PADB-logoLSSR - PepMap molecular information by study

Study ID 21538913
Species human
Disease cancer (upper GI)
Tissue / Source urine
Compartment whole

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  MS2 score: 19
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  MS2 score: 36
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  MS2 score: 46
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  MS2 score: 33
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  MS2 score: 8
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  MS2 score: 18
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMAN-.MSGLR.V  MS2 score: 4
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMAN-.MSGLRVYSTSVTGSR.E  MS2 score: 1
A107AS100A12Protein S100-A12S10AC_HUMAN-.MTKLEEHLEGIVNIFHQYSVR.K  MS2 score: 13
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  MS2 score: 47
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  MS2 score: 44
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  MS2 score: 3
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 9
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 5
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 8
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 26
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 28
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 18
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  MS2 score: 32
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  MS2 score: 25
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  MS2 score: 39
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  MS2 score: 17
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  MS2 score: 4
A107AS100A12Protein S100-A12S10AC_HUMANK.AAHYHTHK.E  MS2 score: 7
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANK.AALEDTLAETEAR.F  MS2 score: 0
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  MS2 score: 30
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  MS2 score: 19
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  MS2 score: 30
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  MS2 score: 22
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  MS2 score: 38
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  MS2 score: 2
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  MS2 score: 18
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  MS2 score: 13
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 33
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 26
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 10
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  MS2 score: 34
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  MS2 score: 20
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  MS2 score: 2
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMANK.AENARLVVEIDNAK.L  MS2 score: 4
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AFAHLQVPER.V  MS2 score: 2
A3616ENO2Gamma enolaseENOG_HUMANK.AGAAERELPLYR.H  MS2 score: 0
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  MS2 score: 31
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  MS2 score: 31
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  MS2 score: 24
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  MS2 score: 24
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  MS2 score: 31
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating6PGD_HUMANK.AGQAVDDFIEK.L  MS2 score: 5
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.AKGQPR.E  MS2 score: 9
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANK.ALAAELNQLR.A  MS2 score: 3
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  MS2 score: 27
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNRLR.K  MS2 score: 4
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  MS2 score: 36
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  MS2 score: 34
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  MS2 score: 30
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  MS2 score: 36
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  MS2 score: 36
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  MS2 score: 6
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  MS2 score: 9
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  MS2 score: 24
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  MS2 score: 29
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  MS2 score: 12
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  MS2 score: 34
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  MS2 score: 34
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  MS2 score: 45
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  MS2 score: 41
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  MS2 score: 19
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  MS2 score: 23
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  MS2 score: 23
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  MS2 score: 21
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  MS2 score: 25
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  MS2 score: 25
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  MS2 score: 22
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  MS2 score: 18
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  MS2 score: 25
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  MS2 score: 22
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  MS2 score: 25
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANK.ARLEGEIATYR.H  MS2 score: 22
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ASCLYGQLPK.F  MS2 score: 2
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ASLEGNLAETENR.Y  MS2 score: 28
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETK.G  MS2 score: 16
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETK.G  MS2 score: 26
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETK.G  MS2 score: 16
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETK.G  MS2 score: 26
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETKGR.Y  MS2 score: 15
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETKGR.Y  MS2 score: 33
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  MS2 score: 15
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  MS2 score: 33
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ATEDEGSEQKIPEATNR.R  MS2 score: 40
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.ATEHLSTLSEK.A  MS2 score: 15
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ATMQNLNDR.L  MS2 score: 29
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ATMQNLNDR.L  MS2 score: 24
A7989TKT, TKT1TransketolaseTKT_HUMANK.AVELAANTK.G  MS2 score: 6
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.AVGKVIPELNGK.L  MS2 score: 6
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  MS2 score: 24
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  MS2 score: 36
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  MS2 score: 30
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  MS2 score: 42
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  MS2 score: 10
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  MS2 score: 30
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  MS2 score: 17
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  MS2 score: 6
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  MS2 score: 34
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  MS2 score: 0
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.CCKADDK.E  MS2 score: 5
A6606GK2, GKP2, GKTAGlycerol kinase, testis specific 2GLPK2_HUMANK.CVFSEHGLLTTVAYKLGR.E  MS2 score: 2
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  MS2 score: 13
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  MS2 score: 4
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  MS2 score: 10
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  MS2 score: 10
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  MS2 score: 13
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  MS2 score: 13
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  MS2 score: 13
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.DAEDWFFSKTEELNR.E  MS2 score: 13
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  MS2 score: 28
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  MS2 score: 17
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  MS2 score: 25
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 7
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 9
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 5
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 6
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 14
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 7
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  MS2 score: 13
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  MS2 score: 3
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  MS2 score: 27
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DGSLR.V  MS2 score: 3
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DGSLR.V  MS2 score: 3
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DGSLR.V  MS2 score: 7
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 35
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 59
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 40
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 33
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 39
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 35
A274ES100P, S100ES-100P proteinS100P_HUMANK.DKDAVDK.L  MS2 score: 27
A274ES100P, S100ES-100P proteinS100P_HUMANK.DKDAVDK.L  MS2 score: 32
A274ES100P, S100ES-100P proteinS100P_HUMANK.DKDAVDK.L  MS2 score: 35
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DLGEENFK.A  MS2 score: 0
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DLGEENFK.A  MS2 score: 11
A0536S100A6, CACYCalcyclinS10A6_HUMANK.DQEVNFQEYVTFLGALALIYNEALKG.-  MS2 score: 27
A0536S100A6, CACYCalcyclinS10A6_HUMANK.DQEVNFQEYVTFLGALALIYNEALKG.-  MS2 score: 7
A0536S100A6, CACYCalcyclinS10A6_HUMANK.DQEVNFQEYVTFLGALALIYNEALKG.-  MS2 score: 26
A0536S100A6, CACYCalcyclinS10A6_HUMANK.DQEVNFQEYVTFLGALALIYNEALKG.-  MS2 score: 19
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DQIVDLTVGNNK.T  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.DQIVDLTVGNNK.T  MS2 score: 4
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANK.DQLIYNLLKEEQTPQNK.I  MS2 score: 31
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.DSAIGFSR.V  MS2 score: 50
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.DSFSIFCETGYELLQGHLPLKSFTAVCQK.D  MS2 score: 2
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.DSQEEEKTEALTSAK.R  MS2 score: 41
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 23
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 24
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 16
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 31
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 25
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.DSTYSLSSTLTLSK.A  MS2 score: 34
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.DSYVGDEAQSK.R  MS2 score: 36
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.DSYVGDEAQSK.R  MS2 score: 36
A7989TKT, TKT1TransketolaseTKT_HUMANK.DTANRLR.I  MS2 score: 9
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DVCKNYAEAK.D  MS2 score: 5
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.DVDAAYMNK.V  MS2 score: 7
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.DVDAAYMNK.V  MS2 score: 7
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.DVDAAYMNK.V  MS2 score: 7
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.DVDAAYMNKVELEAK.V  MS2 score: 20
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.DVDAAYMNKVELEAK.V  MS2 score: 9
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.DVDAAYMNKVELQAK.A  MS2 score: 28
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.DVDAAYMNKVELQAK.A  MS2 score: 28
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.DVDAAYMNKVELQAK.A  MS2 score: 53
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.DVDAAYMNKVELQAK.A  MS2 score: 28
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.DVDAAYMNKVELQAK.V  MS2 score: 53
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DVDGAYMTK.V  MS2 score: 5
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DVDGAYMTK.V  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DVDGAYMTK.V  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DVDGAYMTK.V  MS2 score: 13
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DVDGAYMTK.V  MS2 score: 4
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DVFLGMFLYEYAR.R  MS2 score: 40
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DVFLGMFLYEYAR.R  MS2 score: 32
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DVFLGMFLYEYAR.R  MS2 score: 22
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DYSPYFK.T  MS2 score: 6
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DYSPYFK.T  MS2 score: 6
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DYSPYFK.T  MS2 score: 11
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.DYSPYFK.T  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.DYSPYFK.T  MS2 score: 11
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DYSPYFKTIEDLR.N  MS2 score: 3
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.DYSPYFKTIEDLR.N  MS2 score: 3
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.EAESFMR.T  MS2 score: 0
A3617ENO3Beta enolaseENOB_HUMANK.EAMRIGAEVYHHLK.G  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.EDLAR.L  MS2 score: 15
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.EDLAR.L  MS2 score: 15
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.EIETYHNLLEGGQEDFESSGAGK.I  MS2 score: 44
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.EIETYHNLLEGGQEDFESSGAGK.I  MS2 score: 18
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.EIETYHNLLEGGQEDFESSGAGK.I  MS2 score: 27
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.EIPAWVPFDPAAQITK.Q  MS2 score: 6
A107AS100A12Protein S100-A12S10AC_HUMANK.ELANTIK.N  MS2 score: 12
A107AS100A12Protein S100-A12S10AC_HUMANK.ELANTIK.N  MS2 score: 16
A107AS100A12Protein S100-A12S10AC_HUMANK.ELANTIKNIK.D  MS2 score: 8
A107AS100A12Protein S100-A12S10AC_HUMANK.ELANTIKNIK.D  MS2 score: 6
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ELDINTDGAVNFQEFLILVIK.M  MS2 score: 48
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ELDINTDGAVNFQEFLILVIK.M  MS2 score: 40
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ELDINTDGAVNFQEFLILVIK.M  MS2 score: 47
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQK.E  MS2 score: 23
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQK.E  MS2 score: 23
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQK.E  MS2 score: 25
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQKELTIGSK.L  MS2 score: 0
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQKELTIGSK.L  MS2 score: 34
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELIQKELTIGSK.L  MS2 score: 15
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELKELIQK.E  MS2 score: 5
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELKELIQK.E  MS2 score: 7
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGK.D  MS2 score: 27
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGK.D  MS2 score: 8
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGK.D  MS2 score: 16
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGK.D  MS2 score: 12
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGK.D  MS2 score: 7
A274ES100P, S100ES-100P proteinS100P_HUMANK.ELPGFLQSGKDK.D  MS2 score: 14
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 19
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 15
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 20
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 37
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 28
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSK.L  MS2 score: 29
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSKLQDAEIAR.L  MS2 score: 26
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSKLQDAEIAR.L  MS2 score: 2
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSKLQDAEIAR.L  MS2 score: 41
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSKLQDAEIAR.L  MS2 score: 18
A0536S100A6, CACYCalcyclinS10A6_HUMANK.ELTIGSKLQDAEIAR.L  MS2 score: 0
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ELTTEIDNNIEQISSYK.S  MS2 score: 42
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ELTTEIDNNIEQISSYK.S  MS2 score: 42
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ELTTEIDNNIEQISSYK.S  MS2 score: 35
