PADB-logoLSSR - PepMap molecular information by study

Study ID 18614015
Species mouse
Disease healthy
Tissue / Source cerebrum; cerebellum; brainstem; spinal cord; kidney; liver; heart; skeletal muscle; adipose; stomach; small intestine; large intestine; testis; placenta
Compartment mitochondria

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A9600MRPL27, HSPC25039S ribosomal protein L27, mitochondrialNP_444391(-)MAAAALTLR(T)   peptide count: 1
A9600MRPL27, HSPC25039S ribosomal protein L27, mitochondrialXP_892550(-)MAAAALTLR(T)   peptide count: 1
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorNP_570954(-)MAALSNVRWLTR(A)   peptide count: 1
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6NP_080402(-)MAANSQGNFDGKFEALDLAELTK(K)   peptide count: 2
A890CCOA6Uncharacterized protein C1ORF31NP_778152(-)MAAPSMK(E)   peptide count: 1
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitNP_033968(-)MAAVKTLNPK(A)   peptide count: 9
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartNP_034304(-)MADAFVGTWK(L)   peptide count: 6
A1481HINT1, HINT, PKCI1Histidine triad nucleotide-binding protein 1NP_032274(-)MADEIAK(A)   peptide count: 1
A5416NAP1L1, NRPNucleosome assembly protein 1-like 1NP_056596(-)MADIDNK(E)   peptide count: 1
A2591SSB, SS-B/LaLupus La proteinNP_033304(-)MAENGDNEK(M)   peptide count: 1
A497CSEC62, TLOC1, HTP-1Translocational protein-1NP_081292(-)MAERRRHK(K)   peptide count: 1
A7013MFN1, hfzo2, FZOMitofusin-1NP_077162(-)MAETVSPLKHFVLAKK(A)   peptide count: 1
A0629MAST2, MAST205, HMAST205Microtubule-associated serine/threonine-protein kinase 2NP_001036208(-)MAFQK(A)   peptide count: 1
A0629MAST2, MAST205, HMAST205Microtubule-associated serine/threonine-protein kinase 2NP_032667(-)MAFQK(A)   peptide count: 1
A0630MAST1, SASTMicrotubule-associated serine/threonine-protein kinase 1NP_064329(-)MAFQK(A)   peptide count: 1
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorNP_034404(-)MAFQK(A)   peptide count: 1
A6973MAST4Microtubule-associated serine/threonine-protein kinase 4XP_283179(-)MAFQK(A)   peptide count: 1
A062CKIF1A, ATSV, HSKIF1AKinesin-like protein KIF1ANP_032466(-)MAGASVK(V)   peptide count: 2
A042BSPOPSpeckle-type POZ proteinNP_997154(-)MAGDMEFK(S)   peptide count: 1
A4182PDS5B, APRIN, AS3Sister chromatid cohesion protein PSD homolog BNP_780519(-)MAHSK(T)   peptide count: 1
A6515FMO4, FMO2Dimethylaniline monooxygenase [N-oxide forming] 4NP_659127(-)MAKKVAVIGAGVSGLSSIK(C)   peptide count: 1
A3588PYGBGlycogen phosphorylase, brain formNP_722476(-)MAKPLTDSERQK(Q)   peptide count: 1
A9558RPL2960S ribosomal protein L29NP_033108(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_484210(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_620107(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_622633(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_979163(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_990228(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_995784(-)MAKSKNHTTHNQSR(K)   peptide count: 2
A298ACNOT1, CDC39, NOT1CCR4-NOT transcription complex, subunit 1XP_979726(-)MAKSNSGIEK(G)   peptide count: 1
A1290UBE2D3, UBC5C, UBCH5CUbiquitin-conjugating enzyme E2 D3NP_079632(-)MALKRINK(E)   peptide count: 1
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit ENP_031536(-)MALSDADVQKQIKHMMAFIEQEANEKAEEIDAK(A)   peptide count: 1
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_907583(-)MAMNFGDWHLFRSMVLEMR(S)   peptide count: 2
A2838ZNF436Zinc finger protein 436NP_033583(-)MAMYLTREEWRPLDPTQRDLYR(D)   peptide count: 1
A161CMYL1Myosin light chain 1/3, skeletal muscleNP_067260(-)MAPKKDVKKPAAAPAPAPAPAPAPAKPK(E)   peptide count: 1
A9548RPL22, RPL22L260S ribosomal protein L22NP_033105(-)MAPVKK(L)   peptide count: 1
A9540RPL1160S ribosomal protein L11XP_981252(-)MAQDQGEKENLMR(E)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(-)MAQQAADKYLYVDK(N)   peptide count: 1
A875BCHP1, CHPCalcium-binding protein p22XP_622645(-)MAQSQITSLYSR(F)   peptide count: 1
A012EZfp747Zinc finger protein 747NP_780769(-)MAQVMAPGR(A)   peptide count: 1
A621AISY1, ISY1-RAB43Pre-mRNA-splicing factor ISY1 homologNP_598695(-)MARNAEK(A)   peptide count: 1
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like proteinNP_083085(-)MARNTLSSRFR(R)   peptide count: 4
A1373HIST1H3A, H3FA, HIST1H3BHistone H3NP_659539(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3NP_835513(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3NP_835514(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3NP_038578(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3XP_356549(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3XP_001001643(-)MARTKQTAR(K)   peptide count: 1
A1373HIST1H3A, H3FA, HIST1H3BHistone H3XP_001001657(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_062342(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_473386(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_038576(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_783584(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_835511(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_835510(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_835512(-)MARTKQTAR(K)   peptide count: 1
