A9, GNT1, UGT1UDP-glucuronosyltransferase 1-9 precursor, microsomalGI:145699137;GI:145864477;GI:145699099;GI:33186906;GI:145864463;GI:32526871;GI:47059123;GI:284413688AMEIAEALGR1204.65129 (observed)  
A8151UGT1A9, GNT1, UGT1UDP-glucuronosyltransferase 1-9 precursor, microsomalGI:145699137;GI:145864477;GI:145699099;GI:33186906;GI:145864463;GI:32526871;GI:47059123;GI:284413688AMEIAEALGR1204.64604 (observed)  
A6321SORD, SORDLSorbitol dehydrogenaseGI:22128627AMGAAQVVVTDLSASR1719.92058 (observed)  
A6321SORD, SORDLSorbitol dehydrogenaseGI:22128627AMGAAQVVVTDLSASR1719.90581 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1887.92143 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1888.9041 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1904.89665 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1888.90911 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1903.9229 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1919.91179 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1905.8864 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1919.91582 (observed)  
A469AHIST1H1A, H1F1Histone H1.1GI:68131547;GI:68226433;GI:30061385;GI:149264032;GI:160420312;GI:46049029;GI:28316760;GI:68226431;GI:160420308;GI:30089704;GI:30061387;GI:13386452AMGIMNSFVNDIFER1905.88616 (observed)  
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitGI:94410730;GI:41054806AMGNLQIDFADPQR1719.86003 (observed)  
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitGI:94410730;GI:41054806AMGNLQIDFADPQR1735.85478 (observed)  
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitGI:94410730;GI:41054806AMGNLQIDFADPQR1719.85857 (observed)  
A588AEIF5Eukaryotic translation initiation factor 5GI:149261435AMGPLVLTEVLFDEK1950.09354 (observed)  
A588AEIF5Eukaryotic translation initiation factor 5GI:149261435AMGPLVLTEVLFDEK1966.08487 (observed)  
A9491TACSTD2, GA733-1, M1S1Tumor-associated calcium signal transducer 2 precursorGI:31560359AMGSQVLVDCSTLTSK1973.99663 (observed)  
A9491TACSTD2, GA733-1, M1S1Tumor-associated calcium signal transducer 2 precursorGI:31560359AMGSQVLVDCSTLTSK1989.99222 (observed)  
A9491TACSTD2, GA733-1, M1S1Tumor-associated calcium signal transducer 2 precursorGI:31560359AMGSQVLVDCSTLTSK1974.00089 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2355.12394 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2371.11289 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2355.11734 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2371.11563 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2355.12394 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2371.11289 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2355.11734 (observed)  
A0961TCEB1Transcription elongation factor B polypeptide 1GI:149249090;GI:82923135AMLSGPGQFAENETNEVNFR2371.11563 (observed)  
A812DPLAC8, BM-004Placenta-specific gene 8 proteinGI:21105853AMNAF697.34894 (observed)  
A812DPLAC8, BM-004Placenta-specific gene 8 proteinGI:21105853AMNAF713.34613 (observed)  
A812DPLAC8, BM-004Placenta-specific gene 8 proteinGI:21105853AMNAF697.34241 (observed)  
A2562RBM3, RNPLRNA-binding protein 3GI:149234330;GI:37497112;GI:261862339AMNGESLDGR1194.55705 (observed)  
A2562RBM3, RNPLRNA-binding protein 3GI:149234330;GI:37497112AMNGESLDGR1194.55803 (observed)  
A2562RBM3, RNPLRNA-binding protein 3GI:149234330;GI:37497112;GI:261862339AMNGESLDGR1194.55705 (observed)  
A2562RBM3, RNPLRNA-binding protein 3GI:149234330;GI:37497112AMNGESLDGR1194.55803 (observed)  
A4471ITPR3Inositol 1,4,5-trisphosphate receptor type 3GI:61102728AMSLVSGEGEGEQNEIR1949.93315 (observed)  
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitGI:6753320AMTGVEQWPYR1481.73369 (observed)  
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitGI:6753320AMTGVEQWPYR1481.73406 (observed)  
A9451PLXNB2, MM1Plexin B2GI:226958474AMTLEEAEAFVGAER1767.87558 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127AMTMPPVSQPEGSIVLR1957.0391 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AMTTGAIAAMLSTILYSR2047.07224 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AMTTGAIAAMLSTILYSR2015.08316 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AMTTGAIAAMLSTILYSR2031.07523 (observed)  
A7526PSMB1, PSC5Proteasome subunit beta type 1GI:7242197AMTTGAIAAMLSTILYSR2047.07114 (observed)  
A8972PSME2Proteasome activator subunit 2GI:20137004;GI:71725358AMVLDLR961.56297 (observed)  
A8972PSME2Proteasome activator subunit 2GI:20137004;GI:71725358AMVLDLR961.56249 (observed)  
A5087PLS3Plastin 3GI:21704120;GI:262050551ANDDIIVNWVNR1572.82915 (observed)  
A5087PLS3Plastin 3GI:21704120;GI:262050551ANDDIIVNWVNR1572.82585 (observed)  
A1245NEDD4, NEDD4-1, PIG53E3 ubiquitin-protein ligase NEDD4GI:56699423ANILEDSYR1224.63347 (observed)  
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8AGI:38372905ANINVENAFFTLAR1723.9262 (observed)  
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8AGI:38372905ANINVENAFFTLAR1723.92607 (observed)  
A9145VWA5A, BCSC1, LOH11CR2AVon Willebrand factor A domain-containing protein 5AGI:225543183ANLGGTEILTPLCNIYK2154.16001 (observed)  
A9145VWA5A, BCSC1, LOH11CR2AVon Willebrand factor A domain-containing protein 5AGI:225543183ANLGGTEILTPLCNIYK2154.1563 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446ANLQIDQINTDLNLER2014.0706 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446ANLQIDQINTDLNLER2014.06999 (observed)  
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richGI:149252953;GI:23956214ANLSLLR930.58562 (observed)  
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richGI:149252953;GI:23956214ANLSLLR930.58556 (observed)  
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1GI:85861182ANNTTYGLAAGLFTK1830.99394 (observed)  
A7196ND3, NADH3, AD 1NADH-ubiquinone oxidoreductase chain 3GI:34538605;GI:226453482;GI:187373161ANPYECGFDPTSSAR1804.77703 (observed)  
A002AMYOF, FER1L3MyoferlinGI:149270772;GI:149270774;GI:153791796ANVTVLDTQIR1373.79119 (observed)  
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:6680618ANWYFLLAR1297.72344 (observed)  
A8170UK114, HRSP12, PSPRibonuclease UK114GI:40807498APAAIGPYSQAVQVDR1786.96147 (observed)  
A8170UK114, HRSP12, PSPRibonuclease UK114GI:40807498APAAIGPYSQAVQVDR1786.95806 (observed)  
A9529Gm10119Uncharacterized proteinGI:94395665;GI:149265827APAMFNIR1063.58501 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915APAVATVGSICDLNLK1906.04276 (observed)  
A7121CYB5R3, DIA1, B5RDiaphoraseGI:19745150APDAWDYSQGFVNEEMIR2272.054 (observed)  
A7121CYB5R3, DIA1, B5RDiaphoraseGI:19745150APDAWDYSQGFVNEEMIR2272.0501 (observed)  
A7121CYB5R3, DIA1, B5RDiaphoraseGI:19745150APDAWDYSQGFVNEEMIR2288.04911 (observed)  
A0326VIL2, EZREzrinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69988 (observed)  
A0326VIL2, EZREzrinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69597 (observed)  
A0808MSNMoesinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69988 (observed)  
A0808MSNMoesinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69597 (observed)  
A0819RDXRadixinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69988 (observed)  
A0819RDXRadixinGI:149266483;GI:157277952;GI:70778915;GI:157277948APDFVFYAPR1326.69597 (observed)  
A681CHDLBP, HBP, VGLVigilinGI:19527028APDMSSSEEFPSFGAQVAPK2370.15616 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APDVDVSVAGPDAALK1812.99753 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APDVDVSVAGPDAALK1812.99614 (observed)  
A532DHEBP2, SOULHeme-binding protein 2GI:9507129APEDIDPQPGSYEIR1830.90251 (observed)  
A532DHEBP2, SOULHeme-binding protein 2GI:9507129APEDIDPQPGSYEIR1830.90349 (observed)  
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3GI:124487013;GI:117553604;GI:162287349;GI:283135142;GI:247269929APEEILAEK1287.75054 (observed)  
A6465Es1Liver carboxylesterase NGI:124487013;GI:117553604;GI:162287349;GI:283135142;GI:247269929APEEILAEK1287.75054 (observed)  
A0636DNAJC5, CSPDnaJ homolog subfamily C member 5GI:7949027APEGEETEFYVSPEDLEAQLQSDER3012.37809 (observed)  
A0636DNAJC5, CSPDnaJ homolog subfamily C member 5GI:7949027APEGEETEFYVSPEDLEAQLQSDER3012.38211 (observed)  
A3867EPB41L1Band 4.1-like protein 1GI:7305029;GI:54873604APESDTGDEDQDQER1835.77422 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APEVDVQGPEWSLK1842.98528 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APEVDVQGPEWSLK1842.99187 (observed)  
A4642ALCAM, MEMDCD166 antigen precursorGI:31791059APFLETDQLK1449.82646 (observed)  
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:6680748APGIIPR867.55327 (observed)  
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:6680748APGIIPR867.55785 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562APIIAVTR984.63207 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562APIIAVTR984.63317 (observed)  
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68GI:40068493;GI:93587673;GI:40068491;GI:83816893APILIATDVASR1370.81401 (observed)  
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68GI:40068493;GI:93587673;GI:40068491;GI:83816893APILIATDVASR1370.81694 (observed)  
A6264DDX17ATP-dependent RNA helicase DDX17GI:40068493;GI:93587673;GI:40068491;GI:83816893APILIATDVASR1370.81401 (observed)  
A6264DDX17ATP-dependent RNA helicase DDX17GI:40068493;GI:93587673;GI:40068491;GI:83816893APILIATDVASR1370.81694 (observed)  
A1466FN1, FNFibronectinGI:46849812APITGYIIR1147.69328 (observed)  
A261ABTF3, NACB, BTF3bTranscription factor BTF3GI:149234234;GI:56605979APLATGEDDDDEVPDLVENFDEASK2979.39511 (observed)  
A261ABTF3, NACB, BTF3bTranscription factor BTF3GI:149234234;GI:56605979APLATGEDDDDEVPDLVENFDEASK2979.38614 (observed)  
A8971PSME1, IFI5111Proteasome activator complex subunit 1GI:6755212APLDIPVPDPVK1548.92546 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915APLNVQFSSPLPGEAVK2042.15348 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915APLNVQFSSPLPGEAVK2042.16263 (observed)  
A6071LP4947, PTD012Ester hydrolase C11ORF54GI:19526926APLVCLPVFVSK1606.93155 (observed)  
A0978PYGLGlycogen phosphorylase, liver formGI:268836255APNDFNLQDFNVGDYIQAVLDR2668.32437 (observed)  
A5842ASS1, ASSArgininosuccinate synthaseGI:6996911APNSPDVLEIEFK1746.95378 (observed)  
A5842ASS1, ASSArgininosuccinate synthaseGI:6996911APNSPDVLEIEFK1746.95598 (observed)  
A1165RANBP3, RANBP3-ARan-binding protein 3GI:83523744APPPEPGATR1136.622 (observed)  
A3191TMPRSS13, MSP, TMPRSS11Transmembrane protease, serine 13GI:111185930APPPQASPAR1136.622 (observed)  
A896BCOPECoatomer epsilon subunitGI:10946972APPVPGAVSGGSGEVDELFDVK2415.26419 (observed)  
A8957PSMC126S protease regulatory subunit 4GI:6679501APQETYADIGGLDNQIQEIK2491.29801 (observed)  
A8957PSMC126S protease regulatory subunit 4GI:6679501APQETYADIGGLDNQIQEIK2491.29636 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161APQLVGQFIAR1343.79277 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161APQLVGQFIAR1343.79265 (observed)  
A6267DDX21Nucleolar RNA helicase 2GI:72384374APQVLVLAPTR1308.8123 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765APQVSTPTLVEAAR1583.89092 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765APQVSTPTLVEAAR1583.89018 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750APQVYILPPPAEQLSR1923.08415 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750APQVYILPPPAEQLSR1923.08623 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229APSDLYQIILK1548.92961 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229APSDLYQIILK1548.92595 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APSFSVSAPQVSIPDVNVNLK2457.36911 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961APSFSVSAPQVSIPDVNVNLK2457.35625 (observed)  
A8958PSMC3, TBP126S protease regulatory subunit 6AGI:228008337APSIIFIDELDAIGTK1991.13205 (observed)  
A8958PSMC3, TBP126S protease regulatory subunit 6AGI:228008337APSIIFIDELDAIGTK1991.13956 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:21489935APSTYGGMSVTSSR1544.75298 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:21489935APSTYGGMSVTSSR1560.74846 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:21489935APSTYGGMSVTSSR1544.75237 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:21489935APSTYGGMSVTSSR1560.7498 (observed)  
A5541CRYAB, CRYA2Alpha crystallin B chainGI:6753530APSWIDTGLSEMR1606.80498 (observed)  
A5541CRYAB, CRYA2Alpha crystallin B chainGI:6753530APSWIDTGLSEMR1606.80217 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115APVPASELLDAK1498.87383 (observed)  
A0452CANXCalnexin precursorGI:6671664APVPTGEVYFADSFDR1914.93755 (observed)  
A0452CANXCalnexin precursorGI:6671664APVPTGEVYFADSFDR1914.93889 (observed)  
A9766ACIN1, ACINUSApoptotic chromatin condensation inducer 1GI:194394197;GI:146231985APVVLQPEQIVSEEETPPPLLTK2802.58591 (observed)  
A9766ACIN1, ACINUSApoptotic chromatin condensation inducer 1GI:194394197;GI:146231985APVVLQPEQIVSEEETPPPLLTK2802.58445 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQAEAQQPVFNTLR1716.91509 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQAEAQQPVFNTLR1716.9196 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQAELEAQELQR1529.8024 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQAELEAQELQR1529.80364 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AQAELESVSTALSEAESK2138.11186 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026AQAELESVSTALSEAESK2138.11429 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674AQALAIETEAELER1687.90166 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674AQALAIETEAELER1687.90337 (observed)  
A2114SEC31A, SEC31L1, HSPC275Protein transport protein Sec31AGI:244791271AQDGSSPLSLQDLIEK1989.07523 (observed)  
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitGI:6753322AQDIEAGDGTTSVVIIAGSLLDSCTK2898.47293 (observed)  
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitGI:6753322AQDIEAGDGTTSVVIIAGSLLDSCTK2898.46982 (observed)  
A707DLZTFL1Leucine zipper transcription factor-like 1GI:82998566;GI:15277319AQDLDDLENTVATLR1817.94267 (observed)  
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorGI:31982520AQDTAELFFEDVR1684.83403 (observed)  
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorGI:31982520AQDTAELFFEDVR1684.83257 (observed)  
A2439CENPV, PRR6, p30Centromere protein VGI:225703070AQEAAAEEPPPAVTPAASVSALDLGEQR2919.4874 (observed)  
A2439CENPV, PRR6, p30Centromere protein VGI:225703070AQEAAAEEPPPAVTPAASVSALDLGEQR2919.48667 (observed)  
A0097TLN1, TLNTalin 1GI:227116327AQEACGPLEMDSALSVVQNLEK2666.31992 (observed)  
A5073PPLPeriplakinGI:112421039AQEDEVLQLR1344.72551 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264AQEDL719.37134 (observed)  
A224AACTR8, ARP8, INO80NActin-related protein 8GI:188528622AQEFLQHRILNK1786.98491 (observed)  
A5224TPM4Tropomyosin alpha 4 chainGI:47894398AQEQLATALQNLEEAEK2174.16373 (observed)  
A5224TPM4Tropomyosin alpha 4 chainGI:47894398AQEQLATALQNLEEAEK2174.16245 (observed)  
A055BStat2, STAT2Signal transducer and activator of transcription 2GI:9910572AQEVQPPPAPEAVVESQQLEIENR2802.44583 (observed)  
A9865DIABLO, SMACDiablo homolog, mitochondrialGI:85677504AQEVSDEGADQEEEAYLRED2427.0584 (observed)  
A9865DIABLO, SMACDiablo homolog, mitochondrialGI:85677504AQEVSDEGADQEEEAYLRED2427.05376 (observed)  
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:162461907AQFEGIVTDLIK1621.94327 (observed)  
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:162461907AQFEGIVTDLIK1621.93906 (observed)  
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:29789289AQFGQPEILLGTIPGAGGTQR2255.23174 (observed)  
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:29789289AQFGQPEILLGTIPGAGGTQR2255.22734 (observed)  
A3952SFXN3Sideroflexin 3GI:16716499AQIQAQNPSIDVVYYNK2239.20188 (observed)  
A3952SFXN3Sideroflexin 3GI:16716499AQIQAQNPSIDVVYYNK2239.19767 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915AQITNPSGASTECFVK1986.98113 (observed)  
A319CRAB25, CATX8, CATX-8Ras-related protein Rab-25GI:31980838AQIWDTAGLER1403.74187 (observed)  
A319CRAB25, CATX8, CATX-8Ras-related protein Rab-25GI:31980838AQIWDTAGLER1403.73992 (observed)  
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:31980840;GI:6679583AQIWDTAGQER1418.71745 (observed)  
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:31980840;GI:6679583AQIWDTAGQER1418.71636 (observed)  
A6564GALNT4, POC1B-GALNT4, GALNAC-T4Polypeptide N-acetylgalactosaminyltransferase 4GI:7657112AQLETYISNLER1580.84136 (observed)  
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14GI:84452155;GI:31560313AQLFALTGVQPAR1515.87822 (observed)  
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14GI:84452155;GI:31560313AQLFALTGVQPAR1515.87761 (observed)  
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitGI:6753324AQLGVQAFADALLIIPK2056.24051 (observed)  
A4795EVPLEnvoplakinGI:111185907AQLNELVNTNGR1473.778 (observed)  
A4795EVPLEnvoplakinGI:111185907AQLNELVNTNGR1473.7791 (observed)  
A0098VCLVinculinGI:31543942AQMQEAMTQEVSDVFSDTTTPIK2845.39066 (observed)  
A0098VCLVinculinGI:31543942AQMQEAMTQEVSDVFSDTTTPIK2845.38352 (observed)  
A1374LMNA, LMN1Lamin A/CGI:9506843;GI:162287370;GI:161760667AQNTWGCGSSLR1469.67534 (observed)  
A1374LMNA, LMN1Lamin A/CGI:9506843;GI:162287370;GI:161760667AQNTWGCGSSLR1469.67485 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142AQPSASLGVGYR1349.72978 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142AQPSVSLGAAYR1363.74626 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142AQPSVSLGAPYR1389.76311 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142AQPSVSLGAPYR1389.75932 (observed)  
A1761CBFBCore-binding factor, beta subunitGI:238814331;GI:238814333;GI:238814337AQQEDALAQQAFEEAR1948.9467 (observed)  
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5GI:169234940AQQEVLQALEPQVDYLR2144.15641 (observed)  
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:33563252;GI:167555029AQQIQALQSNVR1499.84294 (observed)  
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:33563252;GI:167555029AQQIQALQSNVR1499.84294 (observed)  
A0098VCLVinculinGI:31543942AQQVSQGLDVLTAK1746.0064 (observed)  
A0380ATP5DATP synthase delta chain, mitochondrial precursorGI:166851828AQSELSGAADEAAR1519.74919 (observed)  
A0380ATP5DATP synthase delta chain, mitochondrial precursorGI:166851828AQSELSGAADEAAR1519.74907 (observed)  
A5119SCELSciellinGI:70909345AQSLESLIYMNTQTDR2013.99944 (observed)  
A5119SCELSciellinGI:70909345AQSLESLIYMNTQTDR2014.00627 (observed)  
A5631AACS, ACSF1, SUR5Acetoacetyl-CoA synthetaseGI:21313520AQSYEYVYR1322.65422 (observed)  
A3526SEPT10, SEP10Septin 10GI:226442740;GI:67906175AQTYELQESNVR1581.80303 (observed)  
A1481HINT1, HINT, PKCI1Histidine triad nucleotide-binding protein 1GI:33468857AQVAQPGGDTIFGK1676.92156 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQVEQELTTLR1431.7946 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115AQVEQELTTLR1431.79375 (observed)  
A5139SPON1, VSGPSpondin-1 precursorGI:21704174AQWPAWQPVNVR1595.85869 (observed)  
A3862KRT80, KB20Keratin B20GI:124249090AQYDAIAAR1122.60369 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:122425580;GI:118130981AQYEAMAEQNR1454.68498 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:122425580;GI:118130981AQYEAMAEQNR1454.68201 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:122425580;GI:118130981AQYEAMAEQNR1470.68279 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:122425580;GI:118130981AQYEAMAEQNR1471.66387 (observed)  
A3825KRT24, KA24Keratin, type I cytoskeletal 24GI:122425580;GI:118130981AQYEAMAEQNR1454.68498 (observed)  
A3825KRT24, KA24Keratin, type I cytoskeletal 24GI:122425580;GI:118130981AQYEAMAEQNR1454.68201 (observed)  
A3825KRT24, KA24Keratin, type I cytoskeletal 24GI:122425580;GI:118130981AQYEAMAEQNR1470.68279 (observed)  
A3825KRT24, KA24Keratin, type I cytoskeletal 24GI:122425580;GI:118130981AQYEAMAEQNR1471.66387 (observed)  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.61414 (observed)  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.6187 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.61414 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.6187 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.61414 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.6187 (observed)  