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ELTTEIDNNIEQISSYK.S  MS2 score: 58
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.ENGGAR.L  MS2 score: 1
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ENQLEVLEVSWLHGLK.A  MS2 score: 17
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.EQSSSSFSQGQSS.-  MS2 score: 3
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.EQSSSSFSQGQSS.-  MS2 score: 28
A1256UBBPolyubiquitin-BUBIQ_HUMANK.ESTLHLVLR.L  MS2 score: 40
A1256UBBPolyubiquitin-BUBIQ_HUMANK.ESTLHLVLRLR.G  MS2 score: 4
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.EVASNSELVQSSR.S  MS2 score: 13
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.EVASNSELVQSSR.S  MS2 score: 20
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANK.EVASNTEMIQTSK.T  MS2 score: 0
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.EVTQLRHGVQELEIELQSQLSK.K  MS2 score: 33
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.EYQELMNVK.L  MS2 score: 7
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.EYQELMNVK.L  MS2 score: 7
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.EYQELMNVK.L  MS2 score: 7
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.FASFIDK.V  MS2 score: 13
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.FASFIDK.V  MS2 score: 13
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.FASFIDK.V  MS2 score: 13
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.FASFIDK.V  MS2 score: 13
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.FETEQALR.L  MS2 score: 5
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANK.FETEQALR.M  MS2 score: 5
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_HUMANK.FLASVSTVLTSK.Y  MS2 score: 7
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.FQDGDLTLYQSNTILR.H  MS2 score: 44
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.FQDGDLTLYQSNTILR.H  MS2 score: 67
A5984CTSD, CPSDCathepsin D precursorCATD_HUMANK.FTSIR.R  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.FVSTTSSSR.K  MS2 score: 6
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GADVWFK.E  MS2 score: 30
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GADVWFK.E  MS2 score: 30
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.GDEEGVPAVVIDMSGLR.E  MS2 score: 3
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.GEADAMSLDGGYVYTAGK.C  MS2 score: 33
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.GGSFQLNELQGLK.S  MS2 score: 10
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.GGSISGGGYGSGGGK.H  MS2 score: 27
A107AS100A12Protein S100-A12S10AC_HUMANK.GHFDTLSK.G  MS2 score: 18
A107AS100A12Protein S100-A12S10AC_HUMANK.GHFDTLSK.G  MS2 score: 37
A107AS100A12Protein S100-A12S10AC_HUMANK.GHFDTLSKGELK.Q  MS2 score: 28
A0361YWHAZ14-3-3 protein zeta/delta1433Z_HUMANK.GIVDQSQQAYQEAFEISK.K  MS2 score: 45
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18K1C18_HUMANK.GLQAQIASSGLTVEVDAPK.S  MS2 score: 1
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_HUMANK.GNDISSGTVLSDYVGSGPPK.G  MS2 score: 25
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GNFHAVYR.D  MS2 score: 29
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GNFHAVYR.D  MS2 score: 39
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GNFHAVYRDDLK.K  MS2 score: 17
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.GNFHAVYRDDLK.K  MS2 score: 20
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.GPGEDFR.M  MS2 score: 35
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.GQFPNLCRLCAGTGENK.C  MS2 score: 1
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 52
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 32
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 24
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 41
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 37
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 47
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 59
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.GSLGGGFSSGGFSGGSFSR.G  MS2 score: 38
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.GSSGLGGGSSR.T  MS2 score: 1
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.GSSGLGGGSSRTSCR.L  MS2 score: 3
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.GSSGLGGGSSRTSCR.L  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.GSVYIGGAPDVATLTGGR.F  MS2 score: 17
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.GSVYIGGAPDVATLTGGR.F  MS2 score: 28
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANK.GVCEETSGAYEK.T  MS2 score: 5
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.HDASALDIR.M  MS2 score: 4
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.HDASALDIR.M  MS2 score: 4
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.HEISEMNR.M  MS2 score: 0
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.HGDDLRR.T  MS2 score: 3
A0536S100A6, CACYCalcyclinS10A6_HUMANK.HTLSK.K  MS2 score: 22
A0536S100A6, CACYCalcyclinS10A6_HUMANK.HTLSK.K  MS2 score: 23
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.HVEDVPAFQALGSLNDLQFFR.Y  MS2 score: 57
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.HVEDVPAFQALGSLNDLQFFR.Y  MS2 score: 44
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.HYSSSR.S  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.HYSSSR.S  MS2 score: 1
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.IDVHWTR.A  MS2 score: 11
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.IDVHWTR.A  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 15
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 5
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 24
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 37
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNR.V  MS2 score: 30
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNR.V  MS2 score: 15
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNR.V  MS2 score: 16
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNR.V  MS2 score: 37
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNR.V  MS2 score: 30
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNRVIQR.L  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNRVIQR.L  MS2 score: 4
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNRVIQR.L  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNRVIQR.L  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.IEISELNRVIQR.L  MS2 score: 5
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNRVIQR.L  MS2 score: 16
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNRVIQR.L  MS2 score: 17
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.IEISELNRVIQR.L  MS2 score: 5
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IFHGLK.S  MS2 score: 10
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IFHGLKSTDVAK.T  MS2 score: 7
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IGLFADIELSR.N  MS2 score: 19
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IGLFADIELSR.N  MS2 score: 12
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IGLFADIELSRNEALIALLR.E  MS2 score: 27
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGR.G  MS2 score: 1
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGR.G  MS2 score: 0
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGRGGSGGSYGR.G  MS2 score: 14
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGRGGSGGSYGR.G  MS2 score: 17
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGRGGSGGSYGR.G  MS2 score: 10
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGRGGSGGSYGR.G  MS2 score: 1
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.IGLGGRGGSGGSYGR.G  MS2 score: 16
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.IGNFSTDIKDSK.A  MS2 score: 2
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.IIAATIENAQPILQIDNAR.L  MS2 score: 50
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.IIAATIENAQPILQIDNAR.L  MS2 score: 77
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating6PGD_HUMANK.IISYAQGFMLLR.Q  MS2 score: 18
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.IKEWYEK.H  MS2 score: 10
A7989TKT, TKT1TransketolaseTKT_HUMANK.ILATPPQEDAPSVDIANIR.M  MS2 score: 8
A4168NEDD8, NEDD8-MDP1Ubiquitin-like protein NEDD8NEDD8_HUMANK.ILGGSVLHLVLALR.G  MS2 score: 33
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ILLDVK.T  MS2 score: 11
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ILLDVK.T  MS2 score: 11
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ILTATVDNANILLQIDNAR.L  MS2 score: 66
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ILTATVDNANILLQIDNAR.L  MS2 score: 61
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ILTATVDNANVLLQIDNAR.L  MS2 score: 45
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ILTATVDNANVLLQIDNAR.L  MS2 score: 37
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.ILTEHGYRFTTMAER.E  MS2 score: 2
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.ILTER.G  MS2 score: 9
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.ILTER.G  MS2 score: 9
A1256UBBPolyubiquitin-BUBIQ_HUMANK.IQDKEGIPPDQQR.L  MS2 score: 3
A1256UBBPolyubiquitin-BUBIQ_HUMANK.IQDKEGIPPDQQR.L  MS2 score: 38
A1819B2M, HDCMA22PBeta-2-microglobulin precursorB2MG_HUMANK.IQVYSR.H  MS2 score: 7
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.IRDWYQR.Q  MS2 score: 6
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.IRDWYQR.Q  MS2 score: 6
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.IRDWYQR.Q  MS2 score: 6
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.IRDWYQR.Q  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.IRDWYQR.Q  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.IRDWYQR.Q  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.IRLENEIQTYR.S  MS2 score: 23
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.IRLENEIQTYR.S  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.IRLENEIQTYR.S  MS2 score: 15
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.IRLENEIQTYR.S  MS2 score: 15
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ITDLIK.D  MS2 score: 7
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.ITFRPDSADGMLLYNGQKR.V  MS2 score: 0
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ITLLSALVETR.T  MS2 score: 19
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ITLLSALVETR.T  MS2 score: 32
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.IWHHTFYNELR.V  MS2 score: 13
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.IWHHTFYNELR.V  MS2 score: 13
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.KDVDAAYMNK.V  MS2 score: 2
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.KDVDAAYMNK.V  MS2 score: 2
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.KDVDAAYMNK.V  MS2 score: 2
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.KDVDEAYMNK.V  MS2 score: 1
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.KGADVWFK.E  MS2 score: 20
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.KGGSFQLNELQGLK.S  MS2 score: 16
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.KGPAAIQK.N  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.KGPAAIQK.N  MS2 score: 13
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.KGPAAIQK.N  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.KGPAAIQK.N  MS2 score: 11
A7355PGA4Pepsin A-4PEPA_HUMANK.KHNLNPAR.K  MS2 score: 24
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KLVAASQAALGL.-  MS2 score: 18
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KLVAASQAALGL.-  MS2 score: 15
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.KNHEEEMNALR.G  MS2 score: 0
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.KNHEEEMNALR.G  MS2 score: 2
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.KNHEEEMNALR.G  MS2 score: 0
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.KNHEEEMNALR.G  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.KQISNLQQSISDAEQR.G  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.KQISNLQQSISDAEQR.G  MS2 score: 28
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KQTALVELVK.H  MS2 score: 15
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KQTALVELVK.H  MS2 score: 17
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KQTALVELVK.H  MS2 score: 9
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KQTALVELVK.H  MS2 score: 6
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANK.KSADTLWGIQK.E  MS2 score: 5
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 43
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 42
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 34
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 48
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 16
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 40
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.KVPQVSTPTLVEVSR.N  MS2 score: 23
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANK.LAADDFR.T  MS2 score: 36
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMANK.LAADDFR.T  MS2 score: 36
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIKT33B_HUMANK.LAADDFR.T  MS2 score: 36
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.LAELEEALQK.A  MS2 score: 20
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.LAELEEALQKAK.Q  MS2 score: 5
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANK.LALDIEIATYR.K  MS2 score: 36
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.LALDIEIATYR.K  MS2 score: 36
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANK.LALDIEIATYR.K  MS2 score: 36
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.LALDIEIATYR.K  MS2 score: 36
A3862KRT80, KB20Keratin B20K2C80_HUMANK.LALDIEIATYR.K  MS2 score: 36
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 25
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 36
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 21
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LALDLEIATYR.T  MS2 score: 16
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.LALDVEIATYR.K  MS2 score: 19
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.LALDVEIATYR.K  MS2 score: 19
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.LALDVEIATYR.K  MS2 score: 19
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.LALDVEIATYR.K  MS2 score: 34
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.LALDVEIATYR.K  MS2 score: 19
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.LALDVEIATYR.K  MS2 score: 19
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.LALDVEIATYRK.L  MS2 score: 18
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.LALDVEIATYRK.L  MS2 score: 18
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.LALDVEIATYRK.L  MS2 score: 18
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.LAMQEFMILPVGAANFR.E  MS2 score: 1
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.LAQANGWGVMVSHR.S  MS2 score: 13
A3617ENO3Beta enolaseENOB_HUMANK.LAQSNGWGVMVSHR.S  MS2 score: 7
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LCTVATLR.E  MS2 score: 3
A7989TKT, TKT1TransketolaseTKT_HUMANK.LDNLVAILDINR.L  MS2 score: 2
A107AS100A12Protein S100-A12S10AC_HUMANK.LEEHLEGIVNIFHQYSVR.K  MS2 score: 8
A107AS100A12Protein S100-A12S10AC_HUMANK.LEEHLEGIVNIFHQYSVR.K  MS2 score: 39
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.LEGLEDALQK.A  MS2 score: 21
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.LEGLEDALQK.A  MS2 score: 21
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.LEGLEDALQK.A  MS2 score: 7
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.LEGLEDALQK.A  MS2 score: 21
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANK.LGHPDTLNQGEFK.E  MS2 score: 25
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANK.LGHPDTLNQGEFK.E  MS2 score: 16
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.LISWYDNEFGYSNR.V  MS2 score: 42
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.LLETECPQYIR.K  MS2 score: 24
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.LLETECPQYIR.K  MS2 score: 21
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANK.LLIVSNPVDILTYVAWK.I  MS2 score: 40
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LNDLEDALQQAK.E  MS2 score: 15
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LNDLEDALQQAK.E  MS2 score: 30
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.LNDLEDALQQAKEDLAR.L  MS2 score: 45
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.LNLAFIANLFNR.Y  MS2 score: 50
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_HUMANK.LNPNFLVDFGKEPLGPALAHELR.Y  MS2 score: 42
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.LNVTEQEK.I  MS2 score: 4
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 36
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 43
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 35
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 42
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 39
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 65