A519AHIST2H3A, HIST2H3C, H3F2Histone H3.2NP_835587(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3ANP_032236(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3ANP_032237(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AXP_900402(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AXP_902036(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AXP_889622(-)MARTKQTAR(K)   peptide count: 1
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AXP_892907(-)MARTKQTAR(K)   peptide count: 1
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(-)MASPLRFDGRVVLVTGAGGGLGR(A)   peptide count: 1
A083CLAPTM5Lysosomal-associated transmembrane protein 5NP_034816(-)MASRAAPVR(Q)   peptide count: 2
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorNP_058052(-)MATAMTVSSK(L)   peptide count: 1
A7556PAICS, ADE2, AIRCMultifunctional protein ADE2NP_080215(-)MATAVVVNIGKKLYEGK(T)   peptide count: 1
A0369LDHBL-lactate dehydrogenase B chainNP_032518(-)MATLKEKLIASVADDEAAVPNNK(I)   peptide count: 4
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ANP_058655(-)MAVGKNKR(L)   peptide count: 1
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3AXP_999639(-)MAVGKNKR(L)   peptide count: 1
A3816RPS340S ribosomal protein S3NP_036182(-)MAVQISKKR(K)   peptide count: 1
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT16NP_291096(-)MAVTLDKDAYYRR(V)   peptide count: 1
A9531PCBP1Poly(rC)-binding protein 1NP_035995(-)MDAGVTESGLNVTLTIRLLMHGK(E)   peptide count: 1
A7908AARSAlanyl-tRNA synthetaseNP_666329(-)MDATLTAREIR(E)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_906671(-)MDAVGK(E)   peptide count: 3
A0361YWHAZ14-3-3 protein zeta/deltaNP_035870(-)MDKNELVQK(A)   peptide count: 10
A7421AGPAT4, UNQ499/PRO1016, UNQ4991-acylglycerol-3-phosphate O- acyltransferase 4NP_080920(-)MDLIGLLK(S)   peptide count: 1
A3910NAPB, SNAPBBeta-soluble NSF attachment proteinNP_062606(-)MDNAGKEREAVQLMAEAEK(R)   peptide count: 1
A0596NAPA, SNAPAAlpha-soluble NSF attachment proteinNP_080174(-)MDNSGKQAEAMALLAEAER(K)   peptide count: 1
A8461Serpinb6dMCG20280NP_001070258(-)MDPLPKLNTK(F)   peptide count: 1
A3205TPM3Tropomyosin alpha 3 chainNP_071709(-)MEAIK(K)   peptide count: 2
A2341ACTN1Alpha-actinin 1NP_598917(-)MEELGR(V)   peptide count: 1
A2344ACTN4Alpha-actinin 4NP_068695(-)MEELGR(V)   peptide count: 1
A8039TRMT44, METTL19, UPF0383Probable tRNA (uracil-O(2)-)-methyltransferaseNP_084484(-)MEELGR(V)   peptide count: 1
A662BTMEM205, UNQ501/PRO1018, UNQ501Transmembrane protein 205NP_848692(-)MEKGEDPGSLIK(V)   peptide count: 1
A624DKank4, KANK4, ANKRD38Ankyrin repeat domain-containing protein 38NP_766460(-)MEKIDGKDQSSQGDEEK(E)   peptide count: 1
A0924TOP2A, TOP2DNA topoisomerase 2NP_035753(-)MELSPLQPVNENMLMNKKK(N)   peptide count: 1
A473DFSIP2Fibrous sheath-interacting protein 2XP_485018(-)MELYLSACSK(T)   peptide count: 2
A220D PREDICTED: Hypothetical protein XP_496281NP_001014836(-)MENVR(R)   peptide count: 3
A6901LIPEHormone sensitive lipaseNP_034849(-)MEPAVESAPVGAQASKQGKEGSK(N)   peptide count: 1
A375CSLC12A2, NKCC1Solute carrier family 12 member 2NP_033220(-)MEPGPAGPR(L)   peptide count: 1
A0492STIP1Stress-induced-phosphoprotein 1NP_058017(-)MEQVNELKEKGNK(A)   peptide count: 2
A5599TMEM126ATransmembrane protein 126ANP_079736(-)MESHKPSTSK(D)   peptide count: 2
A5599TMEM126ATransmembrane protein 126ANP_079736(-)MESHKPSTSKDDLILNIISR(K)   peptide count: 9
A4291DNAJB12DnaJ homolog subfamily B member 12NP_064349(-)MESNKDEAER(C)   peptide count: 1
A731CSLC30A9, HUELZinc transporter 9NP_848766(-)MESVGAAGGSEAGGGVR(V)   peptide count: 1
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(-)MEVHELFR(Y)   peptide count: 1
A2090WDR38WD repeat-containing protein 38NP_083963(-)MEWAPMNIR(A)   peptide count: 2
A6097COX1, CO1, COICytochrome c oxidase subunit 1NP_904330(-)MFINR(W)   peptide count: 18
A9731NFU1, HIRIP5, CGI-33HIRA-interacting protein 5NP_064429(-)MFIQTQDTPNPNSLK(F)   peptide count: 7
A4795EVPLEnvoplakinNP_079552(-)MFKGLSKGSQGK(G)   peptide count: 1
A733CMP68, PRO15746.8 kDa mitochondrial proteolipidNP_081636(-)MFQTLIQK(V)   peptide count: 78
A112CCBARA1, MICU1, CALCCalcium binding atopy-related autoantigen 1NP_659071(-)MFRLNTLSALAELAVGSR(W)   peptide count: 3
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorNP_082664(-)MFSLALRARATGLAAQWGR(H)   peptide count: 2
A5268AMN, UNQ513, UNQ513/PRO1028Protein amnionlessNP_291081(-)MGALGR(V)   peptide count: 1
A5917BACE2, AEPLC, ALP56Beta secretase 2 precursorNP_062390(-)MGALLR(A)   peptide count: 26
A7223OATOrnithine aminotransferase, mitochondrial precursorNP_058674(-)MGALLR(A)   peptide count: 26
A859D4930480E11RikMCG52719XP_135942(-)MGDQRLPENQLPR(L)   peptide count: 1
A4218SMC1A, SB1.8, SMC1Structural maintenance of chromosome 1-like 1 proteinNP_062684(-)MGFLK(L)   peptide count: 1
A521DGTPBP2, PRO1181GTP binding protein 2NP_062527(-)MGGNLKARGAGGSSSCGGPK(G)   peptide count: 1
A9555RPL2760S ribosomal protein L27XP_110983(-)MGKFMKSR(K)   peptide count: 1
A357DFAM133BProtein FAM133BNP_001035966(-)MGKRDNRVAYMNPIAMAR(S)   peptide count: 1
A7796SERHL, SERHL2Serine hydrolase-like proteinNP_075964(-)MGLHSELK(L)   peptide count: 2