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.61414 (observed)  
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75GI:29789317;GI:20911031;GI:114145561;GI:269914154AQYEDIANR1223.6187 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:54607171;GI:113195684AQYEDIAQR1237.63086 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:54607171;GI:113195684AQYEDIAQR1237.63037 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171;GI:113195684AQYEDIAQR1237.63086 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:54607171;GI:113195684AQYEDIAQR1237.63037 (observed)  
A0660ACTR1A, CTRN1Alpha-centractinGI:8392847AQYYLPDGSTIEIGPSR2011.0269 (observed)  
A0660ACTR1A, CTRN1Alpha-centractinGI:8392847AQYYLPDGSTIEIGPSR2011.02397 (observed)  
A397EPrLZ, TPD52, PC-1Prostate and colon associated proteinGI:70608194;GI:70608205;GI:70608198;GI:6678407;GI:70608214ASAAFSSVGSVITK1612.91965 (observed)  
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:6754036ASAELALGENNEVLK1846.02298 (observed)  
A4709COL14A1, UNDCollagen alpha-1(XIV) chain precursorGI:226423922ASALATIGPPTELITSEVTAR2242.25241 (observed)  
A4709COL14A1, UNDCollagen alpha-1(XIV) chain precursorGI:226423922ASALATIGPPTELITSEVTAR2242.25022 (observed)  
A4394TBCD, SSD1, TFCDBeta-tubulin cofactor DGI:28077067ASALEAFGESAETR1582.7813 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589ASAPATPLSPTR1312.7354 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589ASAPATPLSPTR1312.73577 (observed)  
A523EAAK1Conserved hypothetical proteinGI:149255330ASDDLGEPDVFATAPFR1951.95561 (observed)  
A523EAAK1Conserved hypothetical proteinGI:149255330ASDDLGEPDVFATAPFR1951.94963 (observed)  
A230ERCN1, RCNReticulocalbin 1 precursorGI:6677691ASDLDGDLTATR1378.69365 (observed)  
A230ERCN1, RCNReticulocalbin 1 precursorGI:6677691ASDLDGDLTATR1378.6939 (observed)  
A7941WARS, IFI53, WRSTryptophanyl-tRNA synthetase, cytoplasmicGI:256818802;GI:256818806ASEDFVDPWTVR1565.77544 (observed)  
A7941WARS, IFI53, WRSTryptophanyl-tRNA synthetase, cytoplasmicGI:256818802;GI:256818806ASEDFVDPWTVR1565.77019 (observed)  
A0658DCTN1Dynactin 1GI:118601017ASEQIYGSPSSSPYECLR2163.98052 (observed)  
A0658DCTN1Dynactin 1GI:118601017ASEQIYGSPSSSPYECLR2163.98125 (observed)  
A1552APOA1, A175PApolipoprotein A-I precursorGI:160333304ASETLTAQ964.50817 (observed)  
A1552APOA1, A175PApolipoprotein A-I precursorGI:160333304ASETLTAQ964.50817 (observed)  
A222CNECAP2Adaptin EAR-binding coat-associated protein 2GI:13384758ASEWQLDQPSWSGR1790.85845 (observed)  
A222CNECAP2Adaptin EAR-binding coat-associated protein 2GI:13384758ASEWQLDQPSWSGR1790.86284 (observed)  
A6662GCLC, GLCL, GLCLCGlutamate-cysteine ligase catalytic subunitGI:33468897ASGELMTVAR1178.63347 (observed)  
A1276CLU, APOJ, CLIClusterin precursorGI:149266012;GI:214010170ASGIIDTLFQDR1479.79741 (observed)  
A1276CLU, APOJ, CLIClusterin precursorGI:149266012;GI:214010170ASGIIDTLFQDR1479.79753 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376ASGPGLNTTGVPASLPVEFTIDAK2630.43875 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376ASGPGLNTTGVPASLPVEFTIDAK2630.43546 (observed)  
A470AHIST1H1C, H1F2Histone H1.2GI:9845257;GI:254588110ASGPPVSELITK1486.87395 (observed)  
A470AHIST1H1C, H1F2Histone H1.2GI:9845257;GI:254588110ASGPPVSELITK1486.87676 (observed)  
A5161STMN1, LAP18, OP18StathminGI:149252580;GI:9789995ASGQAFELILSPR1532.85893 (observed)  
A5161STMN1, LAP18, OP18StathminGI:149252580;GI:9789995ASGQAFELILSPR1532.85698 (observed)  
A3515SEPT2, DIFF6, NEDD5Septin-2GI:6754816;GI:228480253ASIPFSVVGSNQLIEAK2048.16849 (observed)  
A3515SEPT2, DIFF6, NEDD5Septin-2GI:6754816;GI:228480253ASIPFSVVGSNQLIEAK2048.16153 (observed)  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8GI:114145561ASLEAAIADAEQR1488.78264 (observed)  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8GI:114145561ASLEAAIADAEQR1488.7824 (observed)  
A5008NID2Nidogen-2GI:84370361ASLEAGAEPETIITSGLISPEGLAIDHFR3138.6511 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961ASLGSLEGEVEAEASSPK2049.06498 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961ASLGSLEGEVEAEASSPK2049.06182 (observed)  
A6328DHX36, DDX36, MLEL1Probable ATP-dependent RNA helicase DHX36GI:240848573ASLLDDYQLPEILR1789.9887 (observed)  
A1037NUP98, ADAR2, NUP98/HOXC13Nuclear pore complex protein Nup98-Nup96GI:39930413ASLLVDEEDVDAMDQR1949.93291 (observed)  
A558AHNRNPL, HNRPLHeterogeneous nuclear ribonucleoprotein LGI:183980004ASLNGADIYSGCCTLK1996.90801 (observed)  
A558AHNRNPL, HNRPLHeterogeneous nuclear ribonucleoprotein LGI:183980004ASLNGADIYSGCCTLK1996.90581 (observed)  
A6483FAHFumarylacetoacetaseGI:240120112ASLQNLLSASQAR1502.84514 (observed)  
A6483FAHFumarylacetoacetaseGI:240120112ASLQNLLSASQAR1502.8427 (observed)  
A652ALRRFIP1, GCF2, TRIPLeucine-rich repeat Flightless-interacting protein 1GI:162417949ASNSPEQSSCLEGLDSEVPGPTEDLK3023.40854 (observed)  
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 1GI:110626031ASPATQPPPLLPPSTPGPDATVVGSAPTPLLPPSATAAVK4057.25942 (observed)  
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmicGI:261878543ASQAPSSFQLLYDLK1956.0756 (observed)  
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmicGI:261878543ASQAPSSFQLLYDLK1956.07541 (observed)  
A493AH2AFX, H2AXHistone H2A.xGI:7106331ASQASQEY1027.48235 (observed)  
A493AH2AFX, H2AXHistone H2A.xGI:7106331ASQASQEY1027.48247 (observed)  
A4407UNC45A, SMAP1, SMAP-1BSMAP-1a/bGI:227908790ASQNLVVLAR1214.73479 (observed)  
A4363PFDN2, PFD2, HSPC231Prefoldin subunit 2GI:31981577ASSAGVLVS934.53302 (observed)  
A4363PFDN2, PFD2, HSPC231Prefoldin subunit 2GI:31981577ASSAGVLVS934.53638 (observed)  
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorGI:282398108ASSFVLALEPELESR1791.96623 (observed)  
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorGI:282398108ASSFVLALEPELESR1791.96428 (observed)  
A6483FAHFumarylacetoacetaseGI:240120112ASSIVVSGTPIR1330.78093 (observed)  
A605D Hypothetical proteinGI:75677516ASSLAASESPASALPTGIPEAEPR2453.27542 (observed)  
A8906NSFL1C, UBXN2CNSFL1 cofactor P47GI:38198665ASSSILINEAEPTTNIQIR2201.19321 (observed)  
A8906NSFL1C, UBXN2CNSFL1 cofactor P47GI:38198665ASSSILINEAEPTTNIQIR2201.19468 (observed)  
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorGI:31982522ASSTANLIFEDCR1616.75383 (observed)  
A9977LRBA, BGL, CDC4LLipopolysaccharide-responsive and beige-like anchor proteinGI:117956399;GI:117956395;GI:117956397ASTSTEAPQPQR1416.72209 (observed)  
A0097TLN1, TLNTalin 1GI:227116327ASVPTIQDQASAMQLSQCAK2411.21189 (observed)  
A5177TNKS1BP1, TAB182182 kDa tankyrase 1-binding proteinGI:124486923ASVSTNQDTDENDQELGMK2370.10288 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ASVTVLGDILGSAMQNTQDLLK2562.40848 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ASVTVLGDILGSAMQNTQDLLK2563.3956 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ASVTVLGDILGSAMQNTQDLLK2578.40641 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ASVTVLGDILGSAMQNTQDLLK2578.40549 (observed)  
A6403EBP3-beta-hydroxysteroid-delta(8),delta(7)-isomeraseGI:6681255ASVVPLGAGR1070.64299 (observed)  
A6403EBP3-beta-hydroxysteroid-delta(8),delta(7)-isomeraseGI:6681255ASVVPLGAGR1070.64543 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917ASVVTLPVYLNFTR1723.99101 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917ASVVTLPVYLNFTR1723.98943 (observed)  
A6934LYPLAL1Lysophospholipase-like 1GI:227496223ASVVYQDLQQGGR1564.82341 (observed)  
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:12963591ASYGVEDPEYAVTQLAQTTMR2474.2139 (observed)  
A6306DAKBifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)GI:21703976ASYISSAQLDQPDPGAVAAAAIFR2563.335 (observed)  
A6306DAKBifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)GI:21703976ASYISSAQLDQPDPGAVAAAAIFR2563.33554 (observed)  
A1810DCN, SLRR1BDecorin precursorGI:6681143ASYSAVSLYGNPVR1627.85723 (observed)  
A1810DCN, SLRR1BDecorin precursorGI:6681143ASYSAVSLYGNPVR1627.8571 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142ASYVAPLTAQPATYR1752.93901 (observed)  
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14GI:86262142ASYVAPLTAQPATYR1752.94072 (observed)  
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorGI:153791270ATAESASECLPCDCNGR2009.73209 (observed)  
A7533PSMB8, LMP7, PSMB5iProteasome (prosome, macropain) subunit beta type 8 precursorGI:158303322ATAGSYISSLR1269.69231 (observed)  
A7533PSMB8, LMP7, PSMB5iProteasome (prosome, macropain) subunit beta type 8 precursorGI:158303322ATAGSYISSLR1269.6917 (observed)  
A6317DHRS1Dehydrogenase/reductase SDR family member 1GI:31980844ATAQEAQSLGGR1332.70122 (observed)  
A3526SEPT10, SEP10Septin 10GI:226442740;GI:67906175ATCELFPNQSFLASGSSIR2218.07938 (observed)  
A3567PSMA4, HC9, PSC9Proteasome subunit alpha type 4GI:6755196ATCIGNNSAAAVSMLK1884.95757 (observed)  
A3567PSMA4, HC9, PSC9Proteasome subunit alpha type 4GI:6755196ATCIGNNSAAAVSMLK1884.96183 (observed)  
A3965TPM1, TMSATropomyosin 1 alpha chainGI:31560030;GI:11875203;GI:256000780;GI:256000786;GI:256000794;GI:25600784ATDAEADVASLNR1476.74199 (observed)  
A3965TPM1, TMSATropomyosin 1 alpha chainGI:31560030;GI:11875203ATDAEADVASLNR1476.73857 (observed)  
A5222TPM2, TMSB, TPM2bTropomyosin beta chainGI:31560030;GI:11875203;GI:256000780;GI:256000786;GI:256000794;GI:25600784ATDAEADVASLNR1476.74199 (observed)  
A5222TPM2, TMSB, TPM2bTropomyosin beta chainGI:31560030;GI:11875203ATDAEADVASLNR1476.73857 (observed)  
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6755114ATDLLLDDSLVSLFGNR1993.075 (observed)  
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6755114ATDLLLDDSLVSLFGNR1993.07536 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393ATEIGGILVNTPEDPNLSK2256.2338 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393ATEIGGILVNTPEDPNLSK2256.23618 (observed)  
A887APTRF, FKSG13Polymerase I and transcript release factorGI:6679567ATEMVEVGPEDDEVGAER2076.95659 (observed)  
A887APTRF, FKSG13Polymerase I and transcript release factorGI:6679567ATEMVEVGPEDDEVGAER2092.94913 (observed)  
A887APTRF, FKSG13Polymerase I and transcript release factorGI:6679567ATEMVEVGPEDDEVGAER2076.95268 (observed)  
A552AHNRNPH2, FTP3, HNRPH2Heterogeneous nuclear ribonucleoprotein H2GI:9845253ATENDIYNFFSPLNPMR2173.05246 (observed)  
A552AHNRNPH2, FTP3, HNRPH2Heterogeneous nuclear ribonucleoprotein H2GI:9845253ATENDIYNFFSPLNPMR2173.0607 (observed)  
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HGI:19527048;GI:10946928ATENDIYNFFSPLNPVR2141.07988 (observed)  
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HGI:19527048;GI:10946928ATENDIYNFFSPLNPVR2141.08037 (observed)  
A557AHNRNPF, HNRPFHeterogeneous nuclear ribonucleoprotein FGI:19527048;GI:10946928ATENDIYNFFSPLNPVR2141.07988 (observed)  
A557AHNRNPF, HNRPFHeterogeneous nuclear ribonucleoprotein FGI:19527048;GI:10946928ATENDIYNFFSPLNPVR2141.08037 (observed)  
A4559SCINAdseverinGI:226246550;GI:226246552ATEVPLSWESFNK1795.95183 (observed)  
A4559SCINAdseverinGI:226246550;GI:226246552ATEVPLSWESFNK1795.94583 (observed)  
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseGI:68226731ATFDISLVVPK1477.89067 (observed)  
A665DLMO7, FBX20, FBXO20LIM domain only protein 7GI:157311641ATFSSMSGLDSVSDSGEGR2033.92229 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966ATFSSVPR1008.55858 (observed)  
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1GI:242332572ATFYGEQVDYYK1771.88677 (observed)  
A909ARBM12, CPNE1, SWANRNA-binding protein 12GI:114155125ATGEGFVEFR1256.64189 (observed)  
A473AHIST1H1B, H1F5Histone H1.5GI:21426893ATGPPVSELITK1500.89165 (observed)  
A473AHIST1H1B, H1F5Histone H1.5GI:21426893ATGPPVSELITK1500.88542 (observed)  
A1466FN1, FNFibronectinGI:46849812ATGVFTTLQPLR1447.84136 (observed)  
A1466FN1, FNFibronectinGI:46849812ATGVFTTLQPLR1447.83891 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328702;GI:194328706;GI:18700026;GI:194328708ATGVSAEDADPR1332.65312 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522ATIDPETGLLFLSLSK1993.15573 (observed)  
A0324JUP, CTNNG, DP3Junction plakoglobinGI:28395018ATIGLIR887.57878 (observed)  
A0252AP2A2, ADTAB, CLAPA2Adapter-related protein complex 2 alpha 2 subunitGI:163644277ATIQDVLR1059.62834 (observed)  
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BGI:30794432ATISDEEIER1306.66423 (observed)  
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BGI:30794432ATISDEEIER1306.66155 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086ATLEAESR1020.54753 (observed)  
A7831SLK, STK2, HSLKCTCL tumor antigen se20-9GI:257467552;GI:257467554ATLEQPETDEVEQVSESNSIEELER3005.41605 (observed)  
A5809PRMT1, HRMT1L2, HMT2Protein arginine N-methyltransferase 1GI:9790109ATLYVTAIEDR1395.76079 (observed)  
A5809PRMT1, HRMT1L2, HMT2Protein arginine N-methyltransferase 1GI:9790109ATLYVTAIEDR1395.75932 (observed)  
A1670COL4A2Collagen alpha 2(IV) chain precursorGI:226437587ATPFIECNGGR1355.62102 (observed)  
A1670COL4A2Collagen alpha 2(IV) chain precursorGI:226437587ATPFIECNGGR1355.62004 (observed)  
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IGI:21450625;GI:149270417;GI:22682339ATQALVLAPTR1284.77812 (observed)  
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IGI:21450625;GI:149270417;GI:226823309ATQALVLAPTR1284.78179 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2395.19455 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2395.19345 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2379.19707 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2379.18413 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2395.19455 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2395.19345 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2379.19707 (observed)  
A4048MYL12B, MRLC2, MYLC2BMyosin regulatory light chain 12BGI:21728376;GI:71037403;GI:198278553ATSNVFAMFDQSQIQEFK2379.18413 (observed)  
A3927PICALM, CALMPhosphatidylinositol-binding clathrin assembly proteinGI:32567788ATTLSNAVSSLASTGLSLTK2210.25418 (observed)  
A3927PICALM, CALMPhosphatidylinositol-binding clathrin assembly proteinGI:32567788ATTLSNAVSSLASTGLSLTK2210.26004 (observed)  
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:12963591ATVLESEGTR1206.64202 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ATVLNYLQTCIR1584.84184 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039ATVLNYLQTCIR1584.84062 (observed)  
A2117PRPF19, NMP200, PRP19Pre-mRNA-processing factor 19GI:19527358ATVLTTER1034.59599 (observed)  
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:160358825ATVLYQGMR1182.64519 (observed)  
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1GI:189409138AVAALLTIPEAEK1613.9802 (observed)  
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1GI:189409138AVAALLTIPEAEK1613.97539 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:162287140;GI:6755781AVAEPGIQLK1313.80913 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:162287140;GI:6755781AVAEPGIQLK1313.81426 (observed)  
A0097TLN1, TLNTalin 1GI:227116327AVAEQIPLLVQGVR1636.99016 (observed)  
A0097TLN1, TLNTalin 1GI:227116327AVAEQIPLLVQGVR1636.98638 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277AVAGDASESALLK1519.86113 (observed)  
A5647ABHD14B, CIBAlpha/beta hydrolase domain-containing protein 14BGI:171460960AVAIDLPGLGR1225.73955 (observed)  
A8957PSMC126S protease regulatory subunit 4GI:6679501AVANQTSATFLR1422.78533 (observed)  
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitGI:6753320AVAQALEVIPR1310.79302 (observed)  
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitGI:6753320AVAQALEVIPR1310.79265 (observed)  
A5233THBS3, TSP3Thrombospondin 3 precursorGI:239915968AVAQPGLQLK1313.80913 (observed)  
A5233THBS3, TSP3Thrombospondin 3 precursorGI:239915968AVAQPGLQLK1313.81426 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393AVASLNTPFMPPDPDVSPMK2402.24045 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393AVASLNTPFMPPDPDVSPMK2402.23642 (observed)  
A8956PSMC6, SUG226S protease regulatory subunit S10BGI:27754103AVASQLDCNFLK1642.85552 (observed)  
A3566PSMD14, POH126S proteasome non-ATPase regulatory subunit 14GI:145966883AVAVVVDPIQSVK1612.99455 (observed)  
A3566PSMD14, POH126S proteasome non-ATPase regulatory subunit 14GI:145966883AVAVVVDPIQSVK1612.9876 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97771 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97185 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97782 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97002 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97771 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97185 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97782 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97002 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97771 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97185 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97782 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97002 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97771 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97185 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR1997.97782 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6755901;GI:34740335;GI:6678465;GI:6678467;GI:51765047;GI:82930560;GI:8394493;GI:6678469AVCMLSNTTAIAEAWAR2013.97002 (observed)  
A3812RPL860S ribosomal protein L8GI:6755358AVDFAER951.50347 (observed)  
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6GI:82880886;GI:149261044;GI:149270558;GI:149270560;GI:149274983;GI:84662736AVDLQILPK1284.80657 (observed)  
A7159NIT2, CUA002Omega-amidase NIT2GI:12963555AVDNQVYVATASPAR1705.90117 (observed)  
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50GI:6755566AVDPDSPAEASGLR1528.77275 (observed)  
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:6680748AVDSLVPIGR1170.69829 (observed)  
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:6680748AVDSLVPIGR1170.69829 (observed)  
A4784EMILIN1, EMIEMILIN 1 precursorGI:19527130AVDTVFNGR1123.58391 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845AVDVFFPPEAQNDFPVAMQISEK2867.45469 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845AVDVFFPPEAQNDFPVAMQISEK2867.4567 (observed)  
A330CRAB5C, RABLRas-related protein Rab-5CGI:113866024AVEFQEAQAYADDNSLLFMETSAK2966.44498 (observed)  
A0097TLN1, TLNTalin 1GI:227116327AVEGCVSASQAATEDGQLLR2195.05844 (observed)  
A1950GSTA3Glutathione S-transferase A3-3GI:6680117AVEHADGGVAAGVAVLDNPYPV2265.16733 (observed)  
A3679PMPCB, MPPBMitochondrial processing peptidase beta subunit, mitochondrial precursorGI:95113671AVEILADIIQNSTLGEAEIER2428.31467 (observed)  
A7989TKT, TKT1TransketolaseGI:6678359AVELAANTK1204.70781 (observed)  
A7989TKT, TKT1TransketolaseGI:6678359AVELAANTK1204.72515 (observed)  
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3GI:261824000AVENSSTAIGIR1361.75176 (observed)  
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3GI:261824000AVENSSTAIGIR1361.75237 (observed)  
A032APDCD5, TFAR19Programmed cell death protein 5GI:149246587AVENYLIQMAR1451.78398 (observed)  
A032APDCD5, TFAR19Programmed cell death protein 5GI:149246587AVENYLIQMAR1451.77849 (observed)  
A6915LOXL1, LOXLLysyl oxidase homolog 1 precursorGI:45598390AVEPQPPFR1184.65398 (observed)  
A447DFAM92BProtein FAM92BGI:283806727AVEVYSSAFQTLENYDLER2379.16587 (observed)  
A4202RAD23BUV excision repair protein RAD23 homolog BGI:171906578AVEYLLMGIPGDR1577.85344 (observed)  
A4202RAD23BUV excision repair protein RAD23 homolog BGI:171906578AVEYLLMGIPGDR1593.84661 (observed)  
A4202RAD23BUV excision repair protein RAD23 homolog BGI:171906578AVEYLLMGIPGDR1577.85076 (observed)  
A4202RAD23BUV excision repair protein RAD23 homolog BGI:171906578AVEYLLMGIPGDR1593.84563 (observed)  
A7908AARSAlanyl-tRNA synthetaseGI:34610207AVFDETYPDPVR1552.77764 (observed)  