A0536S100A6, CACYCalcyclinS10A6_HUMANK.LQDAEIAR.L  MS2 score: 52
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.LQELHLSSNGLESLSPEFLRPVPQLR.V  MS2 score: 43
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.LQHLENELTHDIITK.F  MS2 score: 0
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.LRPVAAEVYGTER.Q  MS2 score: 21
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_HUMANK.LRVDPVNFK.L  MS2 score: 3
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.LSITGTYDLK.S  MS2 score: 8
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.LSITGTYDLK.S  MS2 score: 8
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.LSPEELLLR.W  MS2 score: 16
A8051PRSS3, mesotrypsinogen, PRSS4Trypsin III precursorTRY3_HUMANK.LSSPAVINAR.V  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 36
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 28
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 45
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 4
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 37
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 35
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 10
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVAASQAALGL.-  MS2 score: 25
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.LVINGNPITIFQER.D  MS2 score: 45
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 17
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 5
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 28
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 18
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 19
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVNEVTEFAK.T  MS2 score: 24
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating6PGD_HUMANK.LVPLLDTGDIIIDGGNSEYR.D  MS2 score: 63
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.LVTDLTK.V  MS2 score: 22
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_HUMANK.LYTLVLTDPDAPSR.K  MS2 score: 21
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.MEEVEAMLLPETLK.R  MS2 score: 5
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.MGVAAHK.K  MS2 score: 14
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.MGVAAHKK.S  MS2 score: 4
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.NHEEEMKDLR.N  MS2 score: 4
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.NHEEEMLALR.G  MS2 score: 4
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.NHEEEMNALR.G  MS2 score: 1
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.NHEEEMNALR.G  MS2 score: 8
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.NHEEEMNALR.G  MS2 score: 1
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.NHEEEMNALR.G  MS2 score: 8
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.NHKEEMSQLTGQNSGDVNVEINVAPGK.D  MS2 score: 10
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.NILDR.Q  MS2 score: 24
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.NILDRQDPPSVVVTSHQAPGEK.K  MS2 score: 20
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.NKLEGLEDALQK.A  MS2 score: 12
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.NKLEGLEDALQK.A  MS2 score: 12
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.NKLEGLEDALQK.A  MS2 score: 17
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.NKLEGLEDALQK.A  MS2 score: 12
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.NKLNDLEDALQQAK.E  MS2 score: 55
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.NKYEDEINK.R  MS2 score: 20
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.NKYEDEINK.R  MS2 score: 25
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.NKYEDEINK.R  MS2 score: 25
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.NKYEDEINK.R  MS2 score: 25
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.NKYEDEINK.R  MS2 score: 20
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.NKYEDEINK.R  MS2 score: 25
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.NLVLHSARPGAPPPQPLDLQHR.A  MS2 score: 16
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.NLVLHSARPGAPPPQPLDLQHR.A  MS2 score: 15
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.NMQDMVEDYR.N  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.NMQDMVEDYR.N  MS2 score: 12
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.NMQDMVEDYR.N  MS2 score: 21
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.NMQDMVEDYR.N  MS2 score: 17
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.NQILNLTTDNANILLQIDNAR.L  MS2 score: 9
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.NQILNLTTDNANILLQIDNAR.L  MS2 score: 12
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.NQILNLTTDNANILLQIDNAR.L  MS2 score: 6
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_HUMANK.NRPTSISWDGLDSGK.L  MS2 score: 38
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.NVQDAIADAEQR.G  MS2 score: 34
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.NVQDAIADAEQR.G  MS2 score: 29
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.NYAEAK.D  MS2 score: 36
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.NYAEAK.D  MS2 score: 35
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.NYSPYYNTIDDLK.D  MS2 score: 4
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.NYSPYYNTIDDLKDQIVDLTVGNNK.T  MS2 score: 24
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.QCANLQNAIADAEQR.G  MS2 score: 1
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.QCKNVQDAIADAEQR.G  MS2 score: 23
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.QEIAEINR.M  MS2 score: 21
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.QEIAEINR.M  MS2 score: 21
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.QEIAEINR.M  MS2 score: 21
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.QEIAEINR.M  MS2 score: 21
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.QEYDEAGPSIVHR.K  MS2 score: 8
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.QEYDESGPSIVHR.K  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.QISNLQQSISDAEQR.G  MS2 score: 46
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.QISNLQQSISDAEQR.G  MS2 score: 22
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.QKWEAEPVYVQR.A  MS2 score: 3
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.QKWEAEPVYVQR.A  MS2 score: 1
A107AS100A12Protein S100-A12S10AC_HUMANK.QLLTKELANTIK.N  MS2 score: 8
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.QNCELFEQLGEYK.F  MS2 score: 11
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.QNCELFEQLGEYK.F  MS2 score: 21
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.QNCELFEQLGEYK.F  MS2 score: 2
A3825KRT24, KA24Keratin, type I cytoskeletal 24K1C24_HUMANK.QSASLQAQISTDAGAATSAKNEITELK.R  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.QTALVELVK.H  MS2 score: 9
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.QTALVELVK.H  MS2 score: 3
A3825KRT24, KA24Keratin, type I cytoskeletal 24K1C24_HUMANK.QTMQNLNDR.L  MS2 score: 3
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.QVLLHQQAKFGR.N  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.RGGSLPSR.H  MS2 score: 8
A3617ENO3Beta enolaseENOB_HUMANK.RIAQAVEK.K  MS2 score: 5
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANK.RIQYQLVDISQDNALR.D  MS2 score: 6
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANK.RISGLIYEETR.G  MS2 score: 16
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.RISIGGGSCAISGGYGSR.A  MS2 score: 1
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.RISIGGGSCAISGGYGSR.A  MS2 score: 1
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.RISIGGGSCAISGGYGSR.A  MS2 score: 1
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.RISISTSGGSFR.N  MS2 score: 16
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_HUMANK.RITPR.H  MS2 score: 8
A4616CDH13, CDHHCadherin-13 precursorCAD13_HUMANK.RSIVVSPILIPENQR.Q  MS2 score: 0
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMANK.SDLEAQVESLK.E  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SDQSRLDSELK.N  MS2 score: 7
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.SEISELR.R  MS2 score: 14
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.SEISELR.R  MS2 score: 13
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.SEISELR.R  MS2 score: 14
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.SEISELR.R  MS2 score: 13
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.SEISELRR.T  MS2 score: 19
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.SEISELRR.T  MS2 score: 15
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.SEISELRR.T  MS2 score: 19
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.SEISELRR.T  MS2 score: 15
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELR.R  MS2 score: 32
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 3
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 0
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 12
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SEITELRR.N  MS2 score: 6
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating6PGD_HUMANK.SFLEDIRK.A  MS2 score: 9
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.SHEESHK.E  MS2 score: 3
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.SHEESHKE.-  MS2 score: 28
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.SISISVAGGGGGFGAAGGFGGR.G  MS2 score: 54
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.SISISVAGGGGGFGAAGGFGGR.G  MS2 score: 71
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 7
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 35
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SISISVAR.G  MS2 score: 4
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.SISMSVAGSR.Q  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 33
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 26
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 47
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SKAEAESLYQSK.Y  MS2 score: 19
A7989TKT, TKT1TransketolaseTKT_HUMANK.SKDDQVTVIGAGVTLHEALAAAELLK.K  MS2 score: 33
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SKELTTEIDNNIEQISSYK.S  MS2 score: 43
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.SKELTTEIDNNIEQISSYK.S  MS2 score: 66
A809BAPOA2Apolipoprotein A-II precursorAPOA2_HUMANK.SKEQLTPLIK.K  MS2 score: 13
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.SLAKVEK.E  MS2 score: 7
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.SLHTLFGDK.L  MS2 score: 12
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.SLHTLFGDK.L  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.SLHTLFGDK.L  MS2 score: 16
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.SLHTLFGDK.L  MS2 score: 31
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.SLLAPLNVEMDPEIQR.V  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 31
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDK.V  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDKVR.F  MS2 score: 34
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDKVR.F  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDKVR.F  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDKVR.F  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SLNNQFASFIDKVR.F  MS2 score: 25
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18K1C18_HUMANK.SQDLAKIMADIR.A  MS2 score: 2
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.SQPMGLWR.Q  MS2 score: 0
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANK.SRLEQEIATYR.S  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SSGGSSSVR.F  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SSGGSSSVR.F  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.SSGGSSSVR.F  MS2 score: 1
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.SSSISSFKDPK.I  MS2 score: 2
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 9
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 16
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 10
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 7
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 15
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.STMQELNSR.L  MS2 score: 7
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.SVLGQLGITK.V  MS2 score: 11
A0361YWHAZ14-3-3 protein zeta/delta1433Z_HUMANK.SVTEQGAELSNEER.N  MS2 score: 32
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 60
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 60
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 37
A4550POTEKP, ACTBL3, FKSG30Putative beta-actin-like protein 3ACTK_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 60
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 37
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.SYELPDGQVITIGNER.F  MS2 score: 60
A809BAPOA2Apolipoprotein A-II precursorAPOA2_HUMANK.SYFEK.S  MS2 score: 15
A9139UMODUromodulin precursorUROM_HUMANK.TALQPMVSALNIRVGGTGMFTVR.M  MS2 score: 1
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.TEELNKEVASNSELVQSSR.S  MS2 score: 55
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.TEELNKEVASNSELVQSSR.S  MS2 score: 57
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.TEELNR.E  MS2 score: 8
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.TEELNR.E  MS2 score: 7
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.TEELNR.E  MS2 score: 8
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.TEELNR.E  MS2 score: 7
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANK.TEITDLRR.T  MS2 score: 4
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.TENLNDDEKLNNAK.Y  MS2 score: 6
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.TGAQELLR.V  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.TIDDLKNQILNLTTDNANILLQIDNAR.L  MS2 score: 1
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.TIDDLKNQILNLTTDNANILLQIDNAR.L  MS2 score: 36
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.TIDDLKNQILNLTTDNANILLQIDNAR.L  MS2 score: 40
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.TIDDLKNQILNLTTDNANILLQIDNAR.L  MS2 score: 22
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.TIEDLR.N  MS2 score: 8
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.TIEDLR.N  MS2 score: 8
A1256UBBPolyubiquitin-BUBIQ_HUMANK.TITLEVEPSDTIENVK.A  MS2 score: 30
A1256UBBPolyubiquitin-BUBIQ_HUMANK.TITLEVEPSDTIENVK.A  MS2 score: 19
A1256UBBPolyubiquitin-BUBIQ_HUMANK.TITLEVEPSDTIENVKAK.I  MS2 score: 12
A1256UBBPolyubiquitin-BUBIQ_HUMANK.TITLEVEPSDTIENVKAK.I  MS2 score: 37
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.TLNDMRQEYEQLIAK.N  MS2 score: 32
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.TLNDMRQEYEQLIAK.N  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.TLNDMRQEYEQLIAK.N  MS2 score: 10
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.TLNDMRQEYEQLIAK.N  MS2 score: 41
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.TLNDMRQEYEQLIAK.N  MS2 score: 31
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.TLNNK.F  MS2 score: 13
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.TLNNK.F  MS2 score: 13
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.TLNNK.F  MS2 score: 13
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.TLNNK.F  MS2 score: 13
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.TLNNK.F  MS2 score: 13
A1256UBBPolyubiquitin-BUBIQ_HUMANK.TLTGKTITLEVEPSDTIENVK.A  MS2 score: 33
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TPVSDR.V  MS2 score: 23
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TPVSDR.V  MS2 score: 21
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TPVSDR.V  MS2 score: 23
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TPVSDR.V  MS2 score: 14
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.TRLEQEIATYR.R  MS2 score: 17
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.TRLEQEIATYR.R  MS2 score: 17
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.TRLEQEIATYR.R  MS2 score: 17
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANK.TRLEQEIATYR.S  MS2 score: 17
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMANK.TSATVGPKAPSGGK.K  MS2 score: 2
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.TSESGELHGLTTEEEFVEGIYK.V  MS2 score: 31
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.TSESGELHGLTTEEEFVEGIYK.V  MS2 score: 20
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.TSESGELHGLTTEEEFVEGIYKVEIDTK.S  MS2 score: 6
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.TSESGELHGLTTEEEFVEGIYKVEIDTK.S  MS2 score: 17
A4550POTEKP, ACTBL3, FKSG30Putative beta-actin-like protein 3ACTK_HUMANK.TTFNSIVKSDVDIR.K  MS2 score: 11
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.TTPPVLDSDGSFFLYSK.L  MS2 score: 39
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.TVGSDTFYSFK.Y  MS2 score: 13
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANK.TVTAMDVVYALK.R  MS2 score: 37
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANK.TVTAMDVVYALKR.Q  MS2 score: 21