A4058ARL2, SNX15ADP-ribosylation factor-like protein 2NP_062696(-)MGLLTILKKMK(Q)   peptide count: 1
A4058ARL2, SNX15ADP-ribosylation factor-like protein 2NP_062696(-)MGLLTILKKMK(Q)   peptide count: 2
A9561RPL3160S ribosomal protein L31XP_996947(-)MGLPVTR(K)   peptide count: 2
A427DFAM49APutative uncharacterized protein FAM49ANP_084034(-)MGNLLK(V)   peptide count: 1
A428DFAM49B, BM009, BM-009Protein FAM49BNP_659095(-)MGNLLK(V)   peptide count: 1
A5330FMN2, HT016Formin 2NP_062318(-)MGNQDGKLK(R)   peptide count: 2
A5402NLRP5, MATER, NALP5NACHT-, LRR- and PYD-containing protein 5NP_001034232(-)MGPPEKESKAILK(A)   peptide count: 1
A5402NLRP5, MATER, NALP5NACHT-, LRR- and PYD-containing protein 5NP_035990(-)MGPPEKESKAILK(A)   peptide count: 1
A9630RPS1340S ribosomal protein S13NP_080809(-)MGRMHAPGK(G)   peptide count: 1
A9630RPS1340S ribosomal protein S13XP_894950(-)MGRMHAPGK(G)   peptide count: 1
A9630RPS1340S ribosomal protein S13XP_900154(-)MGRMHAPGK(G)   peptide count: 1
A9048RUTBC1, SGSM2Small G protein signaling modulator 2NP_922934(-)MGSAEDAVK(E)   peptide count: 1
A174CMYO1FMyosin IfNP_444444(-)MGSKER(F)   peptide count: 2
A189DCMC2, DC13UPF0287 protein DC13NP_081120(-)MHPDLSPHLHTEECNVLINLLK(E)   peptide count: 3
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_001034246(-)MHQAKALDSARKMSNNSNK(R)   peptide count: 21
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_067377(-)MHQAKALDSARKMSNNSNK(R)   peptide count: 21
A9699COX16, HSPC203, PTD019Cytochrome C oxidase assembly protein COX16 homolog, mitochondrialNP_079737(-)MIAPAVLR(A)   peptide count: 4
A976BFABP9Fatty acid-binding protein 9NP_035728(-)MIEPFLGTWK(L)   peptide count: 2
A8745DCUN1D1, DCUN1L1, RP42DCN1-like protein 1NP_296372(-)MIFTQSSEKTAVSCLSQNDWK(L)   peptide count: 1
A5478SPATA19, SPERGEN1Spergen-1NP_083575(-)MIITTWIMYIFAR(K)   peptide count: 1
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1NP_064377(-)MILGAVGSVLTSLLRIHR(A)   peptide count: 1
A125DFATSUncharacterized protein C10ORF90XP_899810(-)MISPVVISR(L)   peptide count: 1
A125DFATSUncharacterized protein C10ORF90XP_899810(-)MISPVVISRLIDEK(K)   peptide count: 1
A6614GLYAT, ACGNAT, CATGlycine N-acyltransferaseNP_666047(-)MIVPLQGAQMLQMLEK(S)   peptide count: 4
A2614PAPOLG, PAP2, PAPGPoly(A) polymerase gammaNP_766143(-)MKEMSANTMLDSQR(Q)   peptide count: 1
A0060GNG3, GNGT3Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-3 subunitNP_034446(-)MKGETPVNSTMSIGQAR(K)   peptide count: 1
A7957TECR, GPSN2, SC2Synaptic glycoprotein SC2NP_598879(-)MKHYEVEIR(D)   peptide count: 1
A6010Cbr2Carbonyl reductase [NADPH] 2NP_031647(-)MKLNFSGLR(A)   peptide count: 1
A7307Pbld1Phenazine biosynthesis-like domain-containing protein 1NP_080977(-)MKLPIFIADAFTATAFR(G)   peptide count: 1
A7308Pbld2Phenazine biosynthesis-like domain-containing protein 2NP_080361(-)MKLPIFIADAFTATAFR(G)   peptide count: 1
A9239Vmn2r1Vomeronasal type-2 receptor 1XP_994874(-)MKMAIR(K)   peptide count: 1
A9462GPCR, CASRL1Seven transmembrane helix receptorXP_994913(-)MKMAIR(K)   peptide count: 1
A3619DDOST, OST48Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit precursorNP_031864(-)MKMDPR(L)   peptide count: 1
A9577RPL9, RPL9P7, RPL9P860S ribosomal protein L9XP_621250(-)MKTILSNETVHIPENVDITLKGR(T)   peptide count: 1
A9661MRPS10, MSTP040, PNAS-12228S ribosomal protein S10, mitochondrialNP_898909(-)MKWVPLSNLHVDVPKDVTRPTITTSDEPDTLYK(R)   peptide count: 1
A012F PREDICTED: hypothetical proteinXP_991022(-)MLAGSPGGGKSHYYLARPRPQR(K)   peptide count: 2
A6108CYP11A1, CYP11ACytochrome P450 11A1, mitochondrial precursorNP_062753(-)MLAKGLSLRSVLVK(G)   peptide count: 1
A3916NIPSNAP3A, NIPSNAP4, HSPC299NipSnap4 proteinNP_079899(-)MLALRSGLR(T)   peptide count: 1
A9484SRPRSignal recognition particle receptor alpha subunitNP_080406(-)MLDFFTIFSK(G)   peptide count: 1
A7955TDHL-threonine 3-dehydrogenaseNP_067455(-)MLFLGMLKQVVNGTAQSK(A)   peptide count: 1
A7909AARS2, AARSLProbable alanyl-tRNA synthetase, mitochondrial precursorNP_941010(-)MLGARR(L)   peptide count: 1
A7928NARS2Asparaginyl-tRNA synthetase 2NP_705819(-)MLGARR(L)   peptide count: 1
A8055TPSB2, TPS2Tryptase beta-2NP_034911(-)MLGARR(L)   peptide count: 1
A6229COX6B2, COXVIB2Cytochrome c oxidase subunit VIb testes-specific isoformNP_899664(-)MLGVQAQKPPPGQWTTPPFDPR(F)   peptide count: 1
A6229COX6B2, COXVIB2Cytochrome c oxidase subunit VIb testes-specific isoformNP_899665(-)MLGVQAQKPPPGQWTTPPFDPR(F)   peptide count: 1
A0276CIT, CRIK, STK21Citron proteinNP_031734(-)MLKFKYGVR(N)   peptide count: 3
A6102COX7BCytochrome C oxidase subunit 7B, mitochondrialNP_079655(-)MLPLAKNALSRLQVR(S)   peptide count: 1
A862CBOLA1, CGI-143BOLA-like protein 1NP_081251(-)MLSARSAQCMVSMATRSCVSR(G)   peptide count: 1
A7778SEC11A, SEC11L1, SPC18Microsomal signal peptidase 18 kDa subunitNP_064335(-)MLSLDFLDDVR(R)   peptide count: 1
A7778SEC11A, SEC11L1, SPC18Microsomal signal peptidase 18 kDa subunitNP_064335(-)MLSLDFLDDVRR(M)   peptide count: 1
A980CCCDC15Coiled-coil domain-containing protein 15XP_905792(-)MLTSGQAFISQKSMPGGMAPLKKPR(N)   peptide count: 1
A980CCCDC15Coiled-coil domain-containing protein 15XP_996658(-)MLTSGQAFISQKSMPGGMAPLKKPR(N)   peptide count: 1