A7908AARSAlanyl-tRNA synthetaseGI:34610207AVFDETYPDPVR1552.7758 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674AVFPQNGLVVSSVDVQSVEPVDQR2714.42026 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674AVFPQNGLVVSSVDVQSVEPVDQR2714.42136 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277AVFQANQENLPILK1873.08977 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277AVFQANQENLPILK1873.08513 (observed)  
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseGI:31981273AVFQYIDENQDR1641.80254 (observed)  
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseGI:31981273AVFQYIDENQDR1641.79802 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6678467AVFVDLEPTVIDEIR1860.03349 (observed)  
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:6678467AVFVDLEPTVIDEIR1860.02983 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01152 (observed)  
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01384 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01152 (observed)  
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01384 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01152 (observed)  
A5180TUBA1C, TUBA6Tubulin alpha-1C chainGI:6755901;GI:34740335;GI:51765047;GI:82930560;GI:6678469AVFVDLEPTVIDEVR1846.01384 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161AVGDGILCNTYIDSYK2066.01798 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161AVGDGILCNTYIDSYK2066.02073 (observed)  
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1GI:164698474;GI:84370256AVGPSSTQLYMVR1552.83196 (observed)  
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1GI:164698474;GI:84370256AVGPSSTQLYMVR1552.82854 (observed)  
A8028TRIM25, EFP, RNF147Zinc finger protein 147GI:145207948AVIDAAETSSLR1376.75261 (observed)  
A8028TRIM25, EFP, RNF147Zinc finger protein 147GI:145207948AVIDAAETSSLR1376.7509 (observed)  
A4750DSTN, ACTDP, DSNDestrinGI:9790219AVIFCLSADK1400.75676 (observed)  
A4750DSTN, ACTDP, DSNDestrinGI:9790219AVIFCLSADK1400.74895 (observed)  
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1GI:110347487AVLAESYER1181.62407 (observed)  
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1GI:18875380;GI:45592934AVLCPPPVK1257.72588 (observed)  
A8492Serpina3kSerine protease inhibitor A3KGI:148747546AVLDVAETGTEAAAATGVIGGIR2286.24932 (observed)  
A8492Serpina3kSerine protease inhibitor A3KGI:148747546AVLDVAETGTEAAAATGVIGGIR2286.24687 (observed)  
A8494Serpina3nSerine protease inhibitor A3NGI:124517726;GI:130503301;GI:149263620AVLDVAETGTEAAAATGVK2062.13028 (observed)  
A8494Serpina3nSerine protease inhibitor A3NGI:124517726;GI:130503301;GI:149263620AVLDVAETGTEAAAATGVK2062.13596 (observed)  
A4152MAT2B, TGR, MSTP045Methionine adenosyltransferase 2 subunit betaGI:19527234AVLENNLGAAVLR1483.87224 (observed)  
A0015DLG1, SAP97Disks large homolog 1GI:149267866;GI:149267868;GI:149267870;GI:149267872AVLGDDEITR1232.66313 (observed)  
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 2GI:255069795AVLGEVALYSGAR1449.82073 (observed)  
A1492COL1A2Collagen alpha 2(I) chain precursorGI:111120329AVLLQGSNDVELVAEGNSR2115.11936 (observed)  
A1492COL1A2Collagen alpha 2(I) chain precursorGI:111120329AVLLQGSNDVELVAEGNSR2115.12174 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047AVLLSSDLQAEEWNCLR2137.05962 (observed)  
A3945SEC23AProtein transport protein Sec23AGI:67906177AVLNPLCQVDYR1580.80339 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1745.9251 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1745.92681 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1761.92009 (observed)  
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1761.92119 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1745.9251 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1745.92681 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1761.92009 (observed)  
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainGI:31981939;GI:22165384AVLVDLEPGTMDSVR1761.92119 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889AVNEECPTITR1422.6845 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889AVNEECPTITR1422.68437 (observed)  
A5800CD13, ANPEP, APNAminopeptidase NGI:225637487AVNQQTAVQPPATVR1723.96013 (observed)  
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1GI:31560656AVNSATGVPTV1159.64617 (observed)  
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1GI:31560656AVNSATGVPTV1159.64446 (observed)  
A520CSNX2, TRG9Sorting nexin 2GI:13385878AVNTQALSGAGILR1514.87859 (observed)  
A520CSNX2, TRG9Sorting nexin 2GI:13385878AVNTQALSGAGILR1514.87712 (observed)  
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 2GI:19882201AVPLALALISVSNPR1665.02176 (observed)  
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 2GI:19882201AVPLALALISVSNPR1665.0225 (observed)  
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6GI:82880886;GI:149261044;GI:94405982;GI:149270558;GI:149270560;GI:84662736AVPQLQGYLR1288.74956 (observed)  
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6GI:82880886;GI:149261044;GI:94405982;GI:149270558;GI:149270560;GI:84662736AVPQLQGYLR1288.74993 (observed)  
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:31980840;GI:6679583AVPTDEAR1002.54564 (observed)  
A7349PDXDC1Pyridoxal-dependent decarboxylase domain-containing protein 1GI:88758582;GI:88758584AVPVSNIAPAAVGR1465.86101 (observed)  
A7349PDXDC1Pyridoxal-dependent decarboxylase domain-containing protein 1GI:88758582;GI:88758584AVPVSNIAPAAVGR1465.86003 (observed)  
A4313DNAJC7, TPR2, TTC2DNAJ (HSP40) homolog, subfamily C, member 7GI:31980994AVQFFVQALR1322.77458 (observed)  
A031BSNRPAU1 small nuclear ribonucleoprotein AGI:149263421;GI:114052541AVQGGAAAPVVGAVQPVPGMPPMPQAPR2794.50144 (observed)  
A031BSNRPAU1 small nuclear ribonucleoprotein AGI:149263421;GI:114052541AVQGGAAAPVVGAVQPVPGMPPMPQAPR2810.50302 (observed)  
A031BSNRPAU1 small nuclear ribonucleoprotein AGI:149263421;GI:114052541AVQGGAAAPVVGAVQPVPGMPPMPQAPR2810.50302 (observed)  
A031BSNRPAU1 small nuclear ribonucleoprotein AGI:149263421;GI:114052541AVQGGAAAPVVGAVQPVPGMPPMPQAPR2826.49143 (observed)  
A3911NAPG, SNAPGGamma-soluble NSF attachment proteinGI:110625902AVQLYQQTANVFENEER2183.08573 (observed)  
A177ATAX1BP3, TIP1, TIP-1Tax-binding protein 3GI:149249414;GI:149249416;GI:149250447;GI:149250449AVQQSMLS1023.52934 (observed)  
A6586GFPT1, GFAT, GFPTGlucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1GI:7305085AVQTLQMELQQIMK1965.08677 (observed)  
A687CVPS13CVacuolar protein sorting-associated protein 13CGI:122114537AVSILGDEVFR1349.75566 (observed)  
A028BSMARCB1, BAF47, INI1SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily B member 1GI:6755578;GI:240255565AVSISTEPPTYLR1577.86846 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802AVSSFFSGSCVPCADPVAFPK2496.16509 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802AVSSFFSGSCVPCADPVAFPK2496.16825 (observed)  
A5974CAPN5, NCL3Calpain 5GI:6680846AVTAADMEAR1178.59978 (observed)  
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1GI:124494256AVTDEEPFLIFANR1765.92998 (observed)  
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1GI:124494256AVTDEEPFLIFANR1765.93181 (observed)  
A0907YWHAQ14-3-3 protein tauGI:149263879;GI:6756039AVTEQGAELSNEER1676.8228 (observed)  
A0907YWHAQ14-3-3 protein tauGI:149263879;GI:6756039AVTEQGAELSNEER1676.82268 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AVTGYNDPETGNIISLFQAMNK2671.37711 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AVTGYNDPETGNIISLFQAMNK2687.36863 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AVTGYNDPETGNIISLFQAMNK2671.37253 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086AVTGYNDPETGNIISLFQAMNK2687.36551 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AVTGYTDPYTGDQISLFQAMQR2622.27134 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AVTGYTDPYTGDQISLFQAMQR2606.27451 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AVTGYTDPYTGDQISLFQAMQR2606.27652 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522AVTGYTDPYTGDQISLFQAMQR2622.27243 (observed)  
A050BSRRM1, SRM160Serine/arginine repeptitive matrix protein 1GI:194440682;GI:194440687AVTIATPATAAPAAVSAATTTSAQEEPAAAPEPR3334.73362 (observed)  
A050BSRRM1, SRM160Serine/arginine repeptitive matrix protein 1GI:194440682;GI:194440687AVTIATPATAAPAAVSAATTTSAQEEPAAAPEPR3334.73623 (observed)  
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitGI:6671702AVTIFIR963.61125 (observed)  
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitGI:6671702AVTIFIR963.61394 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628AVTPLYPANQADIIFDITEGNLR2675.42063 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628AVTPLYPANQADIIFDITEGNLR2675.41825 (observed)  
A0583PUF60, FIR, ROBPIPoly-U binding splicing factor PUF60GI:76677895;GI:257196186;GI:257196183AVTPPMPLLTPATPGGLPPAAAVAAAAATAK3082.7739 (observed)  
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:158937312AVTQSAEITIPVTFEAR1977.07988 (observed)  
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:158937312AVTQSAEITIPVTFEAR1977.08061 (observed)  
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorGI:282398108AVTSEIAVLQSR1417.81413 (observed)  
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorGI:282398108AVTSEIAVLQSR1417.81597 (observed)  
A3812RPL860S ribosomal protein L8GI:6755358AVVGVVAGGGR1085.65618 (observed)  
A3812RPL860S ribosomal protein L8GI:6755358AVVGVVAGGGR1085.65495 (observed)  
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richGI:149252953;GI:23956214;GI:255958247AVVIVDDR1030.59892 (observed)  
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richGI:149252953;GI:23956214AVVIVDDR1030.60137 (observed)  
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinGI:149252953;GI:23956214;GI:255958247AVVIVDDR1030.59892 (observed)  
A6045CTHCystathionine gamma-lyaseGI:22122387AVVLPISLATTFK1648.03617 (observed)  
A6045CTHCystathionine gamma-lyaseGI:22122387AVVLPISLATTFK1648.03708 (observed)  
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformGI:19705578AVVQVFEGTSGIDAK1809.0029 (observed)  
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformGI:19705578AVVQVFEGTSGIDAK1809.00235 (observed)  
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16GI:21312760AVVVLVENFYK1568.93694 (observed)  
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16GI:21312760AVVVLVENFYK1568.93193 (observed)  
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:21312994AVVVNAAQLASYSQSK1924.07195 (observed)  
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitGI:94410730;GI:41054806AVVYSNTIQSIMAIVK2025.17319 (observed)  
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitGI:94410730;GI:41054806AVVYSNTIQSIMAIVK2025.16899 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374AVYTVVNDPDQQFVVVTDPTTNDGILK3236.69968 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374AVYTVVNDPDQQFVVVTDPTTNDGILK3236.69272 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404AWALDIAELR1301.73638 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404AWALDIAELR1301.73735 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765;GI:8567364AWAVAR817.48338 (observed)  
A295CARL6IP5, DERP11, JWAVitamin A responsive, cytoskeleton relatedGI:14149750AWDDFFPGSDR1456.66301 (observed)  
A295CARL6IP5, DERP11, JWAVitamin A responsive, cytoskeleton relatedGI:14149750AWDDFFPGSDR1456.66252 (observed)  
A2102COPACoatomer alpha subunitGI:226823359AWEVDTCR1169.52165 (observed)  
A8505SERPINB8, PI8Cytoplasmic antiproteinase 2GI:15826848AWTNPETLTESQVQVFLPR2360.24448 (observed)  
A4323FKBP3, FKBP25FK506-binding protein 3GI:7305061AWTVEQLR1146.63945 (observed)  
A4323FKBP3, FKBP25FK506-binding protein 3GI:7305061AWTVEQLR1146.63957 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408AWVEQEGVSVK1519.8449 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408AWVEQEGVSVK1519.84368 (observed)  
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorGI:149263103;GI:16716343AYAEFYR1063.53288 (observed)  
A8163UFL1, NLBPUPF0555 protein KIAA0776GI:227330590AYDLPGDFLTQALTQR1953.02451 (observed)  
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:58037109AYDLVVDWPVTLVR1790.00383 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408AYEEDYGSTLEEDIQGDTSGYLER2884.2813 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408AYEEDYGSTLEEDIQGDTSGYLER2884.27951 (observed)  
A7989TKT, TKT1TransketolaseGI:6678359AYGLALAK1094.67668 (observed)  
A7989TKT, TKT1TransketolaseGI:6678359AYGLALAK1094.69219 (observed)  
A0204FLNA, FLN, FLN1Filamin AGI:125347376AYGPGIEPTGNMVK1721.91631 (observed)  
A7912DARS, PIG40Aspartyl-tRNA synthetaseGI:211065507AYIDSFR1015.5349 (observed)  
A9035RTN4, NOGOC, NOGOReticulon 4GI:34610241;GI:34610235;GI:34610233;GI:34610237;GI:13195648AYLESEVAISEELVQK2096.14872 (observed)  
A9035RTN4, NOGOC, NOGOReticulon 4GI:34610237;GI:34610241;GI:13195648;GI:34610235;GI:34610233AYLESEVAISEELVQK2096.14524 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482AYLPVNESFGFTADLR1944.00188 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482AYLPVNESFGFTADLR1944.00005 (observed)  
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitGI:9790141AYLQQLR1035.60576 (observed)  
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitGI:9790141AYLQQLR1035.6082 (observed)  
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorGI:118601068AYLVSNEPMEGAFNYVQTR2333.14212 (observed)  
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorGI:118601068AYLVSNEPMEGAFNYVQTR2349.13565 (observed)  
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorGI:118601068AYLVSNEPMEGAFNYVQTR2349.14225 (observed)  
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmicGI:261878543AYTEEDLDLVEK1712.88591 (observed)  
A4795EVPLEnvoplakinGI:111185907AYTEVAAAEQQQLR1721.89519 (observed)  
A4795EVPLEnvoplakinGI:111185907AYTEVAAAEQQQLR1721.89202 (observed)  
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 5GI:225637531AYVSTLMGVPGR1394.76177 (observed)  
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorGI:94408064;GI:6753178AYVVLGQFLVLK1638.03806 (observed)  
A5077BGN, SLRR1ABiglycan precursorGI:20137008AYYNGISLFNNPVPYWEVQPATFR3135.59763 (observed)  
A9849GPS1, COPS1, CSN1COP9 signalosome complex subunit 1GI:149267565;GI:21703742CAAGLAELAAR1235.63591 (observed)  
A1377PCNAProliferating cell nuclear antigenGI:149270621;GI:149270623;GI:7242171CAGNEDIITLR1394.68804 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CATSTPAFFAEK1606.78533 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CATSTPAFFAEK1606.78386 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027CAVVDVPFGGAK1496.78264 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027CAVVDVPFGGAK1496.79013 (observed)  
A8965PSMD13, HSPC02726S proteasome non-ATPase regulatory subunit 13GI:6755210CAWGQQPDLAANEAQLLR2174.06614 (observed)  
A8965PSMD13, HSPC02726S proteasome non-ATPase regulatory subunit 13GI:6755210CAWGQQPDLAANEAQLLR2174.06375 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCAEANPPACYGTVLAEFQPLVEEPK3205.44504 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCAEANPPACYGTVLAEFQPLVEEPK3205.45009 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529CCDIPSR1029.40886 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529CCDIPSR1029.40752 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCSGSLVER1189.49651 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCSGSLVER1189.49236 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCTLPEDQR1300.52751 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765CCTLPEDQR1300.52385 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CDACPVGFTGPMVQGVGINFAK2591.21953 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CDACPVGFTGPMVQGVGINFAK2607.22062 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CDACPVGFTGPMVQGVGINFAK2591.22489 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CDACPVGFTGPMVQGVGINFAK2607.22098 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562CDENILWLDYK1745.85356 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562CDENILWLDYK1745.85369 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802CDEWSIISEGK1600.76616 (observed)  
A079ARAP1B, PNAS-140Ras-related protein Rap-1bGI:21704066;GI:149261508;GI:15042957CDLEDER1069.44072 (observed)  
A079ARAP1B, PNAS-140Ras-related protein Rap-1bGI:21704066;GI:149261508;GI:15042957CDLEDER1069.44084 (observed)  
A327CRAB3D, GOV, RAB16Ras-related protein Rab-3DGI:21704066;GI:149261508;GI:15042957CDLEDER1069.44072 (observed)  
A327CRAB3D, GOV, RAB16Ras-related protein Rab-3DGI:21704066;GI:149261508;GI:15042957CDLEDER1069.44084 (observed)  
A7969TGM2Protein-glutamine gamma-glutamyltransferaseGI:6678329CDLEIQANGR1309.60137 (observed)  
A7969TGM2Protein-glutamine gamma-glutamyltransferaseGI:6678329CDLEIQANGR1309.601 (observed)  
A5073PPLPeriplakinGI:112421039CDLEIYQLK1458.75409 (observed)  
A1599CFH, HF, HF1Complement factor H precursorGI:109627652;GI:149274715;GI:71361676CDNGFSPPSGYSWDYLR2154.89751 (observed)  
A6418ELOVL1, SSC1, CGI-88Elongation of very long chain fatty acids protein 1GI:9507145;GI:85702351CDPIDFSNSPEALR1753.80364 (observed)  
A6418ELOVL1, SSC1, CGI-88Elongation of very long chain fatty acids protein 1GI:9507145;GI:85702351CDPIDFSNSPEALR1753.80181 (observed)  
A1466FN1, FNFibronectinGI:46849812CDPIDQCQDSETR1745.67021 (observed)  
A1466FN1, FNFibronectinGI:46849812CDPIDQCQDSETR1745.66985 (observed)  
A375AEIF2A, CDA02, MSTP004Eukaryotic translation initiation factor 2AGI:54020676CDPVFDFGTGPR1500.67693 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CDSGFALDSEER1518.63384 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CDSGFALDSEER1518.63396 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:30425250CDVDIR910.42395 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:30425250CDVDIR910.42375 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECFPGLAVGLDGR1672.74663 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECFPGLAVGLDGR1672.747 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECPNGMTLDATGR1704.6646 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECPNGMTLDATGR1704.66448 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECPNGMTLDATGR1720.66045 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECPVGFFYNDK1801.76543 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CECPVGFFYNDK1801.76548 (observed)  
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:183396771;GI:51766670CEFQDAYVLLSEK1878.92191 (observed)  
A0368RPL13A, RPL13a60S ribosomal protein L13aGI:31981945CEGINISGNFYR1562.72405 (observed)  
A0368RPL13A, RPL13a60S ribosomal protein L13aGI:31981945CEGINISGNFYR1562.72014 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482CELLYEGPPDDEAAMGIK2285.07657 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482CELLYEGPPDDEAAMGIK2285.07402 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220CEMEAQNQEYNMLLDIK2406.11528 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220CEMEAQNQEYNMLLDIK2422.10154 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220CEMEAQNQEYNMLLDIK2406.11423 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220CEMEAQNQEYNMLLDIK2438.09726 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220CEMEAQNQEYNMLLDIK2438.10111 (observed)  
A2141CORO1BCoronin 1BGI:6753494CEPIVMTVPR1334.67497 (observed)  
A5119SCELSciellinGI:70909345CEQSEELDNLIK1754.85881 (observed)  
A5119SCELSciellinGI:70909345CEQSEELDNLIK1754.85576 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039CEQTLAVQAHYILNDEAVLER2605.29929 (observed)  
A9145VWA5A, BCSC1, LOH11CR2AVon Willebrand factor A domain-containing protein 5AGI:225543183CEWELLER1267.59319 (observed)  
A5157SRPX, ETX1Sushi repeat-containing protein SRPX precursorGI:8394362CEYYCSPGYTLK1806.78714 (observed)  
A5157SRPX, ETX1Sushi repeat-containing protein SRPX precursorGI:8394362CEYYCSPGYTLK1806.78073 (observed)  
A158ATMED4, ERS25, HNLFTransmembrane EMP24 domain-containing protein 4 precursorGI:19527236;GI:145966911CFIEEIPDETMVIGNYR2219.04068 (observed)  