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TYETTLEK.C  MS2 score: 3
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TYETTLEK.C  MS2 score: 10
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TYETTLEK.C  MS2 score: 19
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TYETTLEK.C  MS2 score: 15
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.TYETTLEKCCAAADPHECYAK.V  MS2 score: 2
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_HUMANK.TYFPHFDLSHGSAQVK.G  MS2 score: 43
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.VDALMDEINFMK.M  MS2 score: 14
A3617ENO3Beta enolaseENOB_HUMANK.VDKFMIELDGTENK.S  MS2 score: 3
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.VDLLNQEIEFLK.V  MS2 score: 27
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 42
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 34
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 57
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 49
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 55
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 39
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSK.D  MS2 score: 86
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK.A  MS2 score: 54
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK.A  MS2 score: 51
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.VDSYGGSLR.Y  MS2 score: 2
A1819B2M, HDCMA22PBeta-2-microglobulin precursorB2MG_HUMANK.VEHSDLSFSK.D  MS2 score: 24
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.VEIDTKSYWK.A  MS2 score: 2
A182AVMO1, UNQ6350/PRO21055, UNQ6350Vitteline membrane outer layer protein 1 homolog precursorVMO1_HUMANK.VEPPQGIPGDDTALNGIR.L  MS2 score: 33
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 26
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 34
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 26
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 24
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 33
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 16
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VFDEFKPLVEEPQNLIK.Q  MS2 score: 41
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANK.VFLENVIR.D  MS2 score: 26
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANK.VFLENVIRDAVTYTEHAK.R  MS2 score: 46
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.VFSNGADLSGVTEEAPLK.L  MS2 score: 26
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_HUMANK.VFYSITGQGADTPPVGVFIIER.E  MS2 score: 43
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_HUMANK.VGAHAGEYGAEALER.M  MS2 score: 35
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.VGVNGFGR.I  MS2 score: 47
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANK.VIEHIMEDLDTNADK.Q  MS2 score: 9
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_HUMANK.VIEPKDIHAK.C  MS2 score: 5
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.VISSR.E  MS2 score: 13
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.VISSR.E  MS2 score: 3
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANK.VISSR.E  MS2 score: 13
A809BAPOA2Apolipoprotein A-II precursorAPOA2_HUMANK.VKSPELQAEAK.S  MS2 score: 30
A809BAPOA2Apolipoprotein A-II precursorAPOA2_HUMANK.VKSPELQAEAK.S  MS2 score: 30
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.VKVGVNGFGR.I  MS2 score: 0
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.VLDTK.W  MS2 score: 17
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.VLDTK.W  MS2 score: 3
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.VLDTK.W  MS2 score: 17
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.VLDTK.W  MS2 score: 3
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.VLDTK.W  MS2 score: 17
A8051PRSS3, mesotrypsinogen, PRSS4Trypsin III precursorTRY3_HUMANK.VLEGNEQFINAAK.I  MS2 score: 35
A8051PRSS3, mesotrypsinogen, PRSS4Trypsin III precursorTRY3_HUMANK.VLEGNEQFINAAK.I  MS2 score: 38
A8051PRSS3, mesotrypsinogen, PRSS4Trypsin III precursorTRY3_HUMANK.VLEGNEQFINAAK.I  MS2 score: 35
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.VLETKWTLLQEQGTK.T  MS2 score: 10
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.VLSSR.I  MS2 score: 13
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_HUMANK.VLTPTQVK.N  MS2 score: 7
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.VNDDIIVNWVNETLR.E  MS2 score: 44
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.VNDDIIVNWVNETLR.E  MS2 score: 52
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VPQVSTPTLVEVSR.N  MS2 score: 3
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VPQVSTPTLVEVSR.N  MS2 score: 31
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VPQVSTPTLVEVSR.N  MS2 score: 32
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VPQVSTPTLVEVSR.N  MS2 score: 19
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.VPQVSTPTLVEVSR.N  MS2 score: 25
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.VQALEEANNDLENK.I  MS2 score: 42
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.VQALEEANNDLENK.I  MS2 score: 33
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.VQALEEANNDLENK.I  MS2 score: 43
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.VRALEEANTELEVK.I  MS2 score: 3
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.VSFLSALEEYTK.K  MS2 score: 31
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.VSTSGPR.A  MS2 score: 3
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_HUMANK.VTEPLDR.E  MS2 score: 9
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANK.VTLTSEEEAR.L  MS2 score: 25
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.VTMQNLNDR.L  MS2 score: 14
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.VTMQNLNDR.L  MS2 score: 23
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.VTMQNLNDR.L  MS2 score: 23
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.VTMQNLNDR.L  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.VTMQNLNDR.L  MS2 score: 14
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.VTMQNLNDR.L  MS2 score: 22
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.VTMQNLNDR.L  MS2 score: 23
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.VTMQNLNDR.L  MS2 score: 14
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.VTNPK.Q  MS2 score: 7
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.VTNPK.Q  MS2 score: 10
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylating6PGD_HUMANK.VVGAQSLK.E  MS2 score: 6
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.VVSTHEQVLR.T  MS2 score: 22
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.VVSTHEQVLR.T  MS2 score: 5
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.WELLQQVDTSTR.T  MS2 score: 6
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.YAISMAR.K  MS2 score: 15
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.YDLDFK.S  MS2 score: 19
A3616ENO2Gamma enolaseENOG_HUMANK.YDLDFK.S  MS2 score: 19
A3617ENO3Beta enolaseENOB_HUMANK.YDLDFK.S  MS2 score: 19
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.YEDEINK.R  MS2 score: 0
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.YEDEINK.R  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEDEINK.R  MS2 score: 0
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.YEDEINK.R  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 36
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 39
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 37
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.YEELQITAGR.H  MS2 score: 28
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.YEELQQTAGR.H  MS2 score: 36
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.YEELQQTAGR.H  MS2 score: 26
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.YEELQQTAGR.H  MS2 score: 19
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.YEELQVTAGR.H  MS2 score: 18
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.YEELQVTAGR.H  MS2 score: 18
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.YEELQVTAGR.H  MS2 score: 18
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.YEELQVTVGR.H  MS2 score: 23
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.YEELQVTVGR.H  MS2 score: 16
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.YEELQVTVGR.H  MS2 score: 22
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.YEELQVTVGR.H  MS2 score: 10
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.YEHELALR.Q  MS2 score: 5
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.YEHELALR.Q  MS2 score: 9
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.YENEVALR.Q  MS2 score: 14
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.YENEVALRQSVEADINGLR.R  MS2 score: 1
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANK.YETELSLRQLVEADINGLR.R  MS2 score: 4
A9139UMODUromodulin precursorUROM_HUMANK.YFIIQDR.C  MS2 score: 11
A9139UMODUromodulin precursorUROM_HUMANK.YFIIQDR.C  MS2 score: 18
A9139UMODUromodulin precursorUROM_HUMANK.YFIIQDR.C  MS2 score: 4
A9139UMODUromodulin precursorUROM_HUMANK.YFIIQDR.C  MS2 score: 29
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.YLGPQYVAGITNLKK.C  MS2 score: 29
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.YLYEIAR.R  MS2 score: 5
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.YLYEIAR.R  MS2 score: 18
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.YLYEIAR.R  MS2 score: 7
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.YNSQNQSNNQFVLYR.I  MS2 score: 38
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.YPIEHGIITNWDDMEK.I  MS2 score: 17
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.YSLIK.G  MS2 score: 17
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.YSLIK.G  MS2 score: 20
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.YSLIKGNFHAVYR.D  MS2 score: 26
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.YTTTSSSSR.K  MS2 score: 47
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.YTTTSSSSR.K  MS2 score: 47
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.YTTTSSSSR.K  MS2 score: 47
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.YYYDGKDYIEFNK.E  MS2 score: 0
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.YYYDGKDYIEFNK.E  MS2 score: 10
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANM.DDDIAALVVDNGSGMCKAGFAGDDAPR.A  MS2 score: 0
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANM.GWRAPGALLLALLLHGR.L  MS2 score: 1
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANM.PPYTVVYFPVR.G  MS2 score: 21
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANM.PPYTVVYFPVR.G  MS2 score: 8
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANM.SGRGK.G  MS2 score: 0
A478AHIST1H2AA, H2AFRHistone H2A type 1-AH2A1A_HUMANM.SGRGK.Q  MS2 score: 13
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMANM.SGRGK.T  MS2 score: 4
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANM.SVRYSSSK.H  MS2 score: 0
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANM.SVRYSSSK.H  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANM.SVRYSSSK.H  MS2 score: 4
A274ES100P, S100ES-100P proteinS100P_HUMANM.TELETAMGMIIDVFSR.Y  MS2 score: 7
A274ES100P, S100ES-100P proteinS100P_HUMANM.TELETAMGMIIDVFSR.Y  MS2 score: 1
A107AS100A12Protein S100-A12S10AC_HUMANM.TKLEEHLEGIVNIFHQYSVR.K  MS2 score: 37
A107AS100A12Protein S100-A12S10AC_HUMANM.TKLEEHLEGIVNIFHQYSVR.K  MS2 score: 49
A107AS100A12Protein S100-A12S10AC_HUMANM.TKLEEHLEGIVNIFHQYSVR.K  MS2 score: 51
A107AS100A12Protein S100-A12S10AC_HUMANM.TKLEEHLEGIVNIFHQYSVR.K  MS2 score: 53
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANM.TTCSRQFTSSSSMK.G  MS2 score: 3
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANM.TTCSRQFTSSSSMK.G  MS2 score: 3
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANM.VVGVDSMPAASSVKKPFGLR.S  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.AAGVPSATITWRK.E  MS2 score: 1
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 44
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 43
A3616ENO2Gamma enolaseENOG_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 44
A3616ENO2Gamma enolaseENOG_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 43
A3617ENO3Beta enolaseENOB_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 44
A3617ENO3Beta enolaseENOB_HUMANR.AAVPSGASTGIYEALELR.D  MS2 score: 43
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.ACTEAEFACHSYNECVALEYRCDR.R  MS2 score: 1
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ADLEMQIESLK.E  MS2 score: 5
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.AEAESWYQTK.Y  MS2 score: 10
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.AEAESWYQTK.Y  MS2 score: 10
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.AEAESWYQTK.Y  MS2 score: 10
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.AFIQLWAFDAVK.G  MS2 score: 47
A478AHIST1H2AA, H2AFRHistone H2A type 1-AH2A1A_HUMANR.AGLQFPVGR.I  MS2 score: 56
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_HUMANR.AGLQFPVGR.I  MS2 score: 56
A495AH2AFZ, H2AZHistone H2A.zH2AZ_HUMANR.AGLQFPVGR.I  MS2 score: 53
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMANR.AGLQFPVGR.V  MS2 score: 53
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.AGYVLHR.N  MS2 score: 43
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.AGYVLHR.N  MS2 score: 39
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.AGYVLHR.N  MS2 score: 42
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.AGYVLHR.N  MS2 score: 46
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.AGYVLHR.N  MS2 score: 34
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorSCTM1_HUMANR.AHGQESAIFNEVAPGYFSR.D  MS2 score: 44
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.AIGGGLSSVGGGSSTIK.Y  MS2 score: 32
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.AIGGGLSSVGGGSSTIK.Y  MS2 score: 18
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.AIGGGLSSVGGGSSTIK.Y  MS2 score: 32
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.AIGGGLSSVGGGSSTIK.Y  MS2 score: 18
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.AIGGGLSSVGGGSSTIKYTTTSSSSR.K  MS2 score: 42
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.AIGGGLSSVGGGSSTIKYTTTSSSSR.K  MS2 score: 56
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.AIGGGLSSVGGGSSTIKYTTTSSSSR.K  MS2 score: 42
A1176APOEApolipoprotein E precursorAPOE_HUMANR.AKLEEQAQQIR.L  MS2 score: 31
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ALEEANADLEVK.I  MS2 score: 2
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ALEEANADLEVK.I  MS2 score: 36
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ALEEANADLEVK.I  MS2 score: 2
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ALEEANADLEVK.I  MS2 score: 36
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.ALEEANADLEVK.I  MS2 score: 36
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ALEEANADLEVKIR.D  MS2 score: 0
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ALEEANADLEVKIR.D  MS2 score: 24
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ALEEANADLEVKIR.D  MS2 score: 0
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ALEEANADLEVKIR.D  MS2 score: 24
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.ALEEANTELEVK.I  MS2 score: 38
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.ALEEANTELEVK.I  MS2 score: 21
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 27
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 14
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 38
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 9
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 11
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ALEESNYELEGK.I  MS2 score: 30
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.ALVNFTR.S  MS2 score: 2
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.ALYDAELSQMQTHISDTSVVLSMDNNR.N  MS2 score: 36
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.ALYDAELSQMQTHISDTSVVLSMDNNR.N  MS2 score: 36
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.ALYDAELSQMQTHISDTSVVLSMDNNR.N  MS2 score: 16
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.ALYDAELSQMQTHISDTSVVLSMDNNR.N  MS2 score: 36
A0419GSNGelsolin precursor, plasmaGELS_HUMANR.AMAELAA.-  MS2 score: 1
A7355PGA4Pepsin A-4PEPA_HUMANR.ANNQVGLAPVA.-  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.APGALLLALLLHGR.L  MS2 score: 2
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.APGKDTFYSLGSSLDITFR.S  MS2 score: 6
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.APGKDTFYSLGSSLDITFR.S  MS2 score: 13
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.APQLR.E  MS2 score: 0
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.APQLRETLLQDFR.V  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.APSTYGGGLSVSSR.F  MS2 score: 30
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.APSTYGGGLSVSSR.F  MS2 score: 31