A980CCCDC15Coiled-coil domain-containing protein 15XP_996713(-)MLTSGQAFISQKSMPGGMAPLKKPR(N)   peptide count: 1
A8191VPS29, DC7, DC15Vacuolar protein sorting 29NP_062754(-)MLVLVLGDLHIPHR(C)   peptide count: 3
A3794MECR, NBRF1, CGI-63Trans-2-enoyl-CoA reductase, mitochondrialNP_079573(-)MLVSQR(V)   peptide count: 1
A276D SpenixXP_620381(-)MLYLKGAQGRR(F)   peptide count: 1
A9985MAPKBP1, JNKBP1Mitogen-activated protein kinase-binding protein 1NP_036071(-)MMAGEGSTITSRIK(N)   peptide count: 1
A570DXTP5PUMILIO domain-containing protein KIAA0020NP_803425(-)MMEVKGKK(K)   peptide count: 1
A391ETHNSL1Threonine synthase-like 1NP_001001297(-)MMGIPIR(K)   peptide count: 1
A391ETHNSL1Threonine synthase-like 1NP_808256(-)MMGIPIR(K)   peptide count: 1
A391ETHNSL1Threonine synthase-like 1NP_001001297(-)MMGIPIRK(F)   peptide count: 1
A391ETHNSL1Threonine synthase-like 1NP_808256(-)MMGIPIRK(F)   peptide count: 1
A965BEXOC1, SEC3, SEC3L1Exocyst complex component 1XP_978672(-)MMIKIFR(C)   peptide count: 1
A885BCLPB, HSP78, SKD3Suppressor of potassium transport defect 3NP_033217(-)MMLSAVLR(R)   peptide count: 1
A216CNDUFC2, HLC1NADH dehydrogenase [ubiquinone] 1 subunit C2NP_077182(-)MMNGRPGHEPLK(F)   peptide count: 7
A0063GNG7, GNGT7Guanine nucleotide-binding protein G(i)/G(s)/G(o) gamma-7 subunitNP_001033744(-)MMSGTNNVAQAR(K)   peptide count: 2
A0063GNG7, GNGT7Guanine nucleotide-binding protein G(i)/G(s)/G(o) gamma-7 subunitNP_034449(-)MMSGTNNVAQAR(K)   peptide count: 2
A0382MT-ATP6, ATP6, ATPASE6ATP synthase F0 subunit 6NP_904333(-)MNENLFASFITPTMMGFPIVVAIIMFPSILFPSSK(R)   peptide count: 2
A573AIGF2BP1, IMP-1, CRDBPInsulin-like growth factor 2 mRNA-binding protein 1NP_034081(-)MNKLYIGNLNESVTPADLEK(V)   peptide count: 4
A7228BCKDHB2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursorNP_954665(-)MNLFQSITSALDNSLAK(D)   peptide count: 46
A5694ACSL3, ACS3, FACL3Long-chain-fatty-acid--CoA ligase 3NP_001028778(-)MNNHVSSTPSTMKLK(Q)   peptide count: 2
A5694ACSL3, ACS3, FACL3Long-chain-fatty-acid--CoA ligase 3NP_083093(-)MNNHVSSTPSTMKLK(Q)   peptide count: 2
A580AMTIF2Mitochondrial translational initiation factor 2 precursorNP_598528(-)MNQKLLK(L)   peptide count: 6
A812CARMC1, ARCPArmadillo repeat-containing protein 1NP_083116(-)MNSSSSTMNEEPDALSVVNQLR(D)   peptide count: 1
A812CARMC1, ARCPArmadillo repeat-containing protein 1NP_083116(-)MNSSSSTMNEEPDALSVVNQLR(D)   peptide count: 2
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorXP_896808(-)MPAKR(Q)   peptide count: 2
A120D UPF0728 protein C10ORF53NP_001029209(-)MPAQAVVTLR(Y)   peptide count: 1
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_663335(-)MPEINTSHLDEK(Q)   peptide count: 3
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_808875(-)MPEINTSHLDEK(Q)   peptide count: 3
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-ENP_835586(-)MPELAK(S)   peptide count: 3
A497AHIST1H2BA, TSH2B, STBPHistone H2B, testisNP_783594(-)MPEVAVK(G)   peptide count: 2
A9637RPS1940S ribosomal protein S19XP_001005575(-)MPGVTVKEVNQQEFVR(A)   peptide count: 1
A9637RPS1940S ribosomal protein S19XP_907314(-)MPGVTVKEVNQQEFVR(A)   peptide count: 1
A0648S100A10, ANX2LG, CAL1LCalpactin I light chainNP_033138(-)MPSQMEHAMETMMLTFHRFAGDKDHLTK(E)   peptide count: 2
A9556L27a, RPL27A, L27A60S ribosomal protein L27aNP_036105(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_137118(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_141310(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_484309(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_620643(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_980250(-)MPSRLR(K)   peptide count: 1
A9556L27a, RPL27A, L27A60S ribosomal protein L27aXP_001004506(-)MPSRLR(K)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_356994(-)MQIFMK(T)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorNP_063936(-)MQIFVK(T)   peptide count: 17
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_989861(-)MQIFVK(T)   peptide count: 17
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_001000017(-)MQIFVK(T)   peptide count: 15
A1256UBBPolyubiquitin-BNP_035794(-)MQIFVK(T)   peptide count: 17
A1256UBBPolyubiquitin-BNP_062613(-)MQIFVK(T)   peptide count: 17
A1256UBBPolyubiquitin-BXP_978405(-)MQIFVK(T)   peptide count: 16
A1256UBBPolyubiquitin-BXP_984804(-)MQIFVK(T)   peptide count: 17
A1256UBBPolyubiquitin-BXP_997313(-)MQIFVK(T)   peptide count: 17
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorNP_001029037(-)MQIFVK(T)   peptide count: 17
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorNP_077239(-)MQIFVK(T)   peptide count: 17
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_889611(-)MQIFVK(T)   peptide count: 17
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_984563(-)MQIFVK(T)   peptide count: 17
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_001002242(-)MQIFVK(T)   peptide count: 17
A0155CDC42Cell division control protein 42 homologNP_033991(-)MQTIKCVVVGDGAVGKTCLLISYTTNK(F)   peptide count: 1
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(-)MQTQEILR(I)   peptide count: 2