A158ATMED4, ERS25, HNLFTransmembrane EMP24 domain-containing protein 4 precursorGI:19527236;GI:145966911CFIEEIPDETMVIGNYR2235.03183 (observed)  
A702BTMED9, GP25L2, HSGP25L2GTransmembrane EMP24 domain-containing protein 9GI:19527236;GI:145966911CFIEEIPDETMVIGNYR2219.04068 (observed)  
A702BTMED9, GP25L2, HSGP25L2GTransmembrane EMP24 domain-containing protein 9GI:19527236;GI:145966911CFIEEIPDETMVIGNYR2235.03183 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94369748;GI:94383772;GI:6671569CFIVGADNVGSK1543.78337 (observed)  
A3807RPLP060S acidic ribosomal protein P0GI:94369748;GI:94383772;GI:6671569CFIVGADNVGSK1543.78386 (observed)  
A5250WDR1, PNAS-29WD-repeat containing protein 1GI:6755995CFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVR3518.64804 (observed)  
A5250WDR1, PNAS-29WD-repeat containing protein 1GI:6755995CFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVR3518.64109 (observed)  
A8416CASTCalpain inhibitorGI:33563246CGEDEDTVPAEYR1673.69316 (observed)  
A8416CASTCalpain inhibitorGI:33563246CGEDEDTVPAEYR1673.6917 (observed)  
A3960MYO6Unconventional myosin-VIGI:261823961CGGIQYLQSAIESR1714.83916 (observed)  
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1GI:158635992CGTGIVGVFVK1413.78545 (observed)  
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1GI:158635992CGTGIVGVFVK1413.78398 (observed)  
A697DLY6G6C, G6C, NG24Lymphocyte antigen 6 complex locus G6C protein precursorGI:12963685CGTPEEPCR1227.47441 (observed)  
A9633RPS15A40S ribosomal protein S15aGI:24762230;GI:149250304;GI:149252400;GI:149252492;GI:94372414;GI:149254145;GI:149261725CGVISPR921.47521 (observed)  
A098CLTBP4Latent TGF-beta binding protein-4GI:165905609;GI:165905611CIDIDECR1202.47783 (observed)  
A098CLTBP4Latent TGF-beta binding protein-4GI:165905609;GI:165905611CIDIDECR1202.47856 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824CIDPISCEEPYLLIGENR2300.06046 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824CIDPISCEEPYLLIGENR2300.05864 (observed)  
A0424GLUL, GLNS, PIG43Glutamine synthetaseGI:149269782;GI:31982332CIEEAIDK1254.62651 (observed)  
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 7GI:12963569CIENLEELQSLR1636.81682 (observed)  
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 7GI:12963569CIENLEELQSLR1636.81719 (observed)  
A5453S100A11, MLN70, S100CCalgizzarinGI:94404308;GI:21886811CIESLIAVFQK1584.87156 (observed)  
A5453S100A11, MLN70, S100CCalgizzarinGI:94404308;GI:21886811CIESLIAVFQK1584.87082 (observed)  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorGI:7305007CIITIEDVNDNLPTFTR2154.07505 (observed)  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorGI:7305007CIITIEDVNDNLPTFTR2154.07486 (observed)  
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorGI:240120117;GI:240120119CILDSELEGIR1437.72185 (observed)  
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorGI:240120117;GI:240120119CILDSELEGIR1437.72051 (observed)  
A4750DSTN, ACTDP, DSNDestrinGI:9790219CIVVEEGK1210.63823 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811CLAPMMSEVMR1457.65813 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966CLCLPGFSGPR1385.63457 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966CLCLPGFSGPR1385.63262 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CLCPEGFSLSSTGR1692.7354 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CLCPEGFSLSSTGR1692.73699 (observed)  
A5792RNPEP, APBAminopeptidase BGI:227499103;GI:227499234CLLPEGASELR1377.7 (observed)  
A1599CFH, HF, HF1Complement factor H precursorGI:109627652CLPVTELENGR1421.69121 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628CLSFECPENYR1596.64531 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CLTTIVK1111.64385 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CLTTIVK1111.6436 (observed)  
A697DLY6G6C, G6C, NG24Lymphocyte antigen 6 complex locus G6C protein precursorGI:12963685CLTTNVYLGK1445.77593 (observed)  
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologGI:33859662CLVLTGFGGYDK1606.82207 (observed)  
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologGI:33859662CLVLTGFGGYDK1606.82659 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482CLYASVLTAQPR1511.78765 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482CLYASVLTAQPR1511.78667 (observed)  
A9106TXN delta 3, TXN, TRDXThioredoxinGI:6755911CMPTFQFYK1498.71709 (observed)  
A9106TXN delta 3, TXN, TRDXThioredoxinGI:6755911CMPTFQFYK1514.70867 (observed)  
A9106TXN delta 3, TXN, TRDXThioredoxinGI:6755911CMPTFQFYK1498.71282 (observed)  
A9106TXN delta 3, TXN, TRDXThioredoxinGI:6755911CMPTFQFYK1514.71221 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472CMQLTDFILK1545.81413 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472CMQLTDFILK1545.80857 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472CMQLTDFILK1545.81413 (observed)  
A3814RPL14, RPL14L60S ribosomal protein L14GI:149257159;GI:13385472CMQLTDFILK1545.80857 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CNDTIPEDFQEFQTQSFDR2510.07639 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CNDTIPEDFQEFQTQSFDR2510.0773 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CNEGYEVAPDGR1499.63494 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CNEGYEVAPDGR1499.63567 (observed)  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:31981690;GI:83024101CNEIISWLDK1554.79117 (observed)  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:31981690;GI:83024101CNEIISWLDK1554.78897 (observed)  
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:51491845CNEPAVWSQLAK1679.84575 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:29336026;GI:33598964;GI:114326446;GI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:67189167;GI:71143152CNGVLEGIR1151.56536 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:29336026;GI:67189167;GI:33598964;GI:114326446;GI:71143152CNGVLEGIR1151.56597 (observed)  
A3961MYH10, SmembMyosin-10GI:29336026;GI:33598964;GI:114326446;GI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:67189167;GI:71143152CNGVLEGIR1151.56536 (observed)  
A3961MYH10, SmembMyosin-10GI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:29336026;GI:67189167;GI:33598964;GI:114326446;GI:71143152CNGVLEGIR1151.56597 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026;GI:33598964;GI:114326446;GI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:67189167;GI:71143152CNGVLEGIR1151.56536 (observed)  
A3962MYH14, FP17425Myosin-14GI:82935925;GI:94397543;GI:124486959;GI:205830428;GI:145864471;GI:6754774;GI:82524274;GI:18859641;GI:29336026;GI:67189167;GI:33598964;GI:114326446;GI:71143152CNGVLEGIR1151.56597 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750CPAPNLEGGPSVFIFPPNIK2431.27347 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750CPAPNLEGGPSVFIFPPNIK2431.27384 (observed)  
A1585NID1, NIDNidogen-1GI:94394792;GI:171543883CPDNTLGVDCIER1670.71355 (observed)  
A1585NID1, NIDNidogen-1GI:94394792;GI:171543883CPDNTLGVDCIER1670.71343 (observed)  
A9628RPS1140S ribosomal protein S11GI:21426889;GI:149263120CPFTGNVSIR1283.63408 (observed)  
A9628RPS1140S ribosomal protein S11GI:21426889;GI:149263120CPFTGNVSIR1283.63408 (observed)  
A8654ANP32EAcidic (leucine-rich) nuclear phosphoprotein 32 family member EGI:254587996CPNLTYLNLSGNK1770.91387 (observed)  
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSGI:20982845CPNPTCENMNFSWR1934.76103 (observed)  
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSGI:20982845CPNPTCENMNFSWR1934.75871 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CPPGFYTSPDGTR1587.7061 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CPPGFYTSPDGTR1587.70525 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CPTGYYLNEDTR1621.70928 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CPTGYYLNEDTR1621.70635 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961CPTVDIDTPDVNIEVPEGK2375.176 (observed)  
A1539KNG1, BDK, KNGKininogen-1GI:12963497;GI:156231023;GI:156231021CQALDMTEMAR1458.63542 (observed)  
A1563NPNT, EGFL6L, POEMNephronectinGI:73088940;GI:71067128CQCPSPGLQLAPDGR1777.80205 (observed)  
A1563NPNT, EGFL6L, POEMNephronectinGI:73088940;GI:71067128CQCPSPGLQLAPDGR1777.79839 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CQDLSVNQDLADTDAR1953.87883 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663CQDLSVNQDLADTDAR1953.87456 (observed)  
A2341ACTN1Alpha-actinin 1GI:61097906;GI:11230802;GI:7304855;GI:157951643CQLEINFNTLQTK1885.9782 (observed)  
A2341ACTN1Alpha-actinin 1GI:61097906;GI:11230802;GI:7304855;GI:157951643CQLEINFNTLQTK1885.97513 (observed)  
A2344ACTN4Alpha-actinin 4GI:61097906;GI:11230802;GI:7304855;GI:157951643CQLEINFNTLQTK1885.9782 (observed)  
A2344ACTN4Alpha-actinin 4GI:61097906;GI:11230802;GI:7304855;GI:157951643CQLEINFNTLQTK1885.97513 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589CQSLTEDLEFR1530.70769 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589CQSLTEDLEFR1530.70391 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:149253040;GI:183979966CSATGNPTPMLEWIGGPSGQLPAK2746.36832 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277CSCSPGWIGDGIK1702.76811 (observed)  
A4795EVPLEnvoplakinGI:111185907CSLEPALAVSAPK1619.87175 (observed)  
A4749DPTDermatopontin precursorGI:9789943CSNNGLVAGFQSR1542.72722 (observed)  
A4749DPTDermatopontin precursorGI:9789943CSNNGLVAGFQSR1543.70976 (observed)  
A4749DPTDermatopontin precursorGI:9789943CSNNGLVAGFQSR1543.71111 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850CTELNQAWTSLGK1784.89469 (observed)  
A9541RPL1260S ribosomal protein L12GI:94390243;GI:82995066;GI:82994754;GI:160333553CTGGEVGATSALAPK1695.86528 (observed)  
A9541RPL1260S ribosomal protein L12GI:94390243;GI:160333553;GI:82995066;GI:82994754CTGGEVGATSALAPK1695.8637 (observed)  
A5073PPLPeriplakinGI:112421039CTNELYWLDQQAK1945.94089 (observed)  
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDaGI:112293266CTPACVSFGPK1489.68694 (observed)  
A1599CFH, HF, HF1Complement factor H precursorGI:71361676;GI:109627652CTPTGWIPVPR1416.72392 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086CTVNDQNSDGYCQTGTMSR2315.88774 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086CTVNDQNSDGYCQTGTMSR2315.8897 (observed)  
A2286KCTD12, PFET1BTB/POZ domain-containing protein KCTD12GI:123701966CTVVSVPDSLLWR1664.86576 (observed)  
A6264DDX17ATP-dependent RNA helicase DDX17GI:40068493;GI:93587673;GI:40068491CTYLVLDEADR1487.70207 (observed)  
A6264DDX17ATP-dependent RNA helicase DDX17GI:40068493;GI:93587673;GI:40068491CTYLVLDEADR1487.69988 (observed)  
A1217HL14, LGALS1, HLBP14Galectin-1GI:6678682CVAFE758.33368 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:149261823;GI:164607147CVCPVSNTMCR1494.5656 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:149261823;GI:164607147CVCPVSNTMCR1510.55901 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:149261823;GI:164607147CVCPVSNTMCR1494.56243 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:149261823;GI:164607147CVCPVSNTMCR1510.55657 (observed)  
A5157SRPX, ETX1Sushi repeat-containing protein SRPX precursorGI:8394362CVDGAYFNSR1321.57854 (observed)  
A1675FBLN1, PP213Fibulin-1 precursorGI:168693628CVDVDECSPPAEPCGK2074.83139 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027CVGVGESDGSIWNPDGIDPK2379.12302 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027CVGVGESDGSIWNPDGIDPK2379.12065 (observed)  
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorGI:224922803CVINASGPFTDSVR1655.80107 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485CVLIFGVPSR1280.69792 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485CVLIFGVPSR1280.69963 (observed)  
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1GI:94374716;GI:149258138;GI:6680297CVLNEGMPIYR1484.71819 (observed)  
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1GI:94374716;GI:149258138;GI:6680297CVLNEGMPIYR1484.71819 (observed)  
A4008MOSC2, MARC2MOSC domain-containing protein 2, mitochondrial precursorGI:19526848CVLTTVDPDTGIIDR1807.91155 (observed)  
A4008MOSC2, MARC2MOSC domain-containing protein 2, mitochondrial precursorGI:19526848CVLTTVDPDTGIIDR1807.90959 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CVNLAPGFR1166.59319 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781CVNLAPGFR1166.59624 (observed)  
A0155CDC42Cell division control protein 42 homologGI:18875380;GI:45592934;GI:6753364;GI:6679601;GI:9625037;GI:13489097;GI:34328361CVVVGDGAVGK1337.71575 (observed)  
A0155CDC42Cell division control protein 42 homologGI:18875380;GI:9625037;GI:45592934;GI:6753364;GI:6679601;GI:13489097;GI:34328361CVVVGDGAVGK1337.71343 (observed)  
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1GI:18875380;GI:45592934;GI:6753364;GI:6679601;GI:9625037;GI:13489097;GI:34328361CVVVGDGAVGK1337.71575 (observed)  
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1GI:18875380;GI:9625037;GI:45592934;GI:6753364;GI:6679601;GI:13489097;GI:34328361CVVVGDGAVGK1337.71343 (observed)  
A096ARHOG, ARHGRho-related GTP-binding protein RhoGGI:18875380;GI:45592934;GI:6753364;GI:6679601;GI:9625037;GI:13489097;GI:34328361CVVVGDGAVGK1337.71575 (observed)  
A096ARHOG, ARHGRho-related GTP-binding protein RhoGGI:18875380;GI:9625037;GI:45592934;GI:6753364;GI:6679601;GI:13489097;GI:34328361CVVVGDGAVGK1337.71343 (observed)  
A7916FARSLA, FARSA, FARSPhenylalanyl-tRNA synthetase alpha chainGI:162138894CWELTTEGEEIAR1726.79057 (observed)  
A548DIGFBP2, BP2, IBP2Insulin-like growth factor-binding protein 2GI:31982260CYPNPGSELPLK1651.84355 (observed)  
A4577ANXA7, ANX7, SNXAnnexin A7GI:160707958CYQLEFGR1205.55779 (observed)  
A4577ANXA7, ANX7, SNXAnnexin A7GI:160707958CYQLEFGR1205.55388 (observed)  
A3969DCTN4Dynactin 4GI:13385798DAAAEYDELAEPQDFQDDPDIVAFR2984.37357 (observed)  
A327CRAB3D, GOV, RAB16Ras-related protein Rab-3DGI:15042957DAADQNFDYMFK1752.81845 (observed)  
A3961MYH10, SmembMyosin-10GI:33598964DAAGLESQLQDTQELLQEETR2518.24527 (observed)  
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitGI:126521835DAALMVTNDGATILK1821.00151 (observed)  
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitGI:126521835DAALMVTNDGATILK1821.00737 (observed)  
A5073PPLPeriplakinGI:112421039DAALQNVSDSEK1564.80718 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:149252624;GI:34328485DAAQSSPAFGDR1365.65361 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:149252624;GI:34328485DAAQSSPAFGDR1365.65459 (observed)  
A2102COPACoatomer alpha subunitGI:226823359DADSITLFDVQQK1767.94451 (observed)  
A3787KRT19, K19Keratin, type I cytoskeletal 19GI:6680606DAEATYLAR1153.59917 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981DAEAWFLEK1396.73808 (observed)  
A3809KRT12Keratin, type I cytoskeletal 12GI:118130981DAEAWFLEK1396.74114 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1895.82292 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1895.82524 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1911.82029 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1927.81426 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1927.81546 (observed)  
A2580SFRS2, SRSF2Serine/arginine-rich splicing factor 2GI:6755478DAEDAMDAMDGAVLDGR1911.81499 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484DAEEVISQTIDTIVDMIK2324.2247 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484DAEEVISQTIDTIVDMIK2324.22214 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484DAEEVISQTIDTIVDMIK2308.22586 (observed)  
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:6753484DAEEVISQTIDTIVDMIK2308.22806 (observed)  
A1579K14, KRT14Keratin, type I cytoskeletal 14GI:21489935DAEEWFFSK1446.72038 (observed)  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13GI:6754480DAEEWFQTK1441.72441 (observed)  
A428DFAM49B, BM009, BM-009Protein FAM49BGI:21450053DAEGILEDLQSYR1652.82987 (observed)  
A991BKHSRP, FUBP2Far upstream element binding protein 2GI:163954948DAFADAVQR1136.58 (observed)  
A991BKHSRP, FUBP2Far upstream element binding protein 2GI:163954948DAFADAVQR1136.58537 (observed)  
A0029ANXA6, ANX6Annexin A6GI:31981302;GI:158966670DAFVAIVQSVK1464.87724 (observed)  
A0029ANXA6, ANX6Annexin A6GI:31981302;GI:158966670DAFVAIVQSVK1464.87082 (observed)  
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]GI:149252910;GI:10946870DAGHPLYPFNDPY1649.77373 (observed)  
A3122NFATC2, NFAT1, NFATPNuclear factor of activated T-cells, cytoplasmic 2GI:81295421;GI:81295418;GI:209862955DAGLSPEQPALALAGVAASPR2135.16739 (observed)  
A3122NFATC2, NFAT1, NFATPNuclear factor of activated T-cells, cytoplasmic 2GI:81295421;GI:81295418;GI:209862955DAGLSPEQPALALAGVAASPR2135.16465 (observed)  
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:6754036DAGMQLQGYR1282.63616 (observed)  
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:6754036DAGMQLQGYR1282.63274 (observed)  
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:162461907DAGQISGLNVLR1386.78301 (observed)  
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:162461907DAGQISGLNVLR1386.78411 (observed)  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:31981690DAGTIAGLNVLR1343.78057 (observed)  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:31981690DAGTIAGLNVLR1343.77966 (observed)  
A0451HSPA5, GRP78Heat shock 70kDa protein 5GI:254540166DAGTIAGLNVMR1377.72978 (observed)  
A0451HSPA5, GRP78Heat shock 70kDa protein 5GI:254540166DAGTIAGLNVMR1361.73503 (observed)  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:124339838;GI:124339829;GI:124339826DAGVIAGLNVLR1341.79456 (observed)  
A7363PGAM1, PGAMAPhosphoglycerate mutase 1GI:114326546DAGYEFDICFTSVQK2056.96909 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915DAGYGGISLAVEGPSK1808.96453 (observed)  
A834BARF6ADP-ribosylation factor 6GI:6680724;GI:29789263DAIILIFANK1405.87607 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913DALNIETAVK1361.79875 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913DALNIETAVK1361.79265 (observed)  
A471CSEC24BProtein transport protein Sec24BGI:149251811;GI:46402179DALVNAVVDPLSAYSSAVASVPR2445.31711 (observed)  
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformGI:6677805DANGNSFATR1197.56426 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DANNMPVTAR1232.62065 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DANNMPVTAR1232.62248 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DAPDGPSVEAEPEYTFEGLR2323.08916 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DAPDGPSVEAEPEYTFEGLR2323.09439 (observed)  
A5073PPLPeriplakinGI:112421039DAQELLR988.55687 (observed)  
A8827HS1BP3HCLS1-binding protein 3GI:160948577DAQLAGSPELLEFLGTR1961.04973 (observed)  
A8827HS1BP3HCLS1-binding protein 3GI:160948577DAQLAGSPELLEFLGTR1961.05205 (observed)  
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GI:33563236DAQPQLEEADDDLDSK2076.98032 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674DAQSSVLFDVTGQVR1765.92185 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674DAQSSVLFDVTGQVR1765.9229 (observed)  
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2GI:149258752;GI:14149756DASDDLDDLNFFNQK2044.97759 (observed)  
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2GI:149258752;GI:14149756DASDDLDDLNFFNQK2044.9733 (observed)  
A6616GYG1, GYGGlycogenin-1GI:7305121DASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEER3928.77756 (observed)  
A6616GYG1, GYGGlycogenin-1GI:7305121DASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEER3928.78708 (observed)  
A6616GYG1, GYGGlycogenin-1GI:7305121DASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEER3944.76186 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DASVAEAWLLGQEPYLSSR2236.14493 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DASVVGFFR1141.61553 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DASVVGFFR1141.61357 (observed)  
A1012PKP1Plakophilin 1GI:9790161DATLEACAGALQNLTASK2111.07109 (observed)  
A1012PKP1Plakophilin 1GI:9790161DATLEACAGALQNLTASK2111.07622 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149253386DATNVGDEGGFAPNILENK2249.13262 (observed)  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:149253386DATNVGDEGGFAPNILENK2249.13718 (observed)  