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.APSTYGGGLSVSSSR.F  MS2 score: 48
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.APSTYGGGLSVSSSR.F  MS2 score: 45
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.AQAGANTRPCPS.-  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.AQAGANTRPCPS.-  MS2 score: 3
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.AQAGANTRPCPS.-  MS2 score: 0
A1176APOEApolipoprotein E precursorAPOE_HUMANR.AQAWGER.L  MS2 score: 6
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.ASQSVSNSYLAWYQQKPGQAPR.L  MS2 score: 44
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.ASQSVSSSYLAWYQQKPGQAPR.L  MS2 score: 55
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.ATGGGLSSVGGGSSTIK.Y  MS2 score: 28
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.ATGGGLSSVGGGSSTIK.Y  MS2 score: 35
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.ATGIPDR.F  MS2 score: 9
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.ATGIPDR.F  MS2 score: 9
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.ATGIPDRFSGSGSGTDFTLTISR.L  MS2 score: 9
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.ATGIPDRFSGSGSGTDFTLTISR.L  MS2 score: 9
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.ATLSCR.A  MS2 score: 1
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMANR.ATLSCR.A  MS2 score: 1
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.ATLSCR.A  MS2 score: 1
A735CA1BGAlpha-1B-glycoprotein precursorA1BG_HUMANR.ATWSGAVLAGR.D  MS2 score: 11
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANR.AVFPSIVGRPR.H  MS2 score: 12
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.AVFPSIVGRPR.H  MS2 score: 12
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.AVFPSIVGRPR.H  MS2 score: 23
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANR.AVFPSIVGRPR.H  MS2 score: 23
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANR.AVFPSIVGRPR.Q  MS2 score: 12
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.CEMEQQNQEYKILLDVK.T  MS2 score: 2
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.CEMEQQNQEYKILLDVK.T  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CHLGRSGLR.C  MS2 score: 4
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CSATGSPAPTIHWSK.L  MS2 score: 0
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CSATGSPAPTIHWSKLR.S  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CSATGSPAPTIHWSKLR.S  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CSATGSPAPTIHWSKLR.S  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.CSATGSPAPTIHWSKLR.S  MS2 score: 2
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.DAETWFLSK.T  MS2 score: 12
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.DAVTYTEHAK.R  MS2 score: 28
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANR.DDLKK.L  MS2 score: 7
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANR.DDLKK.L  MS2 score: 17
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANR.DDLKK.L  MS2 score: 11
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.DEGKASSAK.Q  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.DEGKASSAK.Q  MS2 score: 8
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANR.DGAGDVAFIR.E  MS2 score: 29
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANR.DGKLVSESSDVLPK.-  MS2 score: 2
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorSCTM1_HUMANR.DGWQLQVQGGVAQLVIK.G  MS2 score: 38
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.DIKEK.L  MS2 score: 15
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANR.DIKEK.L  MS2 score: 15
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANR.DLDLDSIIAEVRAQYEEIALK.S  MS2 score: 8
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANR.DLTDYLMK.I  MS2 score: 7
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.DLTDYLMK.I  MS2 score: 7
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.DNIQGITKPAIR.R  MS2 score: 29
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.DNIQGITKPAIR.R  MS2 score: 4
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.DNIQGITKPAIRR.L  MS2 score: 1
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.DQYEKMAEK.N  MS2 score: 4
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.DQYEKMAEK.N  MS2 score: 14
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.DQYEKMAEK.N  MS2 score: 4
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.DQYEKMAEK.N  MS2 score: 14
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.DQYEQMAEK.N  MS2 score: 7
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.DQYEQMAEK.N  MS2 score: 21
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 44
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 42
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 47
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 29
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 55
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 45
A9139UMODUromodulin precursorUROM_HUMANR.DSTIQVVENGESSQGR.F  MS2 score: 52
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.DWYQR.Q  MS2 score: 11
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.DWYQR.Q  MS2 score: 11
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.DWYQR.Q  MS2 score: 11
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.DYQELMNTK.L  MS2 score: 9
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.DYSKYYK.T  MS2 score: 10
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.DYSQYYR.T  MS2 score: 19
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANR.DYVSQFEGSALGK.Q  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.EDGRPVPSGTQQR.H  MS2 score: 4
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.EDGRPVPSGTQQR.H  MS2 score: 11
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.EDGRPVPSGTQQR.H  MS2 score: 3
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.EERTFR.N  MS2 score: 2
A0536S100A6, CACYCalcyclinS10A6_HUMANR.EGDKHTLSK.K  MS2 score: 2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANR.EPQVYTLPPSRDELTK.N  MS2 score: 16
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.EQYEAMAEKNR.R  MS2 score: 17
A1176APOEApolipoprotein E precursorAPOE_HUMANR.ERLGPLVEQGR.V  MS2 score: 9
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.ETLLQDFR.V  MS2 score: 27
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.ETLLQDFR.V  MS2 score: 41
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.ETLLQDFR.V  MS2 score: 46
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.ETLLQDFRVVAQGVGIPEDSIFTMADR.G  MS2 score: 9
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.ETLLQDFRVVAQGVGIPEDSIFTMADR.G  MS2 score: 8
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.EVATNSELVQSGK.S  MS2 score: 27
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.EVATNSELVQSGK.S  MS2 score: 34
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.EVATNSELVQSGK.S  MS2 score: 27
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.EVATNSELVQSGK.S  MS2 score: 34
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.EVFTSSSSSSSR.Q  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 22
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 22
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 12
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 3
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 15
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.FKDLGEENFK.A  MS2 score: 17
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.FLEQQNK.A  MS2 score: 17
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANR.FLEQQNK.L  MS2 score: 17
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANR.FLEQQNK.M  MS2 score: 17
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.FLEQQNK.V  MS2 score: 39
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.FLEQQNK.V  MS2 score: 39
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.FLEQQNK.V  MS2 score: 39
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.FLEQQNK.V  MS2 score: 39
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.FLEQQNKALAAELNQLR.A  MS2 score: 1
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.FLEQQNKVLETK.W  MS2 score: 16
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.FLEQQNKVLETK.W  MS2 score: 28
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 21
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 37
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 33
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 40
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTK.W  MS2 score: 50
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.FLEQQNQVLQTK.W  MS2 score: 29
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.FLEQQNQVLQTK.W  MS2 score: 37
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.FLEQQNQVLQTK.W  MS2 score: 40
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.FLEQQNQVLQTK.W  MS2 score: 50
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTKWELLQQVDTSTR.T  MS2 score: 44
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTKWELLQQVDTSTR.T  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FLEQQNQVLQTKWELLQQVDTSTR.T  MS2 score: 26
A9139UMODUromodulin precursorUROM_HUMANR.FRSGSVIDQSR.V  MS2 score: 3
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 23
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 26
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 43
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 30
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 40
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 30
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.FSGSGSGTDFTLTISR.L  MS2 score: 26
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FSSCGGGGGSFGAGGGFGSR.S  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FSSCGGGGGSFGAGGGFGSRSLVNLGGSK.S  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.FSSCGGGGGSFGAGGGFGSRSLVNLGGSK.S  MS2 score: 8
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.FSSSGGR.G  MS2 score: 0
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.FSSSGGRGGGGR.F  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.FSSSSGYGGGSSR.V  MS2 score: 16
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.FSSSSGYGGGSSRVCGR.G  MS2 score: 1
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.FSSSSGYGGGSSRVCGR.G  MS2 score: 3
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANR.GALQNIIPASTGAAK.A  MS2 score: 16
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANR.GALQNIIPASTGAAK.A  MS2 score: 16
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANR.GELAIK.D  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GELALK.D  MS2 score: 25
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANR.GELALK.D  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GELALKDAR.N  MS2 score: 9
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GELALKDAR.N  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GENALKDAK.N  MS2 score: 7
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANR.GFSCGSAIVGGGK.R  MS2 score: 2
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GFSSGSAVVSGGSR.R  MS2 score: 9
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GFSSGSAVVSGGSR.R  MS2 score: 0
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GFSSGSAVVSGGSRR.S  MS2 score: 2
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGGGGGFRGFSSGSAVVSGGSR.R  MS2 score: 20
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGGGGGFRGFSSGSAVVSGGSR.R  MS2 score: 18
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGGGGGFRGFSSGSAVVSGGSR.R  MS2 score: 10
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGGGGGFRGFSSGSAVVSGGSR.R  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 54
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 55
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 43
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 51
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 63
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 66
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 55
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 63
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G  MS2 score: 58
A4168NEDD8, NEDD8-MDP1Ubiquitin-like protein NEDD8NEDD8_HUMANR.GGGGLR.Q  MS2 score: 4
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 10
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 14
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 18
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 11
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 7
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 18
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 11
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 16
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 16
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGR.F  MS2 score: 18
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 11
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 40
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 21
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 1
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 41
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G  MS2 score: 41
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GGNLPAR.H  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGSGGGGGGSSGGR.G  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GGSGGGGGGSSGGR.G  MS2 score: 4
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGSGGGGSISGGGYGSGGGSGGRYGSGGGSK.G  MS2 score: 52
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 26
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 41
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 33
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 46
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 46
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 50
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 55
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 55
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S  MS2 score: 42
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS.-  MS2 score: 36
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS.-  MS2 score: 13
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS.-  MS2 score: 48
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS.-  MS2 score: 21
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS.-  MS2 score: 19
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 20
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 15
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 50
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 24
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGRGSR.G  MS2 score: 4
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGRGSR.G  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GGSGGSYGRGSR.G  MS2 score: 2
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.GGSLLAGGGGFGGGSLSGGGGSR.S  MS2 score: 6
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GGSLPARHQTHGSLLR.L  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GGSLPPHTQVHGSR.L  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GGSLPSHHQTR.G  MS2 score: 5
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GGSSSGGGYGSGGGGSSSVK.G  MS2 score: 0
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GHTPTQPGALNQR.Q  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GHTPTQPGALNQR.Q  MS2 score: 6
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GLGVGFGSGGGSSSSVK.F  MS2 score: 28
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GLGVGFGSGGGSSSSVK.F  MS2 score: 20
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GLGVGFGSGGGSSSSVK.F  MS2 score: 8
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GLGVGFGSGGGSSSSVKFVSTTSSSR.K  MS2 score: 37
A7355PGA4Pepsin A-4PEPA_HUMANR.GLLKDFLK.K  MS2 score: 16
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANR.GNPTVEVDLFTSK.G  MS2 score: 23
A3616ENO2Gamma enolaseENOG_HUMANR.GNPTVEVDLYTAK.G  MS2 score: 7
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.GPCRAFIQLWAFDAVK.G  MS2 score: 1
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANR.GPLQLER.L  MS2 score: 47
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANR.GQLEALQVDGGRLEQGLR.T  MS2 score: 2
A3862KRT80, KB20Keratin B20K2C80_HUMANR.GQLEANLLQVLEK.V  MS2 score: 2
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.GQTGGDVNVEMDAAPGVDLSR.I  MS2 score: 55
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.GQTGGDVNVEMDAAPGVDLSR.I  MS2 score: 45
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.GQVGGDVNVEMDAAPGVDLSR.I  MS2 score: 42
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.GQVGGDVNVEMDAAPGVDLSR.I  MS2 score: 73
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.GQVGGEINVEMDAAPGVDLSR.I  MS2 score: 56
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.GQVGGEINVEMDAAPGVDLSR.I  MS2 score: 3