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(-)MQTQEILR(I)   peptide count: 2
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(-)MQTQEILR(I)   peptide count: 2
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(-)MQTQEILR(I)   peptide count: 2
A777BABCB10ATP-binding cassette, sub-family B, member 10, mitochondrial precursorNP_062425(-)MRAPSAR(A)   peptide count: 1
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainNP_033476(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A5190TUBB2BTubulin beta-2B chainNP_076205(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainNP_666228(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chainNP_075768(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chainNP_033477(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainNP_035785(-)MREIVHIQAGQCGNQIGAK(F)   peptide count: 5
A013F PREDICTED: hypothetical protein LOC77671XP_991420(-)MRPRSSAPPR(R)   peptide count: 1
A7294PAPSS2, ATPSK2Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2NP_035994(-)MSANFKMNHKR(D)   peptide count: 1
A8813GLRX5Glutaredoxin-related protein 5, mitochondrialNP_082695(-)MSASLSR(A)   peptide count: 1
A6299DGKG, DAGK3Diacylglycerol kinase gammaNP_619591(-)MSEEQWVSLSSEEFDQLQK(Y)   peptide count: 1
A650DLGALS2Galectin-2NP_079898(-)MSEKFEVKDLNMKPGMSLK(I)   peptide count: 1
A799DPhxr5Putative per-hexamer repeat protein 5XP_890391(-)MSENGKTVTGSMSGNGK(T)   peptide count: 1
A766CAPOA1BP, AIBP, YJEFN1Apolipoprotein A-I binding proteinNP_659146(-)MSGLRTLLGLGLLVAGSRLPR(V)   peptide count: 1
A014F PREDICTED: hypothetical proteinXP_992660(-)MSGNITNGNITSGNIMSDNIK(S)   peptide count: 4
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_694813(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_291074(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_835515(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_783585(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_783586(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_783587(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_835582(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_835583(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_783588(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_783583(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_835499(-)MSGRGKGGK(G)   peptide count: 1
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4NP_835500(-)MSGRGKGGK(G)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835496(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835495(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835494(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835493(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835491(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835492(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_783591(-)MSGRGKQGGK(A)   peptide count: 1
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1NP_835489(-)MSGRGKQGGK(A)   peptide count: 1
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.aXP_983390(-)MSGRGKQGGK(A)   peptide count: 1
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.aXP_983435(-)MSGRGKQGGK(A)   peptide count: 1
A482AHIST1H2AH, HIST1H2AIHistone H2A type 1-HNP_783590(-)MSGRGKQGGK(A)   peptide count: 1
A483AHIST1H2AJ, H2AFE, HIST1H2AKH2A/eNP_783592(-)MSGRGKQGGK(A)   peptide count: 1
A484AHist1h2akHistone H2A type 1-KNP_835490(-)MSGRGKQGGK(A)   peptide count: 1
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oNP_038577(-)MSGRGKQGGK(A)   peptide count: 1
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oNP_835584(-)MSGRGKQGGK(A)   peptide count: 1
A486AHIST2H2ABHistone H2A type 2-BNP_835585(-)MSGRGKQGGK(A)   peptide count: 1
A486AHIST2H2ABHistone H2A type 2-BXP_891398(-)MSGRGKQGGK(A)   peptide count: 1
A487AHIST2H2AC, H2AFQHistone H2A type 7NP_783593(-)MSGRGKQGGK(A)   peptide count: 1
A488AHIST3H2AH2A histone family, member LNP_835736(-)MSGRGKQGGK(A)   peptide count: 1
A490AH2AFJH2A histone family, member JNP_808356(-)MSGRGKQGGK(A)   peptide count: 1
A1531KRT8, CYK8Keratin, type II cytoskeletal 8NP_112447(-)MSIRVTQK(S)   peptide count: 1
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringNP_031462(-)MSNISSIVNRAR(D)   peptide count: 1
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_001034246(-)MSNNSNK(R)   peptide count: 1
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_001034247(-)MSNNSNK(R)   peptide count: 1
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_001034248(-)MSNNSNK(R)   peptide count: 1
A8090UBE2J2, NCUBE2Ubiquitin conjugating enzyme 6NP_067377(-)MSNNSNK(R)   peptide count: 1
A264BZNF638, NP220, ZFMLZinc finger protein 638NP_032743(-)MSRPR(F)   peptide count: 1
A4074CCNE2Cyclin E2NP_001032211(-)MSRRSSR(L)   peptide count: 1
A3813RPL10A, NEDD660S ribosomal protein L10aNP_035417(-)MSSKVSRDTLYEAVR(E)   peptide count: 1
A5669ACOT13, THEM2, HT012Acyl-coenzyme A thioesterase 13NP_080066(-)MSSMTQNLREVMK(V)   peptide count: 2
A6985MCM4, CDC21DNA replication licensing factor MCM4NP_032591(-)MSSPASTPSR(R)   peptide count: 1
A5767ALDH7A1, ATQ1Aldehyde dehydrogenase family 7 member A1NP_613066(-)MSTLLIHHPQYAWLQDLGLR(E)   peptide count: 1