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2GI:31982273DATSLNQAALYR1466.77385 (observed)  
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorGI:157951706DAVITVPAFFNQAER1821.96245 (observed)  
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorGI:157951706DAVIYPILVEFTR1679.95329 (observed)  
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorGI:157951706DAVIYPILVEFTR1679.95403 (observed)  
A833BARF5ADP-ribosylation factor 5GI:6680722;GI:6680718;GI:6680716;GI:149254976DAVLLVFANK1377.83769 (observed)  
A833BARF5ADP-ribosylation factor 5GI:6680722;GI:6680718;GI:6680716;GI:149254976DAVLLVFANK1377.84062 (observed)  
A835BARFGAP1, ARF1GAPADP-ribosylation factor GTPase activating protein 1GI:6680722;GI:6680718;GI:6680716;GI:149254976DAVLLVFANK1377.83769 (observed)  
A835BARFGAP1, ARF1GAPADP-ribosylation factor GTPase activating protein 1GI:6680722;GI:6680718;GI:6680716;GI:149254976DAVLLVFANK1377.84062 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562DAVLNAWAEDVDLR1730.88994 (observed)  
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeGI:31981562DAVLNAWAEDVDLR1730.88738 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769;GI:75677435DCDLDVACR1245.48516 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769;GI:75677435DCDLDVACR1245.48284 (observed)  
A297AZNF9, CNBP, RNF163Zinc finger protein 9GI:157909784DCDLQEDACYNCGR1886.6425 (observed)  
A297AZNF9, CNBP, RNF163Zinc finger protein 9GI:157909784DCDLQEDACYNCGR1886.6397 (observed)  
A0295PPP2R1ASerine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoformGI:77539776;GI:77539770;GI:8394027DCEAEVR1011.43486 (observed)  
A0492STIP1Stress-induced-phosphoprotein 1GI:14389431DCEECIQLEPTFIK2047.94327 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DCEQAENWMAAR1613.66301 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DCEQAENWMAAR1613.66106 (observed)  
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorGI:6753178DCFGCLR1049.41521 (observed)  
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorGI:6753178DCFGCLR1049.41509 (observed)  
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorGI:153791270DCGTCDPGYYNLQSGQGCER2447.90093 (observed)  
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorGI:153791270DCGTCDPGYYNLQSGQGCER2447.90201 (observed)  
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalGI:18700004DCLTPMGMTSENVAER1943.84612 (observed)  
A4819FMOD, FM, SLRR2EFibromodulin precursorGI:10946680DCPQECDCPPNFPTAMYCDNR2746.95407 (observed)  
A4819FMOD, FM, SLRR2EFibromodulin precursorGI:10946680DCPQECDCPPNFPTAMYCDNR2762.95053 (observed)  
A4819FMOD, FM, SLRR2EFibromodulin precursorGI:10946680DCPQECDCPPNFPTAMYCDNR2746.95041 (observed)  
A4819FMOD, FM, SLRR2EFibromodulin precursorGI:10946680DCPQECDCPPNFPTAMYCDNR2762.94815 (observed)  
A8216ZADH2Zinc-binding alcohol dehydrogenase domain-containing protein 2GI:31559926DCPVPLPGDGDLLVR1755.90178 (observed)  
A8216ZADH2Zinc-binding alcohol dehydrogenase domain-containing protein 2GI:31559926DCPVPLPGDGDLLVR1755.89214 (observed)  
A1187CTBP2RibeyeGI:149253672;GI:6753548;GI:7304989;GI:282721029DCTVEMPILK1482.76738 (observed)  
A1187CTBP2RibeyeGI:149253672;GI:6753548;GI:7304989DCTVEMPILK1482.76775 (observed)  
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorGI:149249577;GI:47059073DCVGDVTENQVCNK1903.81926 (observed)  
A697CVPS28, FP3517Vacuolar sorting protein 28GI:13385320DCVTPNEYTAACSR1765.71099 (observed)  
A7556PAICS, ADE2, AIRCMultifunctional protein ADE2GI:13385434DDANNDPQWSEEQLIAAK2332.12717 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DDDLNLR1004.51341 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DDDLNLR1004.51396 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DDDPLNAR1059.5197 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DDDPLNAR1059.5197 (observed)  
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorGI:149249577;GI:47059073DDFDHDNVPDIDDICPENFDISETDFR3388.40512 (observed)  
A1245NEDD4, NEDD4-1, PIG53E3 ubiquitin-protein ligase NEDD4GI:56699423DDFLGQVDVPLYPLPTENPR2429.2542 (observed)  
A1245NEDD4, NEDD4-1, PIG53E3 ubiquitin-protein ligase NEDD4GI:56699423DDFLGQVDVPLYPLPTENPR2430.25669 (observed)  
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:229892318DDGAAILVAVSNMVQK1919.06137 (observed)  
A371ETAGLN2, CDABP0035Transgelin 2GI:30519911DDGLFSGDPNWFPK1882.92522 (observed)  
A371ETAGLN2, CDABP0035Transgelin 2GI:30519911DDGLFSGDPNWFPK1882.92595 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027DDGSWEVIEGYR1569.73064 (observed)  
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorGI:6680027DDGSWEVIEGYR1569.72759 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:90403607;GI:61743961DDGVFVQEVMQNSPAAR2006.97763 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:90403607;GI:61743961DDGVFVQEVMQNSPAAR2006.97429 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:90403607;GI:61743961DDGVFVQEVMQNSPAAR2022.97002 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:90403607;GI:61743961DDGVFVQEVMQNSPAAR2022.97038 (observed)  
A1528ITGA6Integrin alpha-6GI:31982236DDITFVSGAPR1321.68901 (observed)  
A1528ITGA6Integrin alpha-6GI:31982236DDITFVSGAPR1321.6917 (observed)  
A1507COL5A1Collagen alpha 1(V) chain precursorGI:164565411DDLGGEFTEETIK1741.8737 (observed)  
A1507COL5A1Collagen alpha 1(V) chain precursorGI:164565411DDLGGEFTEETIK1741.87187 (observed)  
A7795PSAT1, PSAPhosphoserine aminotransferaseGI:149258641;GI:149258643;GI:54292132DDLLGFSLR1179.65044 (observed)  
A7795PSAT1, PSAPhosphoserine aminotransferaseGI:149258641;GI:149258643;GI:54292132DDLLGFSLR1179.65007 (observed)  
A1215GANAB, G2ANNeutral alpha-glucosidase ABGI:6679891DDNSVELTVAEGPYK1924.97953 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DDPSGQMLLLLSDAR1774.91814 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DDPSGQMLLLLSDAR1790.91399 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DDPSGQMLLLLSDAR1774.91826 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802DDPVTNLNNAFEVAEK2064.05644 (observed)  
A2344ACTN4Alpha-actinin 4GI:11230802DDPVTNLNNAFEVAEK2064.05229 (observed)  
A4318ERP44, TXNDC4, UNQ532/PRO1075Thioredoxin domain containing protein 4 precursorGI:19072792DDTESLEIFQNEVAR1909.92851 (observed)  
A4318ERP44, TXNDC4, UNQ532/PRO1075Thioredoxin domain containing protein 4 precursorGI:19072792DDTESLEIFQNEVAR1909.93144 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408DDVSGFVDPGLVLQDAQALHEAGEK2898.47129 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408DDVSGFVDPGLVLQDAQALHEAGEK2898.47953 (observed)  
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateGI:6678768DEAAAAAGGEGAAAPGEQAGGAGAEGAAGGEPR2895.32389 (observed)  
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateGI:6678768DEAAAAAGGEGAAAPGEQAGGAGAEGAAGGEPR2895.32755 (observed)  
A8972PSME2Proteasome activator subunit 2GI:20137004;GI:71725358DEAAYGALR1109.57109 (observed)  
A8972PSME2Proteasome activator subunit 2GI:20137004;GI:71725358DEAAYGALR1109.57012 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DEAEMSSWLR1367.63921 (observed)  
A4564AIM1, CRYBG1Absent in melanoma 1 proteinGI:163965368DEAVFDDEVAPDAAAENCLAER2540.11136 (observed)  
A7531PSMB6, LMPY, YProteasome subunit beta type 6 precursorGI:238231384DECLQFTANALALAMER2085.99479 (observed)  
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialGI:21313138DEDITEYQSILAAAVK2054.09726 (observed)  
A8492Serpina3kSerine protease inhibitor A3KGI:160333710;GI:148747546DEELSCSVLELK1698.86479 (observed)  
A332CRAB7A, RAB7Ras-related protein Rab-7AGI:148747526DEFLIQASPR1319.71147 (observed)  
A4575ANXA4, PIG28, ANX4Annexin A4GI:161016799DEGNYLDDALMK1671.81743 (observed)  
A3816RPS340S ribosomal protein S3GI:6755372DEILPTTPISEQK1758.97832 (observed)  
A3816RPS340S ribosomal protein S3GI:6755372DEILPTTPISEQK1758.97881 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026DEMFTLSR1142.56548 (observed)  
A6674GMPSGMP synthase [glutamine-hydrolyzing]GI:82801181;GI:85861218DEPDWESLIFLAR1734.88872 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485DEQGSAADSEDSPTIEAVR2120.96977 (observed)  
A6710ALADDelta-aminolevulinic acid dehydrataseGI:34328485DEQGSAADSEDSPTIEAVR2120.9688 (observed)  
A1337EIF2S1, EIF2AEukaryotic translation initiation factor 2 subunit 1GI:13385624DEQLESLFQR1408.72307 (observed)  
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14GI:31981100DESSPYAAMLAAQDVAQR2066.9954 (observed)  
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14GI:31981100DESSPYAAMLAAQDVAQR2082.9915 (observed)  
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14GI:31981100DESSPYAAMLAAQDVAQR2082.98893 (observed)  
A9994OGN, OIF, SLRR3AMimecan precursorGI:6679166DFADMPNLR1222.60137 (observed)  
A9994OGN, OIF, SLRR3AMimecan precursorGI:6679166DFADMPNLR1238.59587 (observed)  
A9994OGN, OIF, SLRR3AMimecan precursorGI:6679166DFADMPNLR1222.60059 (observed)  
A9994OGN, OIF, SLRR3AMimecan precursorGI:6679166DFADMPNLR1238.59868 (observed)  
A4445CLIC3Chloride intracellular channel protein 3GI:27229085DFAPGSQLPILLYDGDVK2236.21709 (observed)  
A4445CLIC3Chloride intracellular channel protein 3GI:27229085DFAPGSQLPILLYDGDVK2236.21689 (observed)  
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:27754065DFAVDIIK1208.72148 (observed)  
A448ETTLL12Tubulin-tyrosine ligase-like protein 12GI:269954711DFAYGEADPLIR1510.76909 (observed)  
A448ETTLL12Tubulin-tyrosine ligase-like protein 12GI:269954711DFAYGEADPLIR1510.77068 (observed)  
A051D Uncharacterized protein C6orf132GI:161484644DFDGIYYGDNR1478.66814 (observed)  
A051D Uncharacterized protein C6orf132GI:161484644DFDGIYYGDNR1478.66777 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DFDSLAQPSFFDR1688.80742 (observed)  
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:22203747DFDSLAQPSFFDR1688.80791 (observed)  
A1598C3, CPAMD1Complement C3 precursorGI:126518317DFDSVPPVVR1274.68962 (observed)  
A1598C3, CPAMD1Complement C3 precursorGI:126518317DFDSVPPVVR1274.68743 (observed)  
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1GI:158635992DFEQPLAISR1319.70879 (observed)  
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1GI:158635992DFEQPLAISR1319.7072 (observed)  
A9838CLEC11A, CLECSF3, LSLCLStem cell growth factor precursorGI:6677869DFETQAAAQAR1351.67192 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DFFLANASR1184.62029 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DFFLANASR1184.62078 (observed)  
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 1GI:7305075DFFQNFGNVVELR1728.88896 (observed)  
A6542G3BP1, G3BPRas-GTPase-activating protein binding protein 1GI:7305075DFFQNFGNVVELR1728.89006 (observed)  
A738BUPK1B, TSPAN20Uroplakin IBGI:188219537DFFTTNLFLK1533.86296 (observed)  
A738BUPK1B, TSPAN20Uroplakin IBGI:188219537DFFTTNLFLK1533.86504 (observed)  
A6811ITPA, My049Inosine triphosphate pyrophosphataseGI:31982664DFGWDPCFQPDGYEQTYAEMPK2958.275 (observed)  
A6811ITPA, My049Inosine triphosphate pyrophosphataseGI:31982664DFGWDPCFQPDGYEQTYAEMPK2974.25187 (observed)  
A6811ITPA, My049Inosine triphosphate pyrophosphataseGI:31982664DFGWDPCFQPDGYEQTYAEMPK2958.27335 (observed)  
A6158CYP2F1Cytochrome P450 2F1GI:124001560DFIDCFLTK1435.72319 (observed)  
A6158CYP2F1Cytochrome P450 2F1GI:124001560DFIDCFLTK1435.72161 (observed)  
A7466PPP4C, PPP4, PPXSerine/threonine protein phosphatase 4 catalytic subunitGI:9790175DFIIFEAAPQETR1680.87517 (observed)  
A7466PPP4C, PPP4, PPXSerine/threonine protein phosphatase 4 catalytic subunitGI:9790175DFIIFEAAPQETR1680.87578 (observed)  
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:148747424DFLAGGIAAAVSK1507.87969 (observed)  
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:148747424DFLAGGIAAAVSK1507.87407 (observed)  
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:63475897;GI:82880803;GI:22094075DFLAGGVAAAISK1507.87822 (observed)  
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:63475897;GI:82880803;GI:22094075DFLAGGVAAAISK1507.87261 (observed)  
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:18152793DFLIPIGK1190.73174 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393DFLLGAYQTEFPEGPTEQLMK2702.37247 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393DFLLGAYQTEFPEGPTEQLMK2718.36197 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393DFLLGAYQTEFPEGPTEQLMK2703.37314 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393DFLLGAYQTEFPEGPTEQLMK2703.37534 (observed)  
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicGI:31982393DFLLGAYQTEFPEGPTEQLMK2718.35739 (observed)  
A6891GLO1Lactoylglutathione lyaseGI:165932331DFLLQQTMLR1408.77898 (observed)  
A6891GLO1Lactoylglutathione lyaseGI:165932331DFLLQQTMLR1424.77544 (observed)  
A6891GLO1Lactoylglutathione lyaseGI:165932331DFLLQQTMLR1408.77544 (observed)  
A6891GLO1Lactoylglutathione lyaseGI:165932331DFLLQQTMLR1424.77178 (observed)  
A9572RPL3860S ribosomal protein L38GI:82895306;GI:94372654;GI:94377377DFLLTAR979.57042 (observed)  
A9572RPL3860S ribosomal protein L38GI:82895306;GI:94372654;GI:94377377DFLLTAR979.56969 (observed)  
A1517LAMB2, LAMSLaminin beta-2 chain precursorGI:31982223DFLSQEGADPDSIEMVATR2241.0474 (observed)  
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitGI:6671561;GI:116256510DFLTPPLLSVR1401.82463 (observed)  
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitGI:6671561;GI:116256510DFLTPPLLSVR1401.82427 (observed)  
A0778MAP4Microtubule-associated protein 4GI:148747189DFMAALEAEPYDDIVGETVEK2630.29264 (observed)  
A4371PPIC, CYPCPeptidyl-prolyl cis-trans isomerase CGI:6679441DFMIQGGDFTAR1501.72612 (observed)  
A4371PPIC, CYPCPeptidyl-prolyl cis-trans isomerase CGI:6679441DFMIQGGDFTAR1501.72441 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DFMIQGGDFTR1430.68498 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DFMIQGGDFTR1446.68218 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DFMIQGGDFTR1430.68559 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DFMIQGGDFTR1446.68328 (observed)  
A4374PPIL1, CYPL1, CGI-124Peptidyl-prolyl cis-trans isomerase like 1GI:149269121DFMIQGGDPTGTGR1595.76042 (observed)  
A4374PPIL1, CYPL1, CGI-124Peptidyl-prolyl cis-trans isomerase like 1GI:149269121DFMIQGGDPTGTGR1595.76116 (observed)  
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1GI:110347487DFNDTSQDPDFTQVVELDLK2614.28446 (observed)  
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1GI:110347487DFNDTSQDPDFTQVVELDLK2614.28977 (observed)  
A9739PDLIM5, ENH, L9PDZ and LIM domain protein 5GI:170650623;GI:170650625;GI:170650627DFNMPLTISSLK1653.92264 (observed)  
A9739PDLIM5, ENH, L9PDZ and LIM domain protein 5GI:170650623;GI:170650625;GI:170650627DFNMPLTISSLK1653.91692 (observed)  
A3939STX12Syntaxin 12GI:19527102DFNSIIQTCSGNIQR1885.90361 (observed)  
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformGI:31560731DFPELTMEVDGK1668.84282 (observed)  
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorGI:86198316DFPEYTFAIADEEDYATEVK2641.25241 (observed)  
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:58037117DFPLTGYVELR1453.78533 (observed)  
A5096PRELP, SLRR2A, MST161Prolargin precursorGI:229608920DFPNLAFIR1236.68779 (observed)  
A5096PRELP, SLRR2A, MST161Prolargin precursorGI:229608920DFPNLAFIR1236.68425 (observed)  
A3874ANK3Ankyrin 3GI:116256491;GI:116256493;GI:22129789;GI:116256497;GI:116256503;GI:116256505;GI:25121946;GI:86262153;GI:116256499;GI:77681962DFPQYFAVVSR1472.76872 (observed)  
A0784DYNC1LI1, DNCLI1Dynein light intermediate chain 1, cytosolicGI:22122795DFQEYVEPGEDFPASPQR2255.03911 (observed)  
A0784DYNC1LI1, DNCLI1Dynein light intermediate chain 1, cytosolicGI:22122795DFQEYVEPGEDFPASPQR2255.04302 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DFQLFSSPLGK1526.85112 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DFQLFSSPLGK1526.85514 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446DFSALESQLQDTQELLQEENR2637.28398 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446DFSALESQLQDTQELLQEENR2637.2858 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DFSATDLTEFAAR1587.77982 (observed)  
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursorGI:21704140DFSSVFQYLR1405.72612 (observed)  
A3662PCPyruvate carboxylase, mitochondrial precursorGI:251823978;GI:251823980DFTATFGPLDSLNTR1798.91484 (observed)  
A3662PCPyruvate carboxylase, mitochondrial precursorGI:251823978;GI:251823980DFTATFGPLDSLNTR1798.9185 (observed)  
A9735OLFML3, UNQ663/PRO1294, HNOEL-isoOlfactomedin-like protein 3 precursorGI:86439989DFTLAMAAR1139.6021 (observed)  
A9735OLFML3, UNQ663/PRO1294, HNOEL-isoOlfactomedin-like protein 3 precursorGI:86439989DFTLAMAAR1139.60051 (observed)  
A3464PGRMC1, HPR6.6, PGRMCMembrane associated progesterone receptor component 1GI:31980806DFTPAELR1092.58037 (observed)  
A0389ATP5J2, ATP5JL, ATP5J2-PTCD1ATP synthase f chain, mitochondrialGI:10181184DFTPSGIAGAFR1382.7227 (observed)  
A0389ATP5J2, ATP5JL, ATP5J2-PTCD1ATP synthase f chain, mitochondrialGI:10181184DFTPSGIAGAFR1382.7177 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:149241041;GI:28916703;GI:6671549DFTPVCTTELGR1528.72844 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:149241041;GI:28916703;GI:6671549DFTPVCTTELGR1528.72954 (observed)  
A3582ACACA, ACAC, ACC1Acetyl-CoA carboxylase 1GI:157042798;GI:125656173DFTVASPAEFVTR1583.82402 (observed)  
A3213SMC3, BAM, BMHStructural maintenance of chromosome 3GI:36031035DFVEDDTTHG1279.5573 (observed)  
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase AGI:150456419DFVNYLVR1169.64299 (observed)  
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase AGI:150456419DFVNYLVR1169.64336 (observed)  
A3588PYGBGlycogen phosphorylase, brain formGI:24418919DFYELEPEK1457.73882 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769DFYGEDAK1232.61553 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769DFYGEDAK1232.6126 (observed)  
A1885CLDN4, CPER, CPETR1Claudin-4GI:6753440DFYNPMVASGQK1644.82891 (observed)  
A7127POR, CYPORNADPH-cytochrome P450 reductaseGI:6679421DGALTQLNVAFSR1535.82952 (observed)  
A7127POR, CYPORNADPH-cytochrome P450 reductaseGI:6679421DGALTQLNVAFSR1535.83623 (observed)  
A375CSLC12A2, NKCC1Solute carrier family 12 member 2GI:124517716DGDAPLAAAAGVDLPGTAVPSGQEDATTAGR2995.47745 (observed)  
A375CSLC12A2, NKCC1Solute carrier family 12 member 2GI:124517716DGDAPLAAAAGVDLPGTAVPSGQEDATTAGR2995.4791 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGDGSITTQELGTVMR1823.89604 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGDGSITTQELGTVMR1839.89055 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGDGSITTQELGTVMR1823.8925 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGDGSITTQELGTVMR1839.88713 (observed)  
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29GI:19526463DGDLENPVLYNGAVK1892.9921 (observed)  
A1491COL1A1Collagen alpha-1(I) chainGI:34328108DGEAGAQGAPGPAGPAGER1808.86382 (observed)  
A1491COL1A1Collagen alpha-1(I) chainGI:34328108DGEAGAQGAPGPAGPAGER1808.86833 (observed)  
A6905LTA4H, LTA4Leukotriene A-4 hydrolaseGI:116734870DGEAPDPEDPSR1428.63762 (observed)  
A6905LTA4H, LTA4Leukotriene A-4 hydrolaseGI:116734870DGEAPDPEDPSR1428.63701 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DGEEAGAYDGPR1380.61528 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DGEEAGAYDGPR1380.61821 (observed)  
A8763EFHD2, SWS1Swiprosin 1GI:149253239;GI:31981086;GI:13386360DGFIDLMELK1468.8073 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DGFQCGPCPDGYTGNGITCSDVDECK3154.16452 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DGFQCGPCPDGYTGNGITCSDVDECK3154.16013 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404DGGIPADPNNIFLSTGASDAIVTMLK2905.5225 (observed)  
A5770GPT, AAT1, GPT1Alanine aminotransferase 1GI:33413404DGGIPADPNNIFLSTGASDAIVTMLK2905.53128 (observed)  
A0419GSNGelsolin precursor, plasmaGI:28916693DGGQTAPASIR1216.64311 (observed)  
A428BESYT1, FAM62A, MBC2Extended syntaptotagmin-1GI:33859650DGGSGVPPAGPGAASEALAVLTSFGR2485.28592 (observed)  