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.GQVGGEINVEMDAAPGVDLSR.I  MS2 score: 54
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.GRLDSELR.G  MS2 score: 23
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.GRLDSELR.N  MS2 score: 23
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.GRLDSELR.N  MS2 score: 23
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.GRLDSELR.N  MS2 score: 23
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGR.G  MS2 score: 5
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGR.G  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGRGSSSGGVK.S  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGRGSSSGGVK.S  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGRGSSSGGVK.S  MS2 score: 24
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSGGGSSGGSIGGRGSSSGGVK.S  MS2 score: 0
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.GSGGLGGACGGAGFGSR.S  MS2 score: 8
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.GSGGLGGACGGAGFGSR.S  MS2 score: 8
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.GSGGLGGACGGAGFGSR.S  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GSIQVDGEELVSGR.S  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GSIQVDGEELVSGR.S  MS2 score: 7
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANR.GSPAINVAVHVFR.K  MS2 score: 10
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GSRGGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.GSRGGSGGSYGGGGSGGGYGGGSGSR.G  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.GSSGGGCFGGSSGGYGGLGGFGGGSFR.G  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.GSSGGGCFGGSSGGYGGLGGFGGGSFR.G  MS2 score: 0
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.GSSSGGGYSSGSSSYGSGGR.Q  MS2 score: 27
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSSSGGVKSSGGSSSVR.F  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSSSGGVKSSGGSSSVR.F  MS2 score: 5
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.GSVSDEEMMELR.E  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 49
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 67
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 72
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 40
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 63
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 83
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 82
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.GSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR.G  MS2 score: 46
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.GTQLR.W  MS2 score: 3
A2315MICALL2, MICAL-L2, UNQ5811MICAL-like protein 2MILK2_HUMANR.GVELEKR.L  MS2 score: 35
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.GVLKVFLENVIR.D  MS2 score: 2
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.GYSFTTTAER.E  MS2 score: 15
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.GYSFTTTAER.E  MS2 score: 24
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.GYSFTTTAEREIVR.D  MS2 score: 0
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANR.GYSFVTTAER.E  MS2 score: 11
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANR.GYSFVTTAER.E  MS2 score: 9
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.HGDDLR.N  MS2 score: 15
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.HGDDLR.N  MS2 score: 23
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.HGDDLR.N  MS2 score: 23
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.HGDDLR.N  MS2 score: 23
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.HGDDLR.N  MS2 score: 15
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.HGDDLR.N  MS2 score: 23
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.HGGGGGGFGGGGFGSR.S  MS2 score: 11
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.HGGGGGGFGGGGFGSR.S  MS2 score: 50
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.HGGGGGGFGGGGFGSR.S  MS2 score: 29
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.HGVQELEIELQSQLSK.K  MS2 score: 34
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.HGVQELEIELQSQLSK.K  MS2 score: 41
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.HGVQELEIELQSQLSKK.A  MS2 score: 33
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.HHGPTITAK.L  MS2 score: 0
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.HLISTHFAPGDFQGFALVNPQRNSR.L  MS2 score: 3
A495AH2AFZ, H2AZHistone H2A.zH2AZ_HUMANR.HLKSR.T  MS2 score: 3
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANR.HLLEGEDCK.L  MS2 score: 1
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_HUMANR.HLQLAIR.G  MS2 score: 28
A478AHIST1H2AA, H2AFRHistone H2A type 1-AH2A1A_HUMANR.HLQLAIR.N  MS2 score: 28
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_HUMANR.HLQLAIRGDEELDSLIK.A  MS2 score: 1
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.HPDYSVVLLLR.L  MS2 score: 19
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.HPDYSVVLLLR.L  MS2 score: 33
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMANR.HVEQENASLESRIR.E  MS2 score: 6
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANR.IEEELGSK.A  MS2 score: 0
A1819B2M, HDCMA22PBeta-2-microglobulin precursorB2MG_HUMANR.IEKVEHSDLSFSK.D  MS2 score: 8
A7989TKT, TKT1TransketolaseTKT_HUMANR.IIALDGDTK.N  MS2 score: 0
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.IKFEMEQNLR.Q  MS2 score: 4
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.IKFEMEQNLR.Q  MS2 score: 2
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.IKFEMEQNLR.Q  MS2 score: 4
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANR.ILDGK.R  MS2 score: 4
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.ILNEMRDQYEK.M  MS2 score: 20
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.ILNEMRDQYEK.M  MS2 score: 20
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ILNEMRDQYEQMAEK.N  MS2 score: 20
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.ILNEMRDQYEQMAEK.N  MS2 score: 28
A4616CDH13, CDHHCadherin-13 precursorCAD13_HUMANR.INENTGSVSVTR.T  MS2 score: 35
A3862KRT80, KB20Keratin B20K2C80_HUMANR.IQKLR.S  MS2 score: 10
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANR.IQYQLVDISQDNALRDEMR.A  MS2 score: 18
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.ISGLIYEETR.G  MS2 score: 31
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.ISGLIYEETRGVLK.V  MS2 score: 5
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.ISISTSGGSFR.N  MS2 score: 30
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.ISISTSGGSFR.N  MS2 score: 30
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ISSSK.G  MS2 score: 3
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ISSSK.G  MS2 score: 4
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ISSSKGSLGGGFSSGGFSGGSFSR.G  MS2 score: 17
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ISSSKGSLGGGFSSGGFSGGSFSR.G  MS2 score: 14
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.ISSSKGSLGGGFSSGGFSGGSFSR.G  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.ISSTPAK.L  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.ISSTPAK.L  MS2 score: 14
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18K1C18_HUMANR.ISVSRSTSFR.G  MS2 score: 8
A495AH2AFZ, H2AZHistone H2A.zH2AZ_HUMANR.ITPRHLQLAIR.G  MS2 score: 11
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANR.KAADDTWEPFASGK.T  MS2 score: 6
A0419GSNGelsolin precursor, plasmaGELS_HUMANR.KAALK.T  MS2 score: 0
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.KDAEAWFNEK.S  MS2 score: 4
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.KDAEDWFFSK.T  MS2 score: 21
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.KDIENQYETQITQIEHEVSSSGQEVQSSAK.E  MS2 score: 26
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANR.KDLIVMLR.D  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.KEGGSLPPQAR.S  MS2 score: 11
A107AS100A12Protein S100-A12S10AC_HUMANR.KGHFDTLSK.G  MS2 score: 6
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.KIESLEEEIR.F  MS2 score: 6
A7989TKT, TKT1TransketolaseTKT_HUMANR.KLILDSAR.A  MS2 score: 10
A3862KRT80, KB20Keratin B20K2C80_HUMANR.KLVEGEEGR.M  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.KNHEEEMLALR.G  MS2 score: 10
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.KNHEEEMLALR.G  MS2 score: 8
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.KTVTAMDVVYALK.R  MS2 score: 2
A3825KRT24, KA24Keratin, type I cytoskeletal 24K1C24_HUMANR.KVLDDLTMTR.S  MS2 score: 3
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LAADDFR.L  MS2 score: 36
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LAADDFR.L  MS2 score: 34
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 8
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 11
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 5
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 36
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFR.L  MS2 score: 34
A3825KRT24, KA24Keratin, type I cytoskeletal 24K1C24_HUMANR.LAADDFR.L  MS2 score: 36
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANR.LAADDFR.L  MS2 score: 36
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LAADDFR.T  MS2 score: 8
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LAADDFR.T  MS2 score: 36
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LAADDFR.T  MS2 score: 34
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LAADDFR.T  MS2 score: 8
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LAADDFR.T  MS2 score: 36
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LAADDFR.T  MS2 score: 34
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LAADDFR.T  MS2 score: 8
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LAADDFR.T  MS2 score: 34
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LAADDFR.T  MS2 score: 36
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LAADDFR.T  MS2 score: 34
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18K1C18_HUMANR.LAADDFR.V  MS2 score: 36
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LAADDFRLK.Y  MS2 score: 9
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.LASPGFPGEYANDQER.R  MS2 score: 20
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.LASPGFPGEYANDQER.R  MS2 score: 11
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.LASPGFPGEYANDQER.R  MS2 score: 8
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDK.V  MS2 score: 19
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDK.V  MS2 score: 24
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDK.V  MS2 score: 33
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDK.V  MS2 score: 19
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDK.V  MS2 score: 24
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDK.V  MS2 score: 33
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LASYLDK.V  MS2 score: 19
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LASYLDK.V  MS2 score: 33
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LASYLDK.V  MS2 score: 24
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LASYLDK.V  MS2 score: 33
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LASYLDK.V  MS2 score: 24
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LASYLDK.V  MS2 score: 33
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANR.LASYLDK.V  MS2 score: 24
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDK.V  MS2 score: 19
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDK.V  MS2 score: 5
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDK.V  MS2 score: 24
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDK.V  MS2 score: 5
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDK.V  MS2 score: 33
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 19
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 24
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDK.V  MS2 score: 33
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDKVQALEEANNDLENK.I  MS2 score: 22
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.LASYLDKVQALEEANNDLENK.I  MS2 score: 19
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDKVR.A  MS2 score: 33
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDKVR.A  MS2 score: 47
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LASYLDKVR.A  MS2 score: 8
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDKVR.A  MS2 score: 33
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDKVR.A  MS2 score: 47
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LASYLDKVR.A  MS2 score: 8
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LASYLDKVR.A  MS2 score: 33
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LASYLDKVR.A  MS2 score: 8
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LASYLDKVR.A  MS2 score: 47
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LASYLDKVR.A  MS2 score: 8
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LASYLDKVR.A  MS2 score: 47
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LASYLDKVR.A  MS2 score: 8
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANR.LASYLDKVR.A  MS2 score: 47
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDKVR.A  MS2 score: 33
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDKVR.A  MS2 score: 33
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDKVR.A  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDKVR.A  MS2 score: 47
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LASYLDKVR.A  MS2 score: 8
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18K1C18_HUMANR.LASYLDR.V  MS2 score: 12
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANR.LDADPSLQRVR.Q  MS2 score: 2
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.LDLAGR.D  MS2 score: 18
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANR.LDLAGR.D  MS2 score: 18
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.LDQLTANSARLEVER.D  MS2 score: 2
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.LEEEGQSLK.D  MS2 score: 2
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANR.LEGEIATYR.H  MS2 score: 3
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LENEIQTYR.S  MS2 score: 16
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LENEIQTYR.S  MS2 score: 5
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LENEIQTYR.S  MS2 score: 15
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LENEIQTYR.S  MS2 score: 20
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.LEPEDFAVYYCQQYGTSPR.T  MS2 score: 0
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LEQEIATYR.R  MS2 score: 31
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LEQEIATYR.R  MS2 score: 6
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LEQEIATYR.R  MS2 score: 31
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LEQEIATYR.R  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LEQEIATYR.R  MS2 score: 31
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LEQEIATYR.R  MS2 score: 6
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.LEQEIATYR.S  MS2 score: 6
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.LEQEIATYR.S  MS2 score: 6
A182AVMO1, UNQ6350/PRO21055, UNQ6350Vitteline membrane outer layer protein 1 homolog precursorVMO1_HUMANR.LFCCRS.-  MS2 score: 1
A3616ENO2Gamma enolaseENOG_HUMANR.LGAEVYHTLKGVIK.D  MS2 score: 8
A6935LYZ, LZMLysozyme C precursorLYSC_HUMANR.LGMDGYR.G  MS2 score: 10
A1256UBBPolyubiquitin-BUBIQ_HUMANR.LIFAGKQLEDGR.T  MS2 score: 26
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANR.LKQVLLHQQAK.F  MS2 score: 17
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LKYENEVALR.Q  MS2 score: 11
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LKYENEVALR.Q  MS2 score: 11
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LKYENEVALR.Q  MS2 score: 21
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LKYENEVALR.Q  MS2 score: 11
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.LKYENEVALR.Q  MS2 score: 6
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.LLAVTHGLR.A  MS2 score: 9
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LLEGEDAHLSSQQASGQSYSSR.E  MS2 score: 36
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.LLEGEDAHLSSQQASGQSYSSR.E  MS2 score: 58
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LLEGEDAHLSSSQFSSGSQSSR.D  MS2 score: 54
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.LLEGEDAHLSSSQFSSGSQSSR.D  MS2 score: 68
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LLEGEDAHLTQYK.K  MS2 score: 8
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.LLIYGASSR.A  MS2 score: 6
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.LLIYGASSR.A  MS2 score: 30
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMANR.LLIYGASSR.A  MS2 score: 6
A8273IGK, SDNK1, A30Ig kappa chainKV312_HUMANR.LLIYGASSR.A  MS2 score: 6
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMANR.LLIYVASSR.A  MS2 score: 3
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMANR.LLIYVASSR.A  MS2 score: 2