A9710ECSIT, SITPECECSITNP_036159(-)MSWVQVNLLVRSLSR(G)   peptide count: 1
A9633RPS15A40S ribosomal protein S15aXP_920580(-)MSYYYLKR(L)   peptide count: 1
A7329PDE4B, DPDE4, PDE4B5Phosphodiesterase 4BNP_062814(-)MTAKNSPK(E)   peptide count: 1
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3NP_032169(-)MTEQMTLRGTLK(G)   peptide count: 1
A4687CNN3Calponin 3NP_082320(-)MTHFNKGPSYGLSAEVKNK(I)   peptide count: 2
A165ALTA, TNFB, TNFSF1Lymphotoxin-alpha precursorNP_034865(-)MTLLGR(L)   peptide count: 4
A3951SFXN1Sideroflexin 1NP_081600(-)MTLLGR(L)   peptide count: 4
A979ARYBP, DEDAF, YEAF1Death effector domain-associated factorNP_062717(-)MTMGDKK(S)   peptide count: 1
A1977GUCY2C, GUC2C, STARHeat-stable enterotoxin receptorNP_659504(-)MTSLLGLAVRLLLFQPALMVFWASQVRQNCR(N)   peptide count: 1
A684BTM9SF1Transmembrane 9 superfamily protein member 1 precursorNP_083056(-)MTVLGYPR(S)   peptide count: 1
A8210XYLT1, XT1, XT-IXylosyltransferase 1NP_783576(-)MVAAPCARR(L)   peptide count: 1
A5368ISCU, NIFUN, NIFUIron-sulfur cluster assembly enzyme ISCU, mitochondrialXP_989531(-)MVAATGAGRLKR(A)   peptide count: 1
A657DLEMD1LEM domain containing 1NP_001028422(-)MVDVKCLSDYELHKHLMKLGFTPGPILPSTR(K)   peptide count: 1
A597DFAM214AProtein FAM214ANP_705812(-)MVFSGNKGLRR(Q)   peptide count: 1
A0388ATP5I, ATP5KATP synthase e chain, mitochondrialNP_031533(-)MVPPVQVSPLIK(F)   peptide count: 20
A9543RPL17, RPL17P960S ribosomal protein L17XP_141707(-)MVRYSLDPENPTK(S)   peptide count: 2
A9543RPL17, RPL17P960S ribosomal protein L17NP_001002239(-)MVRYSLDPENPTK(S)   peptide count: 2
A9543RPL17, RPL17P960S ribosomal protein L17XP_899577(-)MVRYSLDPENPTK(S)   peptide count: 2
A9543RPL17, RPL17P960S ribosomal protein L17XP_993629(-)MVRYSLDPENPTK(S)   peptide count: 2
A215D Hypothetical proteinNP_848734(-)MVTAALK(R)   peptide count: 1
A193CZNF183, NDUFA1NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1NP_062316(-)MWFEILPGLAIMGVCLVIPGVSTAYIHK(F)   peptide count: 17
A984DBC003266cDNA sequence BC003266NP_084528(-)MWPVLWTVVR(T)   peptide count: 5
A6879LACTB, MRPL56, UNQ843/PRO1781Serine beta lactamase-like protein LACTB, mitochondrialNP_109642(-)MYRLLSSVTAR(A)   peptide count: 1
A9233Olfr829Olfactory receptor 829NP_667278(-)MYSIRFTMNMK(Y)   peptide count: 1
A7109NAALADL1, NAALADASEL, NAALADLN-acetylated-alpha-linked acidic dipeptidase like protein 1NP_001009546(K)AAAASLGEHILTLQK(S)   peptide count: 2
A9659MRPS728S ribosomal protein S7, mitochondrialNP_079581(K)AAAATETSSVFADPVISK(F)   peptide count: 9
A1027NCKIPSD, AF3P21, SPIN90SH3 adapter protein SPIN90NP_109654(K)AAAETVVPR(T)   peptide count: 1
A9586MRPL11, CGI-11360S ribosomal protein L11, mitochondrial precursorNP_079829(K)AAAGIEK(G)   peptide count: 1
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8NP_080979(K)AAAHHYGAQCDK(T)   peptide count: 36
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8NP_080979(K)AAAHHYGAQCDKTNK(E)   peptide count: 3
A5812AOC2Retina-specific copper amine oxidase precursorNP_849263(K)AAALAHLDR(G)   peptide count: 3
A5813AOC3, VAP1Membrane copper amine oxidaseNP_033805(K)AAALAHLDR(G)   peptide count: 3
A0492STIP1Stress-induced-phosphoprotein 1NP_058017(K)AAALEFLNR(F)   peptide count: 1
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_488540(K)AAALEMAMIK(M)   peptide count: 3
A0416TCIRG1, ATP6N1C, ATP6V0A3Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3NP_058617(K)AAALER(L)   peptide count: 2
A7339PDIA2, PDIP, ARHGDIGProtein disulfide isomerase A2 precursorXP_128552(K)AAALLAAESAVVTLAK(V)   peptide count: 1
A7450NP, PNP, PRO1837Purine nucleoside phosphorylaseXP_997970(K)AAAQKLER(F)   peptide count: 1
A7450NP, PNP, PRO1837Purine nucleoside phosphorylaseXP_998000(K)AAAQKLER(F)   peptide count: 1
A3524SEPT11, SEP11Septin-11NP_001009818(K)AAAQLLQSQAQQSGAQQTK(K)   peptide count: 1
A7450NP, PNP, PRO1837Purine nucleoside phosphorylaseNP_038660(K)AAAQTLER(F)   peptide count: 1
A0657MARCKSL1, MLP, MRPMARCKS-like 1NP_034937(K)AAATPESQEPQAK(G)   peptide count: 1
A5242VIL1, VILVillin 1NP_033535(K)AAATTVQEYLK(T)   peptide count: 5
A0098VCLVinculinNP_033528(K)AAAVGTANK(S)   peptide count: 3
A578CSV2CSynaptic vesicle protein 2CXP_996351(K)AAAVLGNLIFGSLVSITK(A)   peptide count: 3
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorNP_570954(K)AAAVPVEFK(E)   peptide count: 45
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorNP_570954(K)AAAVPVEFKEHHLSEVQNMASEEK(L)   peptide count: 5
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)AAAYDKLEK(T)   peptide count: 7
A681CHDLBP, HBP, VGLVigilinNP_598569(K)AACLESAQEPAGAWSNK(I)   peptide count: 1
A501EWDR96WD repeat-containing protein 96XP_129357(K)AACLLEMTTFLR(K)   peptide count: 1
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type CNP_062677(K)AACNLAR(L)   peptide count: 2
A3205TPM3Tropomyosin alpha 3 chainNP_071709(K)AADAEAEVASLNR(R)   peptide count: 1
A3205TPM3Tropomyosin alpha 3 chainNP_071709(K)AADESERGMKVIENRALK(D)   peptide count: 1
A6534FHFumarate hydratase, mitochondrial precursorNP_034339(K)AADEVAEGK(L)   peptide count: 55
A0685DNAJC6Putative tyrosine-protein phosphatase auxilinNP_940804(K)AADFEDLLSSQGFNAHK(D)   peptide count: 3