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalGI:18700004;GI:22122797DGGSTTAGNSSQVSDGAAAVLLAR2349.17594 (observed)  
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalGI:18700004;GI:22122797DGGSTTAGNSSQVSDGAAAVLLAR2349.17923 (observed)  
A1951GSTA4Glutathione S-transferase A4-4GI:160298217DGHLLFGQVPLVEIDGMMLTQTR2714.42264 (observed)  
A1951GSTA4Glutathione S-transferase A4-4GI:160298217DGHLLFGQVPLVEIDGMMLTQTR2730.42093 (observed)  
A1951GSTA4Glutathione S-transferase A4-4GI:160298217DGHLLFGQVPLVEIDGMMLTQTR2746.41281 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DGIGDACDEDADGDGILNEQDNCVLTHNIDQR3666.52285 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DGIGDACDEDADGDGILNEQDNCVLTHNIDQR3666.51303 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DGIGDECDDDDDNDGIPDLVPPGPDNCR3179.23935 (observed)  
A4687CNN3Calponin 3GI:21312564DGIILCELINK1564.8682 (observed)  
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5GI:7305619DGLGGLPDIVR1255.71453 (observed)  
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5GI:7305619DGLGGLPDIVR1255.71306 (observed)  
A7300PARK7, DJ-1RNA-binding protein regulatory subunitGI:55741460DGLILTSR1018.60253 (observed)  
A7300PARK7, DJ-1RNA-binding protein regulatory subunitGI:55741460DGLILTSR1018.60124 (observed)  
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseGI:6996917DGLLPEDTFIVGYAR1809.95439 (observed)  
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseGI:6996917DGLLPEDTFIVGYAR1809.95769 (observed)  
A553AHNRNPH3, HNRPH3Heterogeneous nuclear ribonucleoprotein H3GI:119637823DGMDNQGGYGSVGR1556.69414 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGNGFVSAAELR1380.68926 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGNGFVSAAELR1380.68718 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:13386230DGNGTVDFPEFLTMMSR2061.93633 (observed)  
A0008CALM1, CALM2, CALM3CalmodulinGI:6753244DGNGYISAAELR1410.69963 (observed)  
A6666GSTA2, GST2Glutathione S-transferase A2GI:149259801;GI:149260087;GI:169808401;GI:50263046;GI:154350202DGNLMFDQVPMVEIDGMK2327.13872 (observed)  
A6666GSTA2, GST2Glutathione S-transferase A2GI:149259801;GI:149260087;GI:169808401;GI:50263046;GI:154350202DGNLMFDQVPMVEIDGMK2343.1351 (observed)  
A6666GSTA2, GST2Glutathione S-transferase A2GI:149259801;GI:149260087;GI:169808401;GI:50263046;GI:154350202DGNLMFDQVPMVEIDGMK2327.13425 (observed)  
A6666GSTA2, GST2Glutathione S-transferase A2GI:149259801;GI:149260087;GI:169808401;GI:50263046;GI:154350202DGNLMFDQVPMVEIDGMK2343.1292 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811DGPGFYTTR1157.57121 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277;GI:30409956;GI:21450321DGPNALTPPPTTPEWVK2108.12656 (observed)  
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorGI:21450277;GI:30409956;GI:21450321DGPNALTPPPTTPEWVK2108.12656 (observed)  
A4200RCC2, TD60, TD-60Protein RCC2GI:149253208;GI:33239431DGQILPVPNVVVR1549.92009 (observed)  
A4200RCC2, TD60, TD-60Protein RCC2GI:149253208;GI:33239431DGQILPVPNVVVR1549.91741 (observed)  
A7558ATIC, PURHBifunctional purine biosynthesis protein PURHGI:149234067DGQVIGIGAGQQSR1529.81828 (observed)  
A7558ATIC, PURHBifunctional purine biosynthesis protein PURHGI:149234067DGQVIGIGAGQQSR1529.81841 (observed)  
A4304DNAJB1, DNAJ1, HDJ1DnaJ homolog subfamily B member 1GI:9055242DGSDVIYPAR1236.63469 (observed)  
A1215GANAB, G2ANNeutral alpha-glucosidase ABGI:6679891DGSDYEGWCWPGSASYPDFTNPR2797.14933 (observed)  
A1215GANAB, G2ANNeutral alpha-glucosidase ABGI:6679891DGSDYEGWCWPGSASYPDFTNPR2797.15189 (observed)  
A8391CD109, CPAMD7Activated T-cell marker CD109GI:23346525DGSVSVMDYYEPR1661.75884 (observed)  
A8391CD109, CPAMD7Activated T-cell marker CD109GI:23346525DGSVSVMDYYEPR1661.7603 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DGTVTAGNASGVSDGAGAVIIASEDAVK2820.45224 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915DGTYAVTYIPDK1630.85954 (observed)  
A7842SOD1Superoxide dismutase [Cu-Zn]GI:45597447DGVANVSIEDR1318.67241 (observed)  
A7842SOD1Superoxide dismutase [Cu-Zn]GI:45597447DGVANVSIEDR1318.6729 (observed)  
A4954LYPD3, C4.4A, UNQ491/PRO1007LY6/PLAUR domain-containing protein 3GI:19526946DGVTGPGFTLSGSCCQGPR2074.8975 (observed)  
A4954LYPD3, C4.4A, UNQ491/PRO1007LY6/PLAUR domain-containing protein 3GI:19526946DGVTGPGFTLSGSCCQGPR2074.89969 (observed)  
A1563NPNT, EGFL6L, POEMNephronectinGI:73088940;GI:71067128DGYEGDGLNCVYIPK1976.93425 (observed)  
A270DAbpa21Androgen-binding protein Gm4695GI:149256713DHPEILENTEKIK1999.10857 (observed)  
A1095HMGB1, HMG1, FM1High mobility group protein B1GI:149261847;GI:82952271;GI:149266674;GI:83014391;GI:6680229;GI:149255357;GI:149256155;GI:149256821;GI:149258387;GI:149259678;GI:51829731;GI:83022023;GI:149275099;GI:162329617DIAAYR852.47215 (observed)  
A1528ITGA6Integrin alpha-6GI:31982236DIALEITVTNSPSDPR1871.98882 (observed)  
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1GI:88853578DIANENEAQFQIR1691.84953 (observed)  
A6042CPCeruloplasmin precursorGI:110347564;GI:110815853DIASGLIGPLILCK1747.01328 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:149269348;GI:6756041DICNDVLSLLEK1696.87822 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:149269348;GI:6756041DICNDVLSLLEK1695.88994 (observed)  
A4757DSG3, CDHF6Desmoglein 3 precursorGI:110625833DICTSSPSVTLSVR1654.8272 (observed)  
A4757DSG3, CDHF6Desmoglein 3 precursorGI:110625833DICTSSPSVTLSVR1654.82927 (observed)  
A2150SNRNP200, ASCC3L1, HELIC2U5 small nuclear ribonucleoprotein 200 kDa helicaseGI:40018610DIDAFWLQR1307.68511 (observed)  
A0583PUF60, FIR, ROBPIPoly-U binding splicing factor PUF60GI:76677895;GI:257196186;GI:257196183DIDDDLEGEVTEECGK2100.92118 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:164607147DIDECDIVPDACK1815.79253 (observed)  
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorGI:164607147DIDECDIVPDACK1815.78874 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277DIDECLQNGR1353.59148 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277DIDECLQNGR1353.5927 (observed)  
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10GI:146219837DIDIEDLEELDPDFIMAK2425.1973 (observed)  
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10GI:146219837DIDIEDLEELDPDFIMAK2409.20487 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961DIDITSPEFMIK1696.91484 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961DIDITSPEFMIK1712.91289 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961DIDITSPEFMIK1696.91167 (observed)  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:61743961DIDITSPEFMIK1712.90068 (observed)  
A1133SFRS1, SRSF1, ASFSerine/arginine-rich splicing factor 1GI:149262253;GI:118582271DIEDVFYK1316.70427 (observed)  
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:110625954DIEEIIDELK1504.83989 (observed)  
A2454SYNE2, NUA, TROPHNesprin 2GI:145699091DIEGVVQEGVPTSQSYSEAR2295.12705 (observed)  
A2464NACADNac-alpha domain-containing protein 1GI:126116574DIELVMAQANVTR1621.83769 (observed)  
A2464NACADNac-alpha domain-containing protein 1GI:126116574DIELVMAQANVTR1621.83696 (observed)  
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitGI:41350312;GI:163965357DIELVMSQANVSR1605.8375 (observed)  
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitGI:41350312;GI:163965357DIELVMSQANVSR1605.84136 (observed)  
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitGI:41350312;GI:163965357DIELVMSQANVSR1621.83782 (observed)  
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitGI:41350312;GI:163965357DIELVMSQANVSR1621.83696 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DIFGDACDNCR1464.54888 (observed)  
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:116089322DIFPIAFPR1219.69841 (observed)  
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:116089322DIFPIAFPR1219.69841 (observed)  
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:116089322DIIALNPLYR1331.78142 (observed)  
A1222RPL5, MSTP03060S ribosomal protein L5GI:94362762;GI:149233658;GI:149257749;GI:149250073DIICQIAYAR1355.69866 (observed)  
A0254AP2M1, CLAPM1AP-2 complex subunit muGI:6753074DIILPFR1017.6198 (observed)  
A0254AP2M1, CLAPM1AP-2 complex subunit muGI:6753074DIILPFR1017.62016 (observed)  
A800BAP1S3Adapter-related protein complex 1 sigma 1C subunitGI:83020812;GI:35215317DIIQTVLSR1188.70867 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913DIISDTSGDFR1369.67351 (observed)  
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:149260099;GI:6996913DIISDTSGDFR1369.6729 (observed)  
A4595TGFBI, BIGH3Transforming growth factor-beta induced protein IG-H3 precursorGI:6678321DILATNGVIHFIDELLIPDSAK2683.48862 (observed)  
A1245NEDD4, NEDD4-1, PIG53E3 ubiquitin-protein ligase NEDD4GI:56699423DILGASDPYVR1349.72222 (observed)  
A9634RPS1640S ribosomal protein S16GI:149254484DILIQYDR1179.64861 (observed)  
A9634RPS1640S ribosomal protein S16GI:149254484DILIQYDR1179.64751 (observed)  
A815BAPODApolipoprotein D precursorGI:149267864;GI:75677437DILTSNGIDIEK1606.88518 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DINAYNGETPTEK1740.85588 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DINAYNGETPTEK1740.85405 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DINDNAPVFNPSTYQGQVPENEVNAR3032.44809 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DINDNAPVFNPSTYQGQVPENEVNAR3032.45304 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277DINECETPGICMNGR1904.74656 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277DINECETPGICMNGR1888.74932 (observed)  
A4806FBN1, FBNFibrillin-1GI:118197277DINECETPGICMNGR1904.74344 (observed)  
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:18079339DINQEVYNFLATAGAK2042.08884 (observed)  
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:18079339DINQEVYNFLATAGAK2042.08792 (observed)  
A7673pNORF1, UPF1, RENT1Regulator of nonsense transcripts 1GI:170784813;GI:170784811DINWDSSQWQPLIQDR2145.05344 (observed)  
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorGI:282398108DIPAYSQDTFK1572.8178 (observed)  
A9652RPS6, PNAS-2040S ribosomal protein S6GI:94367038;GI:82885362;GI:149258986;GI:82922450;GI:149265796;GI:82955311;GI:149271678DIPGLTDTTVPR1428.78447 (observed)  
A9652RPS6, PNAS-2040S ribosomal protein S6GI:94367038;GI:82885362;GI:149258986;GI:82922450;GI:149265796;GI:82955311;GI:149271678DIPGLTDTTVPR1428.78496 (observed)  
A7226CROT, COTPeroxisomal carnitine octanoyltransferaseGI:17157983DIPLPEELVFTVDEK2032.11417 (observed)  
A7226CROT, COTPeroxisomal carnitine octanoyltransferaseGI:17157983DIPLPEELVFTVDEK2032.11692 (observed)  
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2GI:23956396DIPNMFMDSAGGLGK1840.92583 (observed)  
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2GI:23956396DIPNMFMDSAGGLGK1840.91635 (observed)  
A1539KNG1, BDK, KNGKininogen-1GI:156231027;GI:156231029;GI:41235784;GI:12963497;GI:156231023;GI:156231021DIPVDSPELK1400.79643 (observed)  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:18252782DIPVNPLCIYR1492.78337 (observed)  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:18252782DIPVNPLCIYR1492.78301 (observed)  
A0417CAPZA2F-actin capping protein alpha-2 subunitGI:6671672DIQDSLTVSNEVQTAK2036.0773 (observed)  
A0417CAPZA2F-actin capping protein alpha-2 subunitGI:6671672DIQDSLTVSNEVQTAK2036.07268 (observed)  
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AGI:30061345;GI:30061339;GI:149246529;GI:82886797;GI:149255259;GI:149255706;GI:38091641;GI:94395563;GI:82952425;GI:82952638;GI:124486606;GI:30061401DIQLAR860.49712 (observed)  
A6483FAHFumarylacetoacetaseGI:240120112DIQQWEYVPLGPFLGK2178.18729 (observed)  
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:27754065DISDVER977.50383 (observed)  
A7722RNASEH1, RNH1Ribonuclease H1GI:31981748;GI:285402638;GI:285402659DISSAVQANPALTELSLR2029.10501 (observed)  
A7722RNASEH1, RNH1Ribonuclease H1GI:31981748;GI:285402638;GI:285402659DISSAVQANPALTELSLR2029.10831 (observed)  
A726AMTA2, MTA1L1, PIDMetastasis associated protein MTA2GI:51491880DISSSLNSLADSNAR1693.851 (observed)  
A0779ANP32A, LANP, MAPMAcidic leucine-rich nuclear phosphoprotein 32 family member AGI:149253242;GI:18700032;GI:40254600DISTLEPLK1303.77861 (observed)  
A0779ANP32A, LANP, MAPMAcidic leucine-rich nuclear phosphoprotein 32 family member AGI:18700032;GI:40254600;GI:149253242DISTLEPLK1303.778 (observed)  
A4055ANP32B, APRIL, PHAPI2Acidic leucine-rich nuclear phosphoprotein 32 family member BGI:149253242;GI:18700032;GI:40254600DISTLEPLK1303.77861 (observed)  
A4055ANP32B, APRIL, PHAPI2Acidic leucine-rich nuclear phosphoprotein 32 family member BGI:18700032;GI:40254600;GI:149253242DISTLEPLK1303.778 (observed)  
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorGI:6755863DISTNYYASQK1577.80864 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DITDTSIGAYWTSAPGMVR2201.07207 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DITDTSIGAYWTSAPGMVR2185.07598 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DITDTSIGAYWTSAPGMVR2185.07695 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DITDTSIGAYWTSAPGMVR2201.06938 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:149253040;GI:183979966DITLECISSGEPR1609.76995 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:149253040;GI:183979966DITLECISSGEPR1609.7697 (observed)  
A1631HPHaptoglobin precursorGI:8850219DITPTLTLYVGK1608.95464 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663DITSDTSGDFR1357.6364 (observed)  
A0647ANXA1, ANX1, LPC1Annexin A1GI:124517663DITSDTSGDFR1357.63555 (observed)  
A0234ACTR3, ARP3Actin-like protein 3GI:52345394;GI:23956222DITYFIQQLLR1553.88481 (observed)  
A0234ACTR3, ARP3Actin-like protein 3GI:52345394;GI:23956222DITYFIQQLLR1553.88689 (observed)  
A3339ACTR3B, ARP4, ARP3BETAActin-related protein 3BGI:52345394;GI:23956222DITYFIQQLLR1553.88481 (observed)  
A3339ACTR3B, ARP4, ARP3BETAActin-related protein 3BGI:52345394;GI:23956222DITYFIQQLLR1553.88689 (observed)  
A682CVIPAS39, VIPAR, SPE39VPS33B-interacting proteinGI:217272818;GI:217035166DIVDDDDDDDLER1693.72173 (observed)  
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-betaGI:170295840DIVENYFMR1330.66203 (observed)  
A1378TRIM28, KAP1, RNF96Transcription intermediary factor 1-betaGI:170295840DIVENYFMR1330.65813 (observed)  
A028AOSTF1Osteoclast stimulating factor 1GI:22267440DIVEVLFTQPNVELNQQNK2516.36753 (observed)  
A028AOSTF1Osteoclast stimulating factor 1GI:22267440DIVEVLFTQPNVELNQQNK2516.37009 (observed)  
A5267AIMP2, JTV1, PRO0992Aminoacyl tRNA synthetase complex-interacting multifunctional protein 2GI:22122695;GI:288541337DIVINANPASPPLSLLVLHR2283.33597 (observed)  
A0418CAPZBCapping protein (actin filament) muscle Z-line, betaGI:6753262;GI:83649737DIVNGLR931.53484 (observed)  
A7293PAPSS1, ATPSK1, PAPSSBifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1GI:6754982DIVPVDASYEVK1622.89617 (observed)  
A7293PAPSS1, ATPSK1, PAPSSBifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1GI:6754982DIVPVDASYEVK1622.88506 (observed)  
A909BCPNE3, CPN3Copine IIIGI:149269167;GI:25141335;GI:6753510;GI:226052679;GI:28416905;GI:58037333;GI:23346611;GI:25470894;GI:21630253;GI:23943807DIVQFVPFR1264.71904 (observed)  
A909BCPNE3, CPN3Copine IIIGI:149269167;GI:25141335;GI:6753510;GI:226052679;GI:28416905;GI:58037333;GI:23346611;GI:25470894;GI:21630253;GI:23943807DIVQFVPFR1264.72246 (observed)  
A907BCPNE1, CPN1Copine-1GI:25141330DIVQFVPYR1280.7133 (observed)  
A907BCPNE1, CPN1Copine-1GI:25141330DIVQFVPYR1280.71245 (observed)  
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorGI:188035858DIVVAETLEDLDK1747.95847 (observed)  
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorGI:188035858DIVVAETLEDLDK1747.95609 (observed)  
A8694CALUCalumenin precursorGI:6680840;GI:41282022DIVVQETMEDIDK1822.94682 (observed)  
A0978PYGLGlycogen phosphorylase, liver formGI:268836255DIWNMEPSDLK1635.83013 (observed)  
A767CAIM1L, CRYBG2Absent in melanoma 1-like proteinGI:244790065DIYNLQQPEDSQSPQLTSVGSLR2719.3751 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:6754524;GI:257743039DLADELALVDVMEDK1964.01824 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:6754524;GI:257743039DLADELALVDVMEDK1964.01396 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:6754524;GI:257743039DLADELALVDVMEDK1980.01384 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:6754524;GI:257743039DLADELALVDVMEDK1980.00957 (observed)  
A0645PARVA, MXRA2Alpha-parvinGI:31982526DLAEDLYDGQVLQK1895.01285 (observed)  
A0645PARVA, MXRA2Alpha-parvinGI:31982526DLAEDLYDGQVLQK1895.00603 (observed)  
A3967KIF5B, KNS, KNS1Kinesin family member 5BGI:61657921DLAEIGIAVGNNDVK1816.01072 (observed)  
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KGI:13384620DLAGSIIGK1161.7022 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DLAILLGMLDPVEK1831.05608 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DLAILLGMLDPVEK1831.05522 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DLAILLGMLDPVEK1815.05632 (observed)  
A0432PRDX6, AOP2Peroxiredoxin 6GI:6671549DLAILLGMLDPVEK1815.05852 (observed)  
A4634CAPG, AFCP, MCPGelsolin-like capping proteinGI:110227377DLALAIR915.57262 (observed)  
A4634CAPG, AFCP, MCPGelsolin-like capping proteinGI:110227377DLALAIR915.57671 (observed)  
A7919GARSGlycyl-tRNA synthetaseGI:93102417DLANGNITWADVEAR1789.88884 (observed)  
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:61888838DLAPTGIR986.57463 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLASVQALLR1229.7354 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLASVQALLR1229.73772 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674DLAVAGPEMQVK1545.86382 (observed)  
A156CMVP, LRPMajor vault proteinGI:239052674DLAVAGPEMQVK1545.85198 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DLDDFQSWLSR1525.74614 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DLDDFQSWLSR1525.74455 (observed)  
A0648S100A10, ANX2LG, CAL1LCalpactin I light chainGI:6677833DLDQCR939.41332 (observed)  
A0648S100A10, ANX2LG, CAL1LCalpactin I light chainGI:6677833DLDQCR939.41655 (observed)  
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:254540027DLDVAVLVGSMPR1515.83965 (observed)  
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:254540027DLDVAVLVGSMPR1531.82792 (observed)  
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:254540027DLDVAVLVGSMPR1515.83281 (observed)  
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:254540027DLDVAVLVGSMPR1531.82947 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DLEAISAR1018.56841 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DLEAISAR1018.56676 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DLEAITFK1224.70207 (observed)  
A7376PGM2, MSTP006Phosphoglucomutase-2GI:227330633DLEALMLDR1219.65044 (observed)  
A7376PGM2, MSTP006Phosphoglucomutase-2GI:227330633DLEALMLDR1219.64849 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917DLEASIAR1018.56841 (observed)  
A1374LMNA, LMN1Lamin A/CGI:9506843;GI:162287370;GI:161760667DLEDSLAR1062.55632 (observed)  
A1374LMNA, LMN1Lamin A/CGI:9506843;GI:162287370;GI:161760667DLEDSLAR1062.55791 (observed)  
A3333NKX3-2, BAPX1, NKX3BHomeobox protein Nkx-3.2GI:161016805DLEEEAPVR1201.61797 (observed)  
A2573RBM39, RNPC2, HCC1RNA-binding motif protein 39GI:118403314DLEEFFSTVGK1559.82866 (observed)  
A3901CLTBClathrin light chain BGI:30794164DLEEWNQR1233.59819 (observed)  
A3901CLTBClathrin light chain BGI:30794164DLEEWNQR1233.59844 (observed)  
A7518PSMA1, HC2, NUProteasome subunit alpha type 1GI:33563282DLEFTIYDDDDVSPFLDGLEERPQR3128.48618 (observed)  
A0446CSE1L, CAS, XPO2Exportin-2GI:12963737DLEGSDIDTR1264.61052 (observed)  
A1598C3, CPAMD1Complement C3 precursorGI:126518317DLELLASGVDR1331.73223 (observed)  
A1598C3, CPAMD1Complement C3 precursorGI:126518317DLELLASGVDR1331.73015 (observed)  
A250CNUCB1, NUC, CALNUCNucleobindin 1 precursorGI:6679158;GI:254750698DLELLIQTATR1416.82231 (observed)  
A250CNUCB1, NUC, CALNUCNucleobindin 1 precursorGI:6679158;GI:254750698DLELLIQTATR1416.82512 (observed)  
A6766EPHX1, EPHX, EPOXEpoxide hydrolase 1GI:6753762DLELLYPFK1425.82927 (observed)  