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.LLKEYQELMNVK.L  MS2 score: 49
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.LLKEYQELMNVK.L  MS2 score: 49
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.LLKEYQELMNVK.L  MS2 score: 38
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.LLKEYQELMNVK.L  MS2 score: 49
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.LLRDYQELMNTK.L  MS2 score: 24
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.LLRDYQELMNTK.L  MS2 score: 13
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.LLRDYQELMNTK.L  MS2 score: 27
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.LLRDYQELMNTK.L  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.LLREYQELMNTK.L  MS2 score: 19
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.LLREYQELMNTK.L  MS2 score: 22
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 6
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 17
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 8
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 16
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 21
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDR.N  MS2 score: 4
A0536S100A6, CACYCalcyclinS10A6_HUMANR.LMEDLDRNK.D  MS2 score: 13
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.LQGEIAHVK.K  MS2 score: 0
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.LQGEIAHVK.K  MS2 score: 6
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.LQGEIAHVK.K  MS2 score: 1
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.LRAEIDNVK.K  MS2 score: 12
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.LRAEIDNVK.K  MS2 score: 5
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.LSQRFPK.A  MS2 score: 1
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLR.R  MS2 score: 8
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLR.R  MS2 score: 4
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLR.R  MS2 score: 5
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLRR.V  MS2 score: 16
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLRR.V  MS2 score: 14
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.LSVEADINGLRR.V  MS2 score: 28
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANR.LTWASHEK.M  MS2 score: 27
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.MATLYSR.T  MS2 score: 28
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.MATLYSR.T  MS2 score: 25
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.MSGDLSSNVTVSVTSSTISSNVASK.A  MS2 score: 29
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.MSVEADINGLR.R  MS2 score: 0
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.MSVEADINGLR.R  MS2 score: 14
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.MSVEADINGLR.R  MS2 score: 14
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.MSVEADINGLRR.V  MS2 score: 13
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.MSVEADINGLRR.V  MS2 score: 13
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.MTLDDFR.I  MS2 score: 2
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.MTLDDFR.I  MS2 score: 1
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.MTLDDFR.I  MS2 score: 3
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.MTVSTLVLGEGATEAEISMTSTR.W  MS2 score: 10
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANR.NALTGLPPGLFQASATLDTLVLK.E  MS2 score: 15
A478AHIST1H2AA, H2AFRHistone H2A type 1-AH2A1A_HUMANR.NDEELNK.L  MS2 score: 19
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.NEALIALLR.E  MS2 score: 30
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.NEALIALLR.E  MS2 score: 31
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.NELLHFER.A  MS2 score: 1
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANR.NIETIINTFHQYSVK.L  MS2 score: 43
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMANR.NIETIINTFHQYSVK.L  MS2 score: 37
A4616CDH13, CDHHCadherin-13 precursorCAD13_HUMANR.NITAVGKTLFVHAR.T  MS2 score: 1
A0536S100A6, CACYCalcyclinS10A6_HUMANR.NKDQEVNFQEYVTFLGALALIYNEALK.G  MS2 score: 23
A0536S100A6, CACYCalcyclinS10A6_HUMANR.NKDQEVNFQEYVTFLGALALIYNEALK.G  MS2 score: 19
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.NKIIAATIENAQPILQIDNAR.L  MS2 score: 28
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.NKILTATVDNANVLLQIDNAR.L  MS2 score: 33
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NKLAELEEALQK.A  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NKYEDEINK.R  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NKYEDEINK.R  MS2 score: 25
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANR.NLAVSQVVHK.A  MS2 score: 17
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NLDLDSIIAEVK.A  MS2 score: 33
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NLDLDSIIAEVK.A  MS2 score: 36
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NLDLDSIIAEVK.A  MS2 score: 28
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.NLDLDSIIAEVK.A  MS2 score: 36
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.NLDLDSIIAEVK.A  MS2 score: 36
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVK.A  MS2 score: 33
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVK.A  MS2 score: 1
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVK.A  MS2 score: 32
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVK.A  MS2 score: 36
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVK.A  MS2 score: 28
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NLDLDSIIAEVK.A  MS2 score: 33
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NLDLDSIIAEVK.A  MS2 score: 36
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NLDLDSIIAEVKAQYEEIANR.S  MS2 score: 40
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 51
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 51
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 43
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 51
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 43
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NLDLDSIIAEVKAQYEEIAQR.S  MS2 score: 51
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.NMQDLVEDFK.N  MS2 score: 21
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.NPDGCLK.C  MS2 score: 3
A3616ENO2Gamma enolaseENOG_HUMANR.NPSVL.-  MS2 score: 11
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 4
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 4
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 12
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.NSKIEISELNR.V  MS2 score: 3
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.NTKQEIAEINR.M  MS2 score: 37
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.NTKQEIAEINR.M  MS2 score: 37
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NTKQEIAEINR.M  MS2 score: 41
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.NTKQEIAEINR.M  MS2 score: 37
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANR.NVNIFKFIIPNVVK.Y  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVQALEIELQSQLALK.Q  MS2 score: 37
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVQALEIELQSQLALK.Q  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVQALEIELQSQLALK.Q  MS2 score: 51
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVQALEIELQSQLALK.Q  MS2 score: 49
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVQALEIELQSQLALK.Q  MS2 score: 43
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S  MS2 score: 37
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S  MS2 score: 21
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S  MS2 score: 44
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S  MS2 score: 13
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S  MS2 score: 31
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.QDPPSVVVTSHQAPGEK.K  MS2 score: 8
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.QDPPSVVVTSHQAPGEK.K  MS2 score: 13
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.QEYEQLIAK.N  MS2 score: 1
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.QFTSSSSIK.G  MS2 score: 24
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QLDSIVGER.G  MS2 score: 1
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QLDSIVGER.G  MS2 score: 15
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.QLDSIVGER.G  MS2 score: 15
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.QLDSIVGER.G  MS2 score: 15
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.QLDSIVGER.G  MS2 score: 1
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.QLDSIVGER.G  MS2 score: 15
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANR.QLQSLTCDLESLR.G  MS2 score: 9
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIKT33B_HUMANR.QLVESDINSLRR.I  MS2 score: 5
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 15
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 22
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 22
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 22
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 15
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.QNLEPLFEQYINNLRR.Q  MS2 score: 22
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.QNQEYQR.L  MS2 score: 8
A4616CDH13, CDHHCadherin-13 precursorCAD13_HUMANR.QPFPR.D  MS2 score: 1
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.QPQAIITWYKR.G  MS2 score: 1
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.QRPAEIK.D  MS2 score: 9
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.QRPAEIK.D  MS2 score: 17
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.QRPAEIKDYSPYFK.T  MS2 score: 13
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.QSGSR.G  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QSSVSFR.S  MS2 score: 13
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.QSSVSFRSGGSR.S  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.QSVEADINGLR.R  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.QSVEADINGLRR.V  MS2 score: 5
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.QTVEADVNGLRR.V  MS2 score: 12
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.QVEGMEDWKQDSQLQK.A  MS2 score: 3
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.RGFSASSAR.L  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.RGSIQVDGEELVSGR.S  MS2 score: 6
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 11
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 23
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 28
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 30
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 37
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPDYSVVLLLR.L  MS2 score: 32
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPYFYAPELLFFAK.R  MS2 score: 2
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPYFYAPELLFFAK.R  MS2 score: 14
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.RHPYFYAPELLFFAK.R  MS2 score: 40
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6KRT36_HUMANR.RILDELTLCK.A  MS2 score: 2
A2315MICALL2, MICAL-L2, UNQ5811MICAL-like protein 2MILK2_HUMANR.RLDALELR.G  MS2 score: 0
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.RLLEGEDAHLSSQQASGQSYSSR.E  MS2 score: 49
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.RLLEGEDAHLSSSQFSSGSQSSR.D  MS2 score: 50
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.RLLEGEDAHLSSSQFSSGSQSSR.D  MS2 score: 2
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.RLLEGEDAHLSSSQFSSGSQSSR.D  MS2 score: 34
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.RLLEGEDAHLTQYK.K  MS2 score: 24
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.RLLEGEDAHLTQYK.K  MS2 score: 18
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.RQLDSIVGER.G  MS2 score: 19
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.RQLDSIVGER.G  MS2 score: 19
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.RQLDSIVGER.G  MS2 score: 19
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.RQLDSIVGER.G  MS2 score: 19
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.RSGGGGGR.F  MS2 score: 10
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.RSGGGGGR.F  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.RSGGGGGR.F  MS2 score: 6
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.RTLQGLEIELQSQLSMK.A  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.RTTSSSTR.R  MS2 score: 6
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.RVLDELTLAR.A  MS2 score: 4
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.RVLDELTLAR.A  MS2 score: 4
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.RVLDELTLAR.T  MS2 score: 4
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.RVLQGLEIELQSQLSMK.A  MS2 score: 42
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANR.RYTIAALLSPYSYSTTAVVTNPK.E  MS2 score: 0
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.RYTLNILEEIGGGQK.V  MS2 score: 28
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANR.SASLHLPK.L  MS2 score: 37
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SEIDNVKK.Q  MS2 score: 3
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.SEVTELR.R  MS2 score: 19
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.SEVTELR.R  MS2 score: 21
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.SEVTELRR.V  MS2 score: 22
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.SEVTELRR.V  MS2 score: 28
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SFSTASAITPSVSR.T  MS2 score: 12
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SFSTASAITPSVSR.T  MS2 score: 13
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.SGFSSISVSR.S  MS2 score: 48
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.SGFSSISVSR.S  MS2 score: 22
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.SGFSSISVSR.S  MS2 score: 48
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.SGFSSISVSR.S  MS2 score: 22
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.SGFSSISVSRSR.G  MS2 score: 4
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.SGFSSISVSRSR.G  MS2 score: 4
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SGFSSVSVSR.S  MS2 score: 7
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SGFSSVSVSR.S  MS2 score: 53
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SGFSSVSVSRSR.G  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQR.R  MS2 score: 16
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQR.R  MS2 score: 4
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQR.R  MS2 score: 19
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQR.R  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQRR.T  MS2 score: 7
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQRR.T  MS2 score: 11
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGFSSGSAGIINYQRR.T  MS2 score: 22
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 51
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 48
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 44
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 8
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 38
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 13
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 17
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 55
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 51
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SGGGGGGGLGSGGSIR.S  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: 11
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: 2
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: 4
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: -10
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SGGGGGR.F  MS2 score: 8
A7989TKT, TKT1TransketolaseTKT_HUMANR.SGKPAELLK.M  MS2 score: 3
A4616CDH13, CDHHCadherin-13 precursorCAD13_HUMANR.SIVVSPILIPENQR.Q  MS2 score: 0
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.SKEEAEALYHSK.Y  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLDLDSIIAEVK.A  MS2 score: 28
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLDLDSIIAEVK.A  MS2 score: 29
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLDLDSIIAEVK.A  MS2 score: 46
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLDLDSIIAEVK.A  MS2 score: 51
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLDLDSIIAEVK.A  MS2 score: 30
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 32
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 2
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 32
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 1
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 28
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 21
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SLLEGEGSSGGGGR.G  MS2 score: 5
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.SLLEGQDAK.M  MS2 score: 4
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 44
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 20