A3479VDAC3Voltage-dependent anion-selective channel protein 3NP_035826(K)AADFQLHTHVNDGTEFGGSIYQK(V)   peptide count: 47
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)AADIDQEVK(E)   peptide count: 4
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)AADIDQEVKER(A)   peptide count: 3
A6048CHDHCholine dehydrogenase, mitochondrial precursorNP_758468(K)AADIIK(G)   peptide count: 1
A6048CHDHCholine dehydrogenase, mitochondrial precursorNP_780552(K)AADIIK(G)   peptide count: 1
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorNP_080784(K)AADILPK(W)   peptide count: 13
A7784OXCT2, FKSG25, H-SCOT-T3-oxoacid CoA transferase 2NP_071316(K)AADISVVEVEEIVDVGTFAPEDIHVPNIYVDR(V)   peptide count: 2
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AADKDTCFSTEGPNLVTR(C)   peptide count: 22
A5920BCAT2, BCATM, BCT2Branched-chain amino acid aminotransferase, mitochondrial precursorNP_033867(K)AADLQIQMTK(E)   peptide count: 28
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorNP_780647(K)AADMLSGPR(R)   peptide count: 40
A9657MRPS528S ribosomal protein S5, mitochondrialNP_084239(K)AADRGDAFR(K)   peptide count: 5
A9657MRPS528S ribosomal protein S5, mitochondrialNP_084239(K)AADRGDAFRK(A)   peptide count: 1
A5846ATP11A, ATPIH, ATPISPotential phospholipid-transporting ATPase IHNP_056619(K)AADTIEALQK(A)   peptide count: 2
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AADTIGYPVMIR(S)   peptide count: 36
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeNP_035229(K)AADVHEVR(K)   peptide count: 7
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeNP_035229(K)AADVHEVRK(V)   peptide count: 5
A7776SARDH, DMGDHL1Sarcosine dehydrogenaseNP_619606(K)AADWLFSADVNRPPGSTVYTCMLNQR(G)   peptide count: 2
A868CMPC1, BRP44L, CGI-129Brain protein 44-like proteinNP_061289(K)AADYVR(S)   peptide count: 14
A7474ALPPL2, ALPPLAlkaline phosphatase, placental-like precursorNP_031459(K)AAEALDAAK(K)   peptide count: 1
A7475ALPIAlkaline phosphatase, intestinal precursorNP_031458(K)AAEALDAAK(K)   peptide count: 1
A7475ALPIAlkaline phosphatase, intestinal precursorXP_129951(K)AAEALDAAK(K)   peptide count: 1
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1NP_058661(K)AAEDLFVNIR(G)   peptide count: 2
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorNP_079612(K)AAEEVEAK(F)   peptide count: 14
A790BDBIAcyl-CoA-binding proteinNP_001033088(K)AAEEVKR(L)   peptide count: 10
A790BDBIAcyl-CoA-binding proteinNP_031856(K)AAEEVKR(L)   peptide count: 10
A4033DMXL2, RC3DmX-like protein 2XP_358382(K)AAEGISSDSLLSVPGQK(N)   peptide count: 3
A3793PHBProhibitinNP_032857(K)AAELIANSLATAGDGLIELR(K)   peptide count: 197
A3793PHBProhibitinNP_001028937(K)AAELIANSLATAGDGLIELR(K)   peptide count: 197
A3793PHBProhibitinNP_032857(K)AAELIANSLATAGDGLIELRK(L)   peptide count: 1
A3793PHBProhibitinNP_001028937(K)AAELIANSLATAGDGLIELRK(L)   peptide count: 1
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomeraseNP_035998(K)AAEMLLFGK(K)   peptide count: 16
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomeraseNP_081223(K)AAEMLLFGK(K)   peptide count: 16
A3962MYH14, FP17425Myosin-14NP_082297(K)AAEQAASDLR(T)   peptide count: 2
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_666301(K)AAEQAVFK(C)   peptide count: 1
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_835168(K)AAEQAVFK(C)   peptide count: 1
A5700ACSS3Acyl-CoA synthetase short-chain family member 3 mitochondrialNP_941038(K)AAEQISWYKPWTK(T)   peptide count: 2
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7NP_075691(K)AAESSAMAATEK(K)   peptide count: 89
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7NP_075691(K)AAESSAMAATEKK(A)   peptide count: 21
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)AAEVLISQLDR(E)   peptide count: 2
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_620758(K)AAEVPNEELVSLLLK(F)   peptide count: 1
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_904942(K)AAEVPNEELVSLLLK(F)   peptide count: 1
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_904953(K)AAEVPNEELVSLLLK(F)   peptide count: 1
A372ETAGLN3, NP25Transgelin-3NP_062728(K)AAEVYGVR(T)   peptide count: 9
A0280YWHAE14-3-3 protein epsilonNP_033562(K)AAFDDAIAELDTLSEESYK(D)   peptide count: 9
A0280YWHAE14-3-3 protein epsilonNP_033562(K)AAFDDAIAELDTLSEESYKDSTLIMQLLR(D)   peptide count: 29
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)AAFECMYTLLDSCLDR(L)   peptide count: 1
A6203CPT1A, CPT1Carnitine O-palmitoyltransferase I, mitochondrial liver isoformNP_038523(K)AAFFVTLDESEQGYREEDPEASIDSYAK(S)   peptide count: 10
A6829CCBL2, KAT3, RBMXL1Kynurenine--oxoglutarate transaminase 3NP_776124(K)AAFIDNMNQYTR(G)   peptide count: 4
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseNP_034053(K)AAGAEEYAQQEVVKR(S)   peptide count: 3
A8170UK114, HRSP12, PSPRibonuclease UK114NP_032313(K)AAGCDFNNVVK(T)   peptide count: 15
A3599ALDH1B1, ALDH5, ALDHXAldehyde dehydrogenase X, mitochondrialNP_082546(K)AAGESNLK(R)   peptide count: 9
A3599ALDH1B1, ALDH5, ALDHXAldehyde dehydrogenase X, mitochondrialNP_082546(K)AAGESNLKR(V)   peptide count: 26
A127DTTC40TPR repeat-containing protein C10ORF93XP_978184(K)AAGHLRR(L)   peptide count: 4