A6766EPHX1, EPHX, EPOXEpoxide hydrolase 1GI:6753762DLELLYPFK1425.82756 (observed)  
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein QGI:114145493;GI:29788787DLFEDELVPLFEK1882.01152 (observed)  
A0599SYNCRIP, HNRPQ, NSAP1Heterogeneous nuclear ribonucleoprotein QGI:114145493;GI:29788787DLFEDELVPLFEK1882.00969 (observed)  
A4795EVPLEnvoplakinGI:111185907DLFLDVDK1252.69707 (observed)  
A524AHDGF, HMG1L2Hepatoma-derived growth factorGI:188497724DLFPYEESK1415.72649 (observed)  
A524AHDGF, HMG1L2Hepatoma-derived growth factorGI:188497724DLFPYEESK1415.73784 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917DLFQVAFNR1253.68035 (observed)  
A1560LAMA5Laminin subunit alpha-5GI:124487155DLGAQGAVAEAELAEAQR1942.9959 (observed)  
A1560LAMA5Laminin subunit alpha-5GI:124487155DLGAQGAVAEAELAEAQR1942.99472 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446;GI:241982716;GI:241982718DLGEELEALK1404.78996 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026DLGEELEALR1288.68877 (observed)  
A3962MYH14, FP17425Myosin-14GI:29336026DLGEELEALR1288.6862 (observed)  
A7083MRI1, MRDI, UNQ6390/PRO21135Methylthioribose-1-phosphate isomeraseGI:268838020DLGQVAAQEAER1430.73772 (observed)  
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGI:116089273DLGTDSQIFISR1495.7896 (observed)  
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGI:116089273DLGTDSQIFISR1495.78728 (observed)  
A585AEIF4G2, DAP5, AAG1Eukaryotic translation initiation factor 4 gamma 2GI:110630015;GI:34486094DLGVFIPAPMAQGR1615.87834 (observed)  
A585AEIF4G2, DAP5, AAG1Eukaryotic translation initiation factor 4 gamma 2GI:110630015;GI:34486094DLGVFIPAPMAQGR1615.87834 (observed)  
A1543F3Tissue factor precursorGI:170172540DLGYIITYR1257.69524 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086DLIDFDDR1152.56633 (observed)  
A0454DSPDesmoplakinGI:82950147;GI:82950149;GI:149264086DLIDFDDR1152.56584 (observed)  
A3652D1Pas1Putative ATP-dependent RNA helicase Pl10GI:25141235;GI:6753620;GI:14861844DLLDLLVEAK1416.86296 (observed)  
A3652D1Pas1Putative ATP-dependent RNA helicase Pl10GI:25141235;GI:6753620;GI:14861844DLLDLLVEAK1416.86341 (observed)  
A7917FARSB, FRSB, FARSLBPhenylalanyl-tRNA synthetase beta chainGI:31981400DLLFQALGR1176.68425 (observed)  
A7917FARSB, FRSB, FARSLBPhenylalanyl-tRNA synthetase beta chainGI:31981400DLLFQALGR1176.68669 (observed)  
A2341ACTN1Alpha-actinin 1GI:61097906;GI:11230802;GI:7304855;GI:157951643DLLLDPAWEK1487.84197 (observed)  
A2341ACTN1Alpha-actinin 1GI:61097906;GI:11230802;GI:7304855;GI:157951643DLLLDPAWEK1487.83684 (observed)  
A2344ACTN4Alpha-actinin 4GI:61097906;GI:11230802;GI:7304855;GI:157951643DLLLDPAWEK1487.84197 (observed)  
A2344ACTN4Alpha-actinin 4GI:61097906;GI:11230802;GI:7304855;GI:157951643DLLLDPAWEK1487.83684 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DLLQPEVAVALLEAQAGTGHIIDPATSAR3100.67502 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DLLQPEVAVALLEAQAGTGHIIDPATSAR3100.67722 (observed)  
A4577ANXA7, ANX7, SNXAnnexin A7GI:160707958DLLSSVSR1020.58129 (observed)  
A4577ANXA7, ANX7, SNXAnnexin A7GI:160707958DLLSSVSR1020.58238 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DLLTAYYDVDYEK1895.95574 (observed)  
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:112293264DLLTAYYDVDYEK1895.95757 (observed)  
A555AHNRNPUL2, HNRPUL2, BSCL2Heterogeneous nuclear ribonucleoprotein U-like protein 2GI:149270322;GI:124487099DLLVQQASQCLSK1766.94596 (observed)  
A555AHNRNPUL2, HNRPUL2, BSCL2Heterogeneous nuclear ribonucleoprotein U-like protein 2GI:149270322;GI:124487099DLLVQQASQCLSK1766.9412 (observed)  
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorGI:21312062DLLVTGAYEITDQSGGAGGLR2237.15934 (observed)  
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorGI:21312062DLLVTGAYEITDQSGGAGGLR2237.16227 (observed)  
A5082PKP3Plakophilin 3GI:242332585;GI:242332587DLLYFDGLR1255.68193 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLMSWINGIR1349.70305 (observed)  
A0235ACTR2, ARP2Actin-like protein 2GI:22122825DLMVGDEASELR1478.73125 (observed)  
A0235ACTR2, ARP2Actin-like protein 2GI:22122825DLMVGDEASELR1494.72319 (observed)  
A0235ACTR2, ARP2Actin-like protein 2GI:22122825DLMVGDEASELR1478.73137 (observed)  
A0235ACTR2, ARP2Actin-like protein 2GI:22122825DLMVGDEASELR1494.72283 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DLNAAEALQR1244.66997 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DLNAAEALQR1244.67058 (observed)  
A1098PRMT5, HRMT1L5, IBP72Protein arginine N-methyltransferase 5GI:188528624DLNCVPEIADTLGAVAK2063.07602 (observed)  
A1098PRMT5, HRMT1L5, IBP72Protein arginine N-methyltransferase 5GI:188528624DLNCVPEIADTLGAVAK2063.07932 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLNSQADSLMTSSAFDTSQVK2533.24051 (observed)  
A4114SPFH1, ERLIN1, KE04Erlin-1GI:256355015DLNTMAPGLTIQAVR1759.95391 (observed)  
A1298PGLS6-phosphogluconolactonaseGI:13384778DLPAAAAPAGPASFAR1626.87651 (observed)  
A1298PGLS6-phosphogluconolactonaseGI:13384778DLPAAAAPAGPASFAR1626.87663 (observed)  
A551CSRP68Signal recognition particle 68 kDa proteinGI:47271535DLPDVQELITQVR1669.92679 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161DLPELALDTPR1383.76152 (observed)  
A838APDCD4, H731Programmed cell death 4GI:110625656;GI:270309161DLPELALDTPR1383.75896 (observed)  
A8890NARG1, NAA15, GA19NMDA receptor-regulated protein 1GI:225543482DLPETVR973.54057 (observed)  
A2047SMARCA2, BAF190B, BRMPossible global transcription activator SNF2L2GI:51593084;GI:21313112DLPEYYELIR1454.76604 (observed)  
A375CSLC12A2, NKCC1Solute carrier family 12 member 2GI:149270069;GI:124517716DLPPVLLVR1165.74065 (observed)  
A375CSLC12A2, NKCC1Solute carrier family 12 member 2GI:149270069;GI:124517716DLPPVLLVR1165.74346 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917DLPPVSGSIIWAK1670.97368 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750DLPSPIER1070.59758 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149263750DLPSPIER1070.59783 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DLPSVQLLMK1431.85344 (observed)  
A7541PGIS, PTGIS, CYP8Prostacyclin synthaseGI:6679535DLQALTEAMYTNLR1782.92301 (observed)  
A4795EVPLEnvoplakinGI:111185907DLQEALQDYELQADTYR2215.06949 (observed)  
A4795EVPLEnvoplakinGI:111185907DLQEALQDYELQADTYR2215.0645 (observed)  
A6285DDX56, DDX21, NOH61Probable ATP-dependent 61 kDa nucleolar RNA helicaseGI:21312650DLQLLR901.56163 (observed)  
A0439PHB2, BAP, REAProhibitin 2GI:126723336DLQMVNISLR1332.74626 (observed)  
A0439PHB2, BAP, REAProhibitin 2GI:126723336DLQMVNISLR1348.74126 (observed)  
A0439PHB2, BAP, REAProhibitin 2GI:126723336DLQMVNISLR1332.74736 (observed)  
A3793PHBProhibitinGI:6679299;GI:85702063DLQNVNITLR1329.76262 (observed)  
A3793PHBProhibitinGI:6679299;GI:85702063DLQNVNITLR1329.76103 (observed)  
A0693PACSIN3Protein kinase C and casein kinase substrate in neurons protein 3GI:163644252DLQQSIEAASDEEDLR1962.9362 (observed)  
A0693PACSIN3Protein kinase C and casein kinase substrate in neurons protein 3GI:163644252DLQQSIEAASDEEDLR1962.93596 (observed)  
A0315PTPN6, HCP, PTP1CProtein-tyrosine phosphatase, non-receptor type 6GI:118130785;GI:118130771DLSGPDAETLLK1546.85735 (observed)  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorGI:226531047;GI:226531069DLSPQDQFNLIEFSGEANQWK2754.37607 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLSSVQTLLTK1492.88078 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLSSVQTLLTK1492.89214 (observed)  
A8654ANP32EAcidic (leucine-rich) nuclear phosphoprotein 32 family member EGI:254587996DLSTVEALQNLK1618.93082 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DLTADTEYQISVFAMK2120.08696 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DLTADTEYQISVFAMK2136.08493 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DLTADTEYQISVFAMK2120.08159 (observed)  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorGI:111074529DLTADTEYQISVFAMK2136.08452 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240;GI:30425250DLTDYLMK1286.69951 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240;GI:30425250DLTDYLMK1302.6895 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240;GI:30425250DLTDYLMK1286.69634 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240;GI:30425250DLTDYLMK1302.68157 (observed)  
A4578ANXA8L1, ANXA8, ANX8Annexin A8GI:149265291;GI:22165408DLTETLK1107.64299 (observed)  
A2541HNRNPDL, HNRPDL, JKTBPJKTBP2GI:148664250DLTEYLSR1140.60369 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039DLTGFPK1065.61113 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLTGVQNLR1159.65557 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DLTGVQNLR1159.65935 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:55926127;GI:117938332;GI:117938334DLTSVNILLK1403.87859 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:55926127;GI:117938332;GI:117938334DLTSVNILLK1403.87859 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127;GI:117938332;GI:117938334DLTSVNILLK1403.87859 (observed)  
A9545RPL18A60S ribosomal protein L18AGI:149240702;GI:162287138;GI:58037465DLTTAGAVTQCYR1588.75614 (observed)  
A9545RPL18A60S ribosomal protein L18AGI:149240702;GI:162287138;GI:58037465DLTTAGAVTQCYR1588.75774 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DLVAIEAK1146.68669 (observed)  
A4576ANXA5, ANX5, ENX2Annexin A5GI:6753060DLVDDLK1105.64421 (observed)  
A1505COL7A1Collagen alpha 1(VII) chain precursorGI:115647999DLVLSEPSSQSLR1574.85039 (observed)  
A1505COL7A1Collagen alpha 1(VII) chain precursorGI:115647999DLVLSEPSSQSLR1574.85002 (observed)  
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:34328286DLVPDLSNFYAQYK1961.03948 (observed)  
A267ERUFY4RUN and FYVE domain-containing protein 4GI:169808409DLVQAMKR1264.71794 (observed)  
A0637GPHRYN, GPHN, GPHGephyrinGI:269973917;GI:269973915DLVQDPSLLGGTISAYK2065.15189 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809DLVSSLTSGLLTIGDR1791.00139 (observed)  
A3586ACLYATP-citrate synthaseGI:29293809DLVSSLTSGLLTIGDR1791.00371 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2376.15964 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2359.17363 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2359.16997 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2375.17197 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2503.27127 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954DLYANTVLSGGTTMYPGIADR2360.18222 (observed)  
A7969TGM2Protein-glutamine gamma-glutamyltransferaseGI:6678329DLYLENPEIK1521.84392 (observed)  
A7969TGM2Protein-glutamine gamma-glutamyltransferaseGI:6678329DLYLENPEIK1521.84245 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769DLYPVIK1135.70635 (observed)  
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringGI:163310769DLYPVIK1135.69243 (observed)  
A7762RTCA, RTCD1, RPCRNA 3'-terminal phosphate cyclaseGI:254587958DLYVSIQPVQEAR1661.90239 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047DMAGLYEEIWK1642.84429 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047DMAGLYEEIWK1658.83672 (observed)  
A711DMAMDC2MAM domain-containing protein 2GI:33469047DMAGLYEEIWK1642.84055 (observed)  
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:18250284DMANPTALLLSAVMMLR2023.05851 (observed)  
A5119SCELSciellinGI:70909345DMCTYCR1127.39433 (observed)  
A5119SCELSciellinGI:70909345DMCTYCR1127.39324 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DMDDEESWIK1555.72258 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DMDLIDVNEAFAPQFLSVQK2584.32456 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DMDLIDVNEAFAPQFLSVQK2568.33561 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DMDLIDVNEAFAPQFLSVQK2568.33286 (observed)  
A7979ACAA2Acetyl-CoA acyltransferase 2GI:29126205DMDLIDVNEAFAPQFLSVQK2584.33133 (observed)  
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10GI:146219837DMDLWEQQEEER1751.76897 (observed)  
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10GI:146219837DMDLWEQQEEER1751.76689 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824DMDVVSGR1022.50525 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824DMDVVSGR1038.50102 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824DMDVVSGR1022.50481 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DMETIGFAVYQVPR1785.90117 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DMETIGFAVYQVPR1769.90532 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DMETIGFAVYQVPR1785.89975 (observed)  
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitGI:160333229DMETIGFAVYQVPR1769.9074 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446DMFQETMEAMR1532.66789 (observed)  
A3166MYH9Myosin heavy chain 9, non-muscleGI:114326446DMFQETMEAMR1532.66765 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DMGEMVTQGQTDAQYMFLR2365.07663 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DMGEMVTQGQTDAQYMFLR2381.07291 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DMGEMVTQGQTDAQYMFLR2365.08304 (observed)  
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorGI:18700024DMGGYSTTTDFIK1723.84551 (observed)  
A9779PYCARD, ASC, CARD5Apoptosis-associated Speck-like protein containing a CARDGI:165377185DMGLQELAEQLQTTK2009.04636 (observed)  
A9779PYCARD, ASC, CARD5Apoptosis-associated Speck-like protein containing a CARDGI:165377185DMGLQELAEQLQTTK1993.05191 (observed)  
A9779PYCARD, ASC, CARD5Apoptosis-associated Speck-like protein containing a CARDGI:165377185DMGLQELAEQLQTTK1993.06473 (observed)  
A4663BGPa, BGP, CEACAM1Carcinoembryonic antigen-related cell adhesion molecule 1 precursorGI:85719313;GI:85719299;GI:85719301;GI:8571933DMGVYTLDMTDENYR1966.866 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2342.21317 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2390.1987 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2358.19773 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2374.1995 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2342.21024 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2390.19779 (observed)  
A9632RPS15, RIG40S ribosomal protein S15GI:6677799;GI:94377390DMIILPEMVGSMVGVYNGK2358.20414 (observed)  
A1927DNM2, DYN2Dynamin 2GI:87299637DMILQFISR1266.70061 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DMLEASILDTYLGK1856.99553 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DMLEASILDTYLGK1856.99932 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DMLEASILDTYLGK1872.99259 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DMLEASILDTYLGK1872.99167 (observed)  
A5073PPLPeriplakinGI:112421039DMSIQELAVLVSGQK1906.06218 (observed)  
A5073PPLPeriplakinGI:112421039DMSIQELAVLVSGQK1922.0643 (observed)  
A5073PPLPeriplakinGI:112421039DMSIQELAVLVSGQK1922.05698 (observed)  
A5073PPLPeriplakinGI:112421039DMSIQELAVLVSGQK1906.06218 (observed)  
A0778MAP4Microtubule-associated protein 4GI:148747189DMSPLPESEVTLGK1790.9478 (observed)  
A0778MAP4Microtubule-associated protein 4GI:148747189DMSPLPESEVTLGK1790.9509 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277DMTSEELDDILR1580.76335 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277DMTSEELDDILR1596.75493 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277DMTSEELDDILR1580.76445 (observed)  
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorGI:21450277DMTSEELDDILR1596.75469 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915DNADGTYQVEYTPFEK2165.03618 (observed)  
A4814FLNB, FLN3, TAPFilamin-BGI:145966915DNADGTYQVEYTPFEK2165.03472 (observed)  
A4795EVPLEnvoplakinGI:111185907DNADPYTWLVQGPGGETK2236.1165 (observed)  
A4795EVPLEnvoplakinGI:111185907DNADPYTWLVQGPGGETK2236.11284 (observed)  
A3608ULIP, DPYSL3, LCRMPDihydropyrimidinase related protein-3GI:209862992;GI:6681219DNFTAIPEGTNGVEER1893.89214 (observed)  
A3608ULIP, DPYSL3, LCRMPDihydropyrimidinase related protein-3GI:209862992;GI:6681219DNFTAIPEGTNGVEER1893.89299 (observed)  
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2GI:40254595DNFTLIPEGTNGTEER1937.92119 (observed)  
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2GI:40254595DNFTLIPEGTNGTEER1937.92058 (observed)  
A0850VIMVimentinGI:31982755DNLAEDIMR1220.60649 (observed)  
A0850VIMVimentinGI:31982755DNLAEDIMR1236.60161 (observed)  
A0850VIMVimentinGI:31982755DNLAEDIMR1220.60625 (observed)  
A0850VIMVimentinGI:31982755DNLAEDIMR1236.60466 (observed)  
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5GI:13386442DNLAQQSFNMEQANYTIQSLK2731.37253 (observed)  
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5GI:13386442DNLAQQSFNMEQANYTIQSLK2731.37125 (observed)  
A3584FASN, FASFatty acid synthaseGI:93102409DNLEFFLTNLGK1698.93692 (observed)  
A3568PSMD126S proteasome non-ATPase regulatory subunit 1GI:74315975DNLEWLAR1160.62041 (observed)  
A3568PSMD126S proteasome non-ATPase regulatory subunit 1GI:74315975DNLEWLAR1160.62004 (observed)  
A1469F2Prothrombin precursorGI:6753798DNLSPPLGQCLTER1732.85173 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906DNLTLWTSDMQGDGEEQNK2469.14811 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906DNLTLWTSDMQGDGEEQNK2485.14383 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906DNLTLWTSDMQGDGEEQNK2469.14774 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906DNLTLWTSDMQGDGEEQNK2485.14054 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906DNLTLWTSDMQGDGEEQNKEALQDVEDENQ3739.67812 (observed)  
A0237COPB2Coatomer beta' subunitGI:29789080DNNQFASASLDR1481.71172 (observed)  
A8135UBR4, RBAF600, ZUBR1E3 ubiquitin-protein ligase UBR4GI:237820660DNPEATQQMNDLIIGK2075.07199 (observed)  
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1GI:6678483DNPGVVTCLDEAR1578.74114 (observed)  
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1GI:6678483DNPGVVTCLDEAR1578.73784 (observed)  
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorGI:161353502DNQSGSLLFIGR1450.77983 (observed)  
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorGI:161353502DNQSGSLLFIGR1450.77825 (observed)  
A0656DCTN2, DCTN50Dynactin 2GI:28076935DNTALLTQVQTTMR1735.91667 (observed)  
A0656DCTN2, DCTN50Dynactin 2GI:28076935DNTALLTQVQTTMR1735.9135 (observed)  
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorGI:153791270DNVEGFNCER1372.57305 (observed)  
A9635RPS17, RPS17L40S ribosomal protein S17GI:149261626;GI:149261791;GI:6677801DNYVPEVSALDQEIIEVDPDTK2777.41404 (observed)  
A9635RPS17, RPS17L40S ribosomal protein S17GI:149261626;GI:149261791;GI:6677801DNYVPEVSALDQEIIEVDPDTK2777.40909 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DPASESNPELLMFPSVYPGLR2479.23777 (observed)  
A1505COL7A1Collagen alpha 1(VII) chain precursorGI:115647999DPEAPLVVPGLR1406.81377 (observed)  
A1505COL7A1Collagen alpha 1(VII) chain precursorGI:115647999DPEAPLVVPGLR1406.81267 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556DPEGQPGGELMLGGTDSK2076.02226 (observed)  
A5984CTSD, CPSDCathepsin D precursorGI:6753556DPEGQPGGELMLGGTDSK2076.01738 (observed)  
A332CRAB7A, RAB7Ras-related protein Rab-7AGI:148747526DPENFPFVVLGNK1763.96611 (observed)  
A332CRAB7A, RAB7Ras-related protein Rab-7AGI:148747526DPENFPFVVLGNK1763.9655 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522DPETGFYMLQLAGK1857.97319 (observed)  
A4792EPPK1, EPIPLEpiplakin 1GI:37537522DPETGFYMLQLAGK1857.97527 (observed)  
A3584FASN, FASFatty acid synthaseGI:93102409DPETLLGYSMVGCQR1858.86955 (observed)  
A3584FASN, FASFatty acid synthaseGI:93102409DPETLLGYSMVGCQR1858.8693 (observed)  
A5453S100A11, MLN70, S100CCalgizzarinGI:149263303;GI:21886811DPGVLDR915.50261 (observed)  
A5453S100A11, MLN70, S100CCalgizzarinGI:149263303;GI:21886811DPGVLDR915.50395 (observed)  
A4795EVPLEnvoplakinGI:111185907DPLSGLLLLPAMLEGYR2002.12261 (observed)  
A6662GCLC, GLCL, GLCLCGlutamate-cysteine ligase catalytic subunitGI:33468897DPLTLFEEK1379.76995 (observed)  
A0098VCLVinculinGI:31543942DPNASPGDAGEQAIR1641.79314 (observed)  
A0098VCLVinculinGI:31543942DPNASPGDAGEQAIR1641.79704 (observed)  
A336ADDB1, XAP1DNA damage binding protein 1GI:7657011DPNTYFIVGTAMVYPEEAEPK2659.32969 (observed)  