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 32
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 37
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 30
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SLPEVPETIELEVR.T  MS2 score: 40
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.SLVGLGGTK.S  MS2 score: 11
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.SLVGLGGTKSISISVAGGGGGFGAAGGFGGR.G  MS2 score: 21
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSK.S  MS2 score: 56
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSK.S  MS2 score: 37
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSK.S  MS2 score: 28
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSK.S  MS2 score: 38
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSK.S  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 42
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 32
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 18
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.SLVNLGGSKSISISVAR.G  MS2 score: 23
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.SLYGLGGSK.R  MS2 score: 27
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.SLYGLGGSK.R  MS2 score: 27
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SLYGLGGSK.R  MS2 score: 27
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SLYGLGGSK.R  MS2 score: 27
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SLYNLGGSK.R  MS2 score: 12
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SLYNLGGSK.R  MS2 score: 5
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SLYNLGGSKR.I  MS2 score: 11
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 47
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 25
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 13
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 24
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 33
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAK.G  MS2 score: 23
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SPGPNVAVNAKGSVYIGGAPDVATLTGGR.F  MS2 score: 0
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.SPHWGSTYSVSVVETDYDQYALLYSQGSK.G  MS2 score: 9
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.SPHWGSTYSVSVVETDYDQYALLYSQGSK.G  MS2 score: 43
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_HUMANR.SQRAGLQFPVGR.I  MS2 score: 4
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNR.K  MS2 score: 24
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNR.K  MS2 score: 26
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNR.K  MS2 score: 7
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNR.K  MS2 score: 28
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNRK.D  MS2 score: 26
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNRK.D  MS2 score: 24
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNRK.D  MS2 score: 20
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.SQYEQLAEQNRK.D  MS2 score: 17
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.SRAEAESWYQTK.Y  MS2 score: 28
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.SRAEAESWYQTK.Y  MS2 score: 28
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.SRAEAESWYQTK.Y  MS2 score: 28
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SRTEAESWYQTK.Y  MS2 score: 11
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.SRTEAESWYQTK.Y  MS2 score: 16
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SSPGK.S  MS2 score: 11
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.SSPGK.S  MS2 score: 5
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SSYSR.F  MS2 score: 4
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SSYSR.F  MS2 score: 3
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SSYSRFSSSGGR.G  MS2 score: 0
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANR.SSYSRFSSSGGR.G  MS2 score: 3
A6935LYZ, LZMLysozyme C precursorLYSC_HUMANR.STDYGIFQINSR.Y  MS2 score: 37
A7989TKT, TKT1TransketolaseTKT_HUMANR.SVPTSTVFYPSDGVATEK.A  MS2 score: 0
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.TAAENDFVTLK.K  MS2 score: 13
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANR.TAAENEFVTLKK.D  MS2 score: 25
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANR.TAAENEFVTLKK.D  MS2 score: 25
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.TAAENEFVTLKK.D  MS2 score: 33
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANR.TAAENEFVTLKK.D  MS2 score: 25
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.TDDIGTASGWGLTQR.G  MS2 score: 7
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.TDLEMQIEGLK.E  MS2 score: 37
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.TDLEMQIEGLK.E  MS2 score: 37
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.TDLEMQIEGLKEELAYLR.K  MS2 score: 33
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.TDLEMQIEGLKEELAYLR.K  MS2 score: 47
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TEAESWYQTK.Y  MS2 score: 25
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TEAESWYQTK.Y  MS2 score: 25
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TEAESWYQTKYEELQQTAGR.H  MS2 score: 29
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.TEELNR.E  MS2 score: 7
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TEEREQIK.T  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLR.R  MS2 score: 43
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLR.R  MS2 score: 46
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLR.R  MS2 score: 61
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 15
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 21
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 10
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 18
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 14
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 3
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 12
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 25
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.THNLEPYFESFINNLRR.R  MS2 score: 16
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TIEELQNK.I  MS2 score: 9
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TIEELQNKILTATVDNANILLQIDNAR.L  MS2 score: 12
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TIEELQNKILTATVDNANILLQIDNAR.L  MS2 score: 23
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TIVEEVQDGK.V  MS2 score: 18
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TKFETEQALR.L  MS2 score: 9
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.TKYEHELALR.Q  MS2 score: 6
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.TKYEHELALR.Q  MS2 score: 28
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.TKYETELNLR.M  MS2 score: 14
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANR.TLDLGENQLETLPPDLLR.G  MS2 score: 23
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 7
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 19
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 23
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 25
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TLLEGEESR.M  MS2 score: 41
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.TLQGLEIELQSQLSMK.A  MS2 score: 18
A1256UBBPolyubiquitin-BUBIQ_HUMANR.TLSDYNIQKESTLHLVLR.L  MS2 score: 49
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.TLTLALIWQLMR.R  MS2 score: 17
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4H4_HUMANR.TLYGFGG.-  MS2 score: 17
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.TMLLQPAGSLGSYSYR.S  MS2 score: 3
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TMQALEIELQSQLSMK.A  MS2 score: 37
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TMQALEIELQSQLSMK.A  MS2 score: 10
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.TMQELEIELQSQLSMK.A  MS2 score: 36
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.TMQNLEIELQSQLSMK.A  MS2 score: 37
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.TMQNLEIELQSQLSMK.A  MS2 score: 38
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 20
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 17
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 22
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 18
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 15
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIK.K  MS2 score: 9
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 34
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 10
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 28
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 19
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 24
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TNAENEFVTIKK.D  MS2 score: 26
A735CA1BGAlpha-1B-glycoprotein precursorA1BG_HUMANR.TPGAAANLELIFVGPQHAGNYR.C  MS2 score: 68
A2315MICALL2, MICAL-L2, UNQ5811MICAL-like protein 2MILK2_HUMANR.TPRPASPGPSLPAR.S  MS2 score: 2
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANR.TQTPR.A  MS2 score: 10
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.TSCRLSGGLGAGSCR.L  MS2 score: 4
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TSFTSVSR.S  MS2 score: 22
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TSFTSVSR.S  MS2 score: 6
A7989TKT, TKT1TransketolaseTKT_HUMANR.TSRPENAIIYNNNEDFQVGQAK.V  MS2 score: 46
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.TSTASGLLLWQGVEVGEAGQGK.D  MS2 score: 11
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.TSTASGLLLWQGVEVGEAGQGK.D  MS2 score: 26
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TTAENEFVMLKK.D  MS2 score: 25
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.TTAENEFVMLKK.D  MS2 score: 22
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L  MS2 score: 27
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L  MS2 score: 26
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.TTSSSTR.R  MS2 score: 1
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.TVAACNLPIVR.G  MS2 score: 3
A8051PRSS3, mesotrypsinogen, PRSS4Trypsin III precursorTRY3_HUMANR.TWRAAR.D  MS2 score: 10
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANR.VAAGAFQGLR.Q  MS2 score: 48
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.VAPEEHPVLLTEAPLNPK.A  MS2 score: 17
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.VAPEEHPVLLTEAPLNPK.A  MS2 score: 26
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.VDQLKSDQSR.L  MS2 score: 0
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.VDQLKSDQSR.L  MS2 score: 8
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.VDQLKSDQSR.L  MS2 score: 6
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANR.VDQLKSDQSR.L  MS2 score: 1
A182AVMO1, UNQ6350/PRO21055, UNQ6350Vitteline membrane outer layer protein 1 homolog precursorVMO1_HUMANR.VEAPTTLGDNTAANNVR.F  MS2 score: 23
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.VEYITGPGVTTYK.A  MS2 score: 1
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.VEYITGPGVTTYK.A  MS2 score: 2
A2315MICALL2, MICAL-L2, UNQ5811MICAL-like protein 2MILK2_HUMANR.VGAGSRPKPEAPMAK.G  MS2 score: 2
A5984CTSD, CPSDCathepsin D precursorCATD_HUMANR.VGFAEAAR.L  MS2 score: 33
A9139UMODUromodulin precursorUROM_HUMANR.VGGTGMFTVR.M  MS2 score: 18
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_HUMANR.VHPVSTMIK.G  MS2 score: 8
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.VIQRLQGEIAHVK.K  MS2 score: 0
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.VISSGSVASYVTSPQGFQFR.R  MS2 score: 2
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.VLDELTLAR.A  MS2 score: 10
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.VLDELTLAR.A  MS2 score: 3
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANR.VLDELTLAR.A  MS2 score: 36
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.VLDELTLAR.A  MS2 score: 10
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.VLDELTLAR.A  MS2 score: 3
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANR.VLDELTLAR.A  MS2 score: 36
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.VLDELTLAR.T  MS2 score: 10
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.VLDELTLAR.T  MS2 score: 36
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.VLDELTLAR.T  MS2 score: 3
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANR.VLDELTLAR.T  MS2 score: 36
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.VLDELTLAR.T  MS2 score: 3
A3787KRT19, K19Keratin, type I cytoskeletal 19K1C19_HUMANR.VLDELTLAR.T  MS2 score: 36
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.VLDELTLTK.A  MS2 score: 13
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.VLDELTLTK.A  MS2 score: 14
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.VLDELTLTK.A  MS2 score: 6
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.VLDELTLTK.A  MS2 score: 23
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANR.VLDELTLTK.A  MS2 score: 6
A7989TKT, TKT1TransketolaseTKT_HUMANR.VLDPFTIKPLDR.K  MS2 score: 4
A9139UMODUromodulin precursorUROM_HUMANR.VLNLGPITR.K  MS2 score: 8
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.VLQGLEIELQSQLSMK.A  MS2 score: 17
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANR.VLQGLEIELQSQLSMK.A  MS2 score: 47
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.VNHLYSDLSDALVIFQLYEK.I  MS2 score: 37
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.VNHLYSDLSDALVIFQLYEK.I  MS2 score: 31
A1819B2M, HDCMA22PBeta-2-microglobulin precursorB2MG_HUMANR.VNHVTLSQPK.I  MS2 score: 30
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.VNKPPYPK.L  MS2 score: 4
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANR.VPTANVSVVDLTCR.L  MS2 score: 3
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANR.VSLAGACGVGGYGSR.S  MS2 score: 2
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.VTKCCTESLVNR.R  MS2 score: 9
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANR.VTKCCTESLVNR.R  MS2 score: 4
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.VTVTSEGGRGTLIIR.D  MS2 score: 2
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.VVAQGVGIPEDSIFTMADR.G  MS2 score: 37
A8383AMBP, ITIL, HCPAMBP protein precursorAMBP_HUMANR.VVAQGVGIPEDSIFTMADR.G  MS2 score: 22
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.VYALPEDLVEVNPK.M  MS2 score: 5
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.VYALPEDLVEVNPK.M  MS2 score: 7
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANR.VYSTSVTGSR.E  MS2 score: 40
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANR.VYSTSVTGSR.E  MS2 score: 49
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMANR.VYSTSVTGSR.E  MS2 score: 45
A6606GK2, GKP2, GKTAGlycerol kinase, testis specific 2GLPK2_HUMANR.WLRDNLGIIETSGDIER.L  MS2 score: 25
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANR.WTLTAPPGYRLR.L  MS2 score: 7
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.WTRISSTPAK.L  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YELGSGLAVLR.S  MS2 score: 6
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.YGSGGGSK.G  MS2 score: 10
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.YGSGGGSKGGSISGGGYGSGGGK.H  MS2 score: 12
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANR.YISPDQLADLYK.S  MS2 score: 24
A0361YWHAZ14-3-3 protein zeta/delta1433Z_HUMANR.YLAEVAAGDDK.K  MS2 score: 2
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANR.YLDGLTAER.T  MS2 score: 31
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 25
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 2
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 23
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 8
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 14
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 13
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANR.YQLGSGEAR.L  MS2 score: 34
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 27
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 36
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 41
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 37
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 36
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTK.G  MS2 score: 35
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTKGELK.V  MS2 score: 42
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTKGELK.V  MS2 score: 37
A274ES100P, S100ES-100P proteinS100P_HUMANR.YSGSEGSTQTLTKGELK.V  MS2 score: 28
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.YSLTYIYTGLSK.H  MS2 score: 41
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.YSLTYIYTGLSK.H  MS2 score: 58
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANR.YSLTYIYTGLSK.H  MS2 score: 47
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.YTLNILEEIGGGQK.V  MS2 score: 25
A5086LCP1, PLS2Plastin-2PLSL_HUMANR.YTLNILEEIGGGQK.V  MS2 score: 35

Compile date 12-23-2014© PADB initiative