A248CNUP205Nuclear pore complex protein Nup205GI:226437676DPPVFIPTPVDR1496.82451 (observed)  
A7179NSDHL, H105E3NAD(P)-dependent steroid dehydrogenaseGI:31982437DPQLVPILIDAAR1564.92241 (observed)  
A7179NSDHL, H105E3NAD(P)-dependent steroid dehydrogenaseGI:31982437DPQLVPILIDAAR1564.92339 (observed)  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinGI:183979966DPSPGQPSNFIVPFQEQAWQRPDGQPATR3394.67173 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917DPTVEFPPDLCSR1665.7758 (observed)  
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:134288917DPTVEFPPDLCSR1665.77788 (observed)  
A0097TLN1, TLNTalin 1GI:227116327;GI:163310736DPVQLNLLYVQAR1672.95098 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYSGNTISLFQAMK1960.01218 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYSGQSVSLFQALK1928.04544 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYSGQSVSLFQALK1928.04416 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYTEQTISLFQAMK2060.06668 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYTEQTISLFQAMK2060.06998 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DPYTGEQISLFQAMK2016.0474 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DQADPQCLFLR1495.71745 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DQADPQCLFLR1495.71672 (observed)  
A3967KIF5B, KNS, KNS1Kinesin family member 5BGI:61657921DQDNMQAELNR1477.68474 (observed)  
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:31980648DQEGQDVLLFIDNIFR2066.06938 (observed)  
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:31980648DQEGQDVLLFIDNIFR2066.0706 (observed)  
A5073PPLPeriplakinGI:112421039DQGPQESLVR1272.66557 (observed)  
A5073PPLPeriplakinGI:112421039DQGPQESLVR1272.66985 (observed)  
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6GI:33620739;GI:94363353;GI:94383790;GI:149265610;GI:149266035DQGTYEDYVEGLR1688.79021 (observed)  
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6GI:33620739;GI:94363353;GI:94383790;GI:149265610;GI:149266035DQGTYEDYVEGLR1688.78984 (observed)  
A7556PAICS, ADE2, AIRCMultifunctional protein ADE2GI:13385434DQITAGNAAR1160.61736 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:149271040;GI:149271078;GI:6754524;GI:257743039DQLIVNLLK1343.85515 (observed)  
A0370LDHA, PIG19L-lactate dehydrogenase A chainGI:149271040;GI:149271078;GI:6754524;GI:257743039DQLIVNLLK1343.85198 (observed)  
A0660ACTR1A, CTRN1Alpha-centractinGI:8392847DQLQTFSEEHPVLLTEAPLNPR2678.40049 (observed)  
A0660ACTR1A, CTRN1Alpha-centractinGI:8392847DQLQTFSEEHPVLLTEAPLNPR2678.39664 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589DQMQQQLSDYEQLLDVK2369.19577 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589DQMQQQLSDYEQLLDVK2369.19815 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589DQMQQQLSDYEQLLDVK2385.1948 (observed)  
A0430LMNB1, LMN2, LMNBLamin B1GI:188219589DQMQQQLSDYEQLLDVK2385.18601 (observed)  
A351CRBP2, CRBP2Retinol-binding protein II, cellularGI:255759938DQNGTWEMESNENFEGYMK2614.10172 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DQNTVETLQR1347.69951 (observed)  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:117938332;GI:117938334DQNTVETLQR1347.70317 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824DQPFTILYR1296.70842 (observed)  
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorGI:6753824DQPFTILYR1296.7083 (observed)  
A428DFAM49B, BM009, BM-009Protein FAM49BGI:21450053DQPPNSVEGLLNALR1766.95635 (observed)  
A428DFAM49B, BM009, BM-009Protein FAM49BGI:21450053DQPPNSVEGLLNALR1766.95366 (observed)  
A7276PADI4, PADI5, PDI5Protein-arginine deiminase type-4GI:156938252DQSTWTWGPGGR1491.71245 (observed)  
A7276PADI4, PADI5, PDI5Protein-arginine deiminase type-4GI:156938252DQSTWTWGPGGR1491.71111 (observed)  
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:225579033DQTNDQVTIDSALATQK2136.10508 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:6754254DQVANSAFVER1379.7061 (observed)  
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:6754254DQVANSAFVER1379.70427 (observed)  
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetaseGI:94364712;GI:82617575DQVDSAVQELLQLK1874.05405 (observed)  
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetaseGI:94364712;GI:82617575DQVDSAVQELLQLK1874.05442 (observed)  
A6566GALNT6, GALNAC-T6Polypeptide N-acetylgalactosaminyltransferase 6GI:240120031DQVLDFMLGAVNNIRDVMPK2580.31821 (observed)  
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21AGI:157823695;GI:157823731;GI:157823795;GI:157823761DQVLQNLGSVESYSEEK2213.12564 (observed)  
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21AGI:157823695;GI:157823731;GI:157823795;GI:157823761DQVLQNLGSVESYSEEK2213.12015 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DQYELLCLDNTR1672.7824 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DQYELLCLDNTR1672.78325 (observed)  
A376AEIF3B, EIF3S9Eukaryotic translation initiation factor 3 subunit 9GI:29789343DQYSVIFESGDR1559.74907 (observed)  
A376AEIF3B, EIF3S9Eukaryotic translation initiation factor 3 subunit 9GI:29789343DQYSVIFESGDR1559.74895 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DSAFGLLR1022.5772 (observed)  
A1437TERF1, PIN2, TRBF1Telomeric repeat binding factor 1GI:20330802DSAFGLLR1022.57726 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328704;GI:194328702;GI:194328706;GI:18700026;GI:194328708DSDGQVFGALASEPFK1956.00364 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328704;GI:194328702;GI:194328706;GI:18700026;GI:194328708DSDGQVFGALASEPFK1956.00144 (observed)  
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:110625954DSDSILETLQR1420.74089 (observed)  
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:110625954DSDSILETLQR1420.74199 (observed)  
A2046SMARCA4, BAF190A, BRG1SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A4GI:76253779DSEAGSSTPTTSTR1540.72344 (observed)  
A529CWISP, SNX9, SH3PX1Sorting nexin 9GI:149269540;GI:29568084DSEPAEAGGIQR1373.67734 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328702;GI:194328706;GI:18700026;GI:194328708DSETEVEELR1350.65068 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328702;GI:194328706;GI:18700026;GI:194328708DSETEVEELR1350.65288 (observed)  
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:13385322DSFPNFLACK1475.73186 (observed)  
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3GI:93102415DSGVDIAAGNMLVK1677.90715 (observed)  
A3796PURBTranscriptional activator protein Pur-betaGI:6755252DSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPR3399.62949 (observed)  
A3796PURBTranscriptional activator protein Pur-betaGI:6755252DSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPR3399.62766 (observed)  
A1395MSH2DNA mismatch repair protein Msh2GI:6678938DSLIIIDELGR1387.79424 (observed)  
A0524PFN1Profilin IGI:6755040DSLLQDGEFTMDLR1783.86637 (observed)  
A0524PFN1Profilin IGI:6755040DSLLQDGEFTMDLR1783.86931 (observed)  
A0524PFN1Profilin IGI:6755040DSLLQDGEFTMDLR1799.86301 (observed)  
A0524PFN1Profilin IGI:6755040DSLLQDGEFTMDLR1799.86228 (observed)  
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:125656150DSLSDEVVR1163.60222 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039DSNVCYGFR1250.54155 (observed)  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorGI:148277039DSNVCYGFR1250.5418 (observed)  
A753ACOBRA1, NELFBNegative elongation factor BGI:165377251DSPDLLLLLR1298.7813 (observed)  
A753ACOBRA1, NELFBNegative elongation factor BGI:165377251DSPDLLLLLR1298.78472 (observed)  
A0658DCTN1Dynactin 1GI:118601017DSPLLLQQISAMR1615.90044 (observed)  
A0658DCTN1Dynactin 1GI:118601017DSPLLLQQISAMR1615.89739 (observed)  
A0524PFN1Profilin IGI:6755040DSPSVWAAVPGK1501.82793 (observed)  
A0524PFN1Profilin IGI:6755040DSPSVWAAVPGK1501.83049 (observed)  
A5974CAPN5, NCL3Calpain 5GI:6680846DSPTGANSYVIIK1652.91338 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DSQDAGGFGPEDR1494.65959 (observed)  
A1941PLEC1, PLECPlectinGI:256000745;GI:256418964;GI:254675117;GI:254675195;GI:254675201;GI:254675251;GI:254675253;GI:254675259;GI:254675119;GI:254675244;GI:254675265;GI:254675115DSQDAGGFGPEDR1494.66069 (observed)  
A0240CRKAdapter molecule CRKGI:31559995DSSTSPGDYVLSVSENSR2043.95915 (observed)  
A0240CRKAdapter molecule CRKGI:31559995DSSTSPGDYVLSVSENSR2043.95537 (observed)  
A050BSRRM1, SRM160Serine/arginine repeptitive matrix protein 1GI:194440682;GI:194440687DSSVQEATSTSDILK1868.96811 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0280YWHAE14-3-3 protein epsilonGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0361YWHAZ14-3-3 protein zeta/deltaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0362YWHAG14-3-3 protein gammaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0362YWHAG14-3-3 protein gammaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0362YWHAG14-3-3 protein gammaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0362YWHAG14-3-3 protein gammaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0467YWHAB14-3-3 protein beta/alphaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0467YWHAB14-3-3 protein beta/alphaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0467YWHAB14-3-3 protein beta/alphaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0467YWHAB14-3-3 protein beta/alphaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0633YWHAH, YWHA114-3-3 protein etaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0633YWHAH, YWHA114-3-3 protein etaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0633YWHAH, YWHA114-3-3 protein etaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0633YWHAH, YWHA114-3-3 protein etaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0901SFN, HME114-3-3 protein sigmaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0901SFN, HME114-3-3 protein sigmaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0901SFN, HME114-3-3 protein sigmaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0901SFN, HME114-3-3 protein sigmaGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0907YWHAQ14-3-3 protein tauGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76518 (observed)  
A0907YWHAQ14-3-3 protein tauGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76056 (observed)  
A0907YWHAQ14-3-3 protein tauGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1333.76457 (observed)  
A0907YWHAQ14-3-3 protein tauGI:226874906;GI:31543976;GI:149251472;GI:149263879;GI:134023662;GI:6756037;GI:6756041;GI:6756039;GI:31543974DSTLIMQLLR1349.76238 (observed)  
A0364RAB6A', RAB6B, RAB6ARas-related protein Rab-6AGI:13195674DSTVAVVVYDITNVNSFQQTTK2717.43491 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149255637;GI:149255639;GI:149255641DSTYSMSSTLTLTK1822.94304 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149255637;GI:149255639;GI:149255641DSTYSMSSTLTLTK1838.93552 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149255637;GI:149255639;GI:149255641DSTYSMSSTLTLTK1822.94023 (observed)  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:149255637;GI:149255639;GI:149255641DSTYSMSSTLTLTK1838.94145 (observed)  
A3804EEF2, EF2Elongation factor 2GI:33859482DSVVAGFQWATK1596.86687 (observed)  
A2563CIRBP, A18HNRNP, CIRPCold-inducible RNA-binding proteinGI:6680946DSYDSYATHNE1445.59746 (observed)  
A8958PSMC3, TBP126S protease regulatory subunit 6AGI:228008337DSYLILETLPTEYDSR2059.03569 (observed)  
A8958PSMC3, TBP126S protease regulatory subunit 6AGI:228008337DSYLILETLPTEYDSR2059.04082 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240DSYVGDEAQSK1486.73699 (observed)  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:6671509;GI:6752954;GI:6671507;GI:157823889;GI:14192922;GI:33563240DSYVGDEAQSK1486.73039 (observed)  
A5157SRPX, ETX1Sushi repeat-containing protein SRPX precursorGI:8394362DTADGILTDVILK1661.95964 (observed)  
A5157SRPX, ETX1Sushi repeat-containing protein SRPX precursorGI:8394362DTADGILTDVILK1661.96024 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DTANWLEINPETGAIFTR2192.11521 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DTANWLEINPETGAIFTR2192.12187 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765DTCFSTEGPNLVTR1729.80559 (observed)  
A1581ALB, GIG20, GIG42Serum albumin precursorGI:163310765DTCFSTEGPNLVTR1729.80301 (observed)  
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorGI:46560582;GI:6681283DTCPPLMLYNPTTYQMDVNPEGK2961.36802 (observed)  
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitGI:112363072DTDAAVGDNIGYITFVLFPR2328.20707 (observed)  
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitGI:112363072DTDAAVGDNIGYITFVLFPR2328.20853 (observed)  
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitGI:9790141DTDIVDEAIYYFK1879.96616 (observed)  
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitGI:9790141DTDIVDEAIYYFK1879.95769 (observed)  
A0008CALM1, CALM2, CALM3CalmodulinGI:6753244;GI:149255339;GI:13386230DTDSEEEIR1237.56885 (observed)  
A0008CALM1, CALM2, CALM3CalmodulinGI:6753244;GI:149255339;GI:13386230DTDSEEEIR1237.57219 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:6753244;GI:149255339;GI:13386230DTDSEEEIR1237.56885 (observed)  
A8693CALML3Calmodulin-related protein NB-1GI:6753244;GI:149255339;GI:13386230DTDSEEEIR1237.57219 (observed)  
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:117606335DTDTGALLFIGR1422.77324 (observed)  
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:117606335DTDTGALLFIGR1422.77544 (observed)  
A5974CAPN5, NCL3Calpain 5GI:6680846DTFFQNPQYVFEVK2050.05327 (observed)  
A5974CAPN5, NCL3Calpain 5GI:6680846DTFFQNPQYVFEVK2050.05864 (observed)  
A541BMXRA7, TMAP1, PS1TP1Matrix-remodelling associated protein 7GI:58037101DTFGEMSDGDMQEQLR2002.86064 (observed)  
A541BMXRA7, TMAP1, PS1TP1Matrix-remodelling associated protein 7GI:58037101DTFGEMSDGDMQEQLR2002.85845 (observed)  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorGI:7305007DTGNLYCTGR1289.57463 (observed)  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorGI:7305007DTGNLYCTGR1289.57073 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DTGVISVLTSGLDR1576.87126 (observed)  
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorGI:6753374DTGVISVLTSGLDR1576.87163 (observed)  
A4177OXR1Oxidation resistance protein 1GI:194328702;GI:194328706;GI:18700026;GI:194328708DTIQQVSQR1218.65911 (observed)  
A4709COL14A1, UNDCollagen alpha-1(XIV) chain precursorGI:226423922DTLFTSDSGTR1343.65654 (observed)  
A1929DNM1L, DLP1, DRP1Dynamin-like proteinGI:71061458;GI:71061455DTLQSELVGQLYK1781.99979 (observed)  
A3813RPL10A, NEDD660S ribosomal protein L10aGI:149233917DTLYEAVR1110.59319 (observed)  
A3813RPL10A, NEDD660S ribosomal protein L10aGI:149233917DTLYEAVR1110.59123 (observed)  
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 1GI:77404392DTNGENIAESLVAEGLATR2105.04563 (observed)  
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 1GI:77404392DTNGENIAESLVAEGLATR2105.05387 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DTNGSQFFITTVK1746.92107 (observed)  
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorGI:71774133DTNGSQFFITTVK1746.92485 (observed)  
A1543F3Tissue factor precursorGI:170172540DTNLGQPVIQQFEQDGR2089.04839 (observed)  
A1543F3Tissue factor precursorGI:170172540DTNLGQPVIQQFEQDGR2089.04692 (observed)  
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 1GI:77404392DTPDEPWAFPAR1545.74809 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889DTPFPNAWQGQGEETQVEAK2520.22611 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889DTPFPNAWQGQGEETQVEAK2520.22611 (observed)  
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinGI:42476274DTPTQEDWLVSVLPEGSR2173.09136 (observed)  
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinGI:42476274DTPTQEDWLVSVLPEGSR2173.09014 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889DTPVLSELPEPVVAR1765.98674 (observed)  
A204AAEBP1, ACLPAdipocyte enhancer-binding protein 1GI:160707889DTPVLSELPEPVVAR1765.9843 (observed)  
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:33859811DTTASAVAVGLR1304.72722 (observed)  
A0405ATP6V1F, ATP6S14, VATFV-type proton ATPase subunit FGI:21314824DTTINEIEDTFR1597.78594 (observed)  
A0405ATP6V1F, ATP6S14, VATFV-type proton ATPase subunit FGI:21314824DTTINEIEDTFR1597.78118 (observed)  
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM2GI:172088119DTVDPVQDEMLAR1632.80852 (observed)  
A6983MCM2, BM28, CCNL1DNA replication licensing factor MCM2GI:172088119DTVDPVQDEMLAR1632.80815 (observed)  
A0778MAP4Microtubule-associated protein 4GI:148747189DVAPPMEEEIVPGNDTTSPK2414.19724 (observed)  
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:13385006DVATFLR965.55211 (observed)  
A2096SEC13, D3S1231E, SEC13L1Protein SEC13 homologGI:29150272DVAWAPSIGLPTSTIASCSQDGR2522.2172 (observed)  
A2096SEC13, D3S1231E, SEC13L1Protein SEC13 homologGI:29150272DVAWAPSIGLPTSTIASCSQDGR2522.21848 (observed)  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4GI:133778953DVDAAYMIK1313.71391 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66765 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65996 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66521 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65788 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66765 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65996 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66521 (observed)  
A1669KRT5Keratin, type II cytoskeletal 5GI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65788 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66765 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65996 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1314.66521 (observed)  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AGI:20911031;GI:54607171;GI:47523977;GI:269914154DVDAAYMNK1330.65788 (observed)  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BGI:113195684DVDAAYMTK1301.66802 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DVDEIEAWISEK1721.88396 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DVDETIGWIK1463.79228 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DVDETIGWIK1463.80498 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DVDEVSSLLR1276.68804 (observed)  
A3542CCT8, CCTQT-complex protein 1, theta subunitGI:126723461DVDEVSSLLR1276.6906 (observed)  
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitGI:6671702DVDFELIK1266.73015 (observed)  
A9491TACSTD2, GA733-1, M1S1Tumor-associated calcium signal transducer 2 precursorGI:31560359DVDIADAAYYFER1691.80657 (observed)  
A9491TACSTD2, GA733-1, M1S1Tumor-associated calcium signal transducer 2 precursorGI:31560359DVDIADAAYYFER1691.81194 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DVDIDSYPDEELPCSAR2113.91997 (observed)  
A5234THBS4, TSP4Thrombospondin 4 precursorGI:6755781DVDIDSYPDEELPCSAR2113.91899 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011DVDLEFLAK1337.7564 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011DVDLEFLAK1337.7592 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011DVDLEFLAK1337.7564 (observed)  
A3918VCPTransitional endoplasmic reticulum ATPaseGI:225543319;GI:94408011DVDLEFLAK1337.7592 (observed)  
A6905LTA4H, LTA4Leukotriene A-4 hydrolaseGI:116734870DVDPDVAYSSIPYEK1985.99419 (observed)  
A6905LTA4H, LTA4Leukotriene A-4 hydrolaseGI:116734870DVDPDVAYSSIPYEK1985.99736 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220DVEAWFFSK1416.74919 (observed)  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15GI:226823220DVEAWFFSK1416.7487 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DVEDEETWIR1435.68523 (observed)  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:115496850DVEDEETWIR1435.68596 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DVEDEILWVTER1647.83721 (observed)  
A5153SPTBN2, SCA5Spectrin beta chain, brain 2GI:55926127DVEDEILWVTER1647.84148 (observed)  
A8502SERPINB5, PI5Maspin precursorGI:6678103DVEDESTGLEK1509.75591 (observed)  
A8502SERPINB5, PI5Maspin precursorGI:6678103DVEDESTGLEK1509.76152 (observed)