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aNP_038749(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_620604(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_193790(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_903693(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_484358(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_484651(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_486245(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_619886(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_893722(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_892272(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_911331(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_990387(K)AAGKGDVPTK(R)   peptide count: 1
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_001003284(K)AAGKGDVPTK(R)   peptide count: 1
A0778MAP4Microtubule-associated protein 4NP_032659(K)AAGSIASAQKPPAGK(V)   peptide count: 3
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorNP_077150(K)AAGTTVVEVEEIVDIGSFAPEDIHIPK(I)   peptide count: 93
A9579RPLP1, RRP160S acidic ribosomal protein P1NP_061341(K)AAGVSVEPFWPGLFAK(A)   peptide count: 20
A9579RPLP1, RRP160S acidic ribosomal protein P1XP_891300(K)AAGVSVEPFWPGLFAK(A)   peptide count: 20
A9579RPLP1, RRP160S acidic ribosomal protein P1XP_981036(K)AAGVSVEPFWPGLFAK(A)   peptide count: 20
A7391PCBD2, DCOH2, DCOHMPterin-4-alpha-carbinolamine dehydratase 2NP_082557(K)AAGWSELSER(D)   peptide count: 17
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorNP_031408(K)AAHKQEPGLGFSFELTEQQKEFQATAR(K)   peptide count: 1
A5659ACAD10Acyl-CoA dehydrohenase family member 10NP_082313(K)AAHLMDVAGNK(A)   peptide count: 18
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_488540(K)AAHLMDVAGNK(A)   peptide count: 18
A5660ACAD11Acyl-CoA dehydrogenase family member 11NP_780533(K)AAHSIDTLGSASAR(K)   peptide count: 7
A3814RPL14, RPL14L60S ribosomal protein L14NP_080250(K)AAIAAAAAAAAAK(A)   peptide count: 9
A4768DNAH6, DNAHC6, DNHL1Dynein heavy chain 6, axonemalXP_918509(K)AAIADYQGKPR(T)   peptide count: 1
A5752AKR1B15PREDICTED: Similar to Aldo-keto reductase family 1 member B10NP_032038(K)AAIDAGYR(H)   peptide count: 7
A5772Akr1b7Aldose reductase-related protein 1NP_033861(K)AAIDAGYR(H)   peptide count: 7
A384ETDRKH, TDRD2Tudor and KH domain-containing proteinNP_082583(K)AAIHQILTENTPVFEQLSVPQR(S)   peptide count: 5
A3793PHBProhibitinNP_032857(K)AAIISAEGDSK(A)   peptide count: 44
A5242VIL1, VILVillin 1NP_033535(K)AAISDSVVEPAAK(A)   peptide count: 3
A7469ACP6, ACPL1, LPAPLysophosphatidic acid phosphatase type 6NP_062774(K)AAISQPGISEDLEK(V)   peptide count: 4
A1842Hbb-bh1Hemoglobin subunit beta-H1NP_032245(K)AAITSIWDKVDLEK(V)   peptide count: 2
A7766SLC27A1, ACSVL5, FATP1Long-chain fatty acid transport protein 1NP_036107(K)AAIVVHSR(Y)   peptide count: 11
A7769SLC27A4, ACSVL4, FATP4Long-chain fatty acid transport protein 4NP_036119(K)AAIVVHSR(Y)   peptide count: 11
A5005NEBNebulinXP_130232(K)AAKDAYK(V)   peptide count: 5
A5368ISCU, NIFUN, NIFUIron-sulfur cluster assembly enzyme ISCU, mitochondrialNP_079802(K)AALADYK(L)   peptide count: 19
A5368ISCU, NIFUN, NIFUIron-sulfur cluster assembly enzyme ISCU, mitochondrialXP_989531(K)AALADYK(L)   peptide count: 19
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2NP_034085(K)AALAGGTTMIIDHVVPEPGTSLLAAFDQWR(E)   peptide count: 1
A7911CARS2Probable Cysteinyl-tRNA synthetase, mitochondrialXP_981397(K)AALANDFDTPR(A)   peptide count: 3
A0596NAPA, SNAPAAlpha-soluble NSF attachment proteinNP_080174(K)AALCHFCIDMLNAK(L)   peptide count: 1
A3910NAPB, SNAPBBeta-soluble NSF attachment proteinNP_062606(K)AALCHFIVDELNAK(L)   peptide count: 4
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseNP_077198(K)AALDGTPGMIGYGMAK(G)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AALDLK(D)   peptide count: 3
A9024RILPL1, RLP1RILP-like protein 1NP_067405(K)AALDLK(D)   peptide count: 3
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorNP_081480(K)AALEAVGGTVVLE(-)   peptide count: 3
A4284CLGNCalmegin precursorNP_034034(K)AALEQEAEEEKAPEKPEDVQEEK(K)   peptide count: 1
A0591CPLX2Complexin 2NP_034076(K)AALEQPCEGSLTRPK(K)   peptide count: 10
A121DFAM213A, PAMM, PRO2290SFLQ611NP_081740(K)AALEYLEDIDLK(T)   peptide count: 8
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1NP_766307(K)AALLETLSLLLGK(V)   peptide count: 2
A9763VMA21, MEAX, XMEAVacuolar ATPase assembly integral membrane protein VMA21XP_903924(K)AALNALQPPEFR(N)   peptide count: 1
A0121AMPH, AMPH1Amphiphysin INP_778172(K)AALPAGEGGSPEGAK(I)   peptide count: 9
A5127SHROOM4, SHAPProtein SHROOM4NP_001035549(K)AALSQK(M)   peptide count: 1
A3718HSD17B2, EDH17B2Estradiol 17 beta-dehydrogenase 2NP_032316(K)AALTMFSTIIR(Q)   peptide count: 2
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetaseNP_062672(K)AALWALQGGTSVVIANGTHPK(V)   peptide count: 19
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetaseNP_705782(K)AALWALQGGTSVVIANGTHPK(V)   peptide count: 19
A004CGLTPGlycolipid transfer proteinNP_062795(K)AALYAAPYK(S)   peptide count: 1
A0324JUP, CTNNG, DP3Junction plakoglobinNP_034723(K)AAMIVNQLSKKEASR(R)   peptide count: 1
A0324JUP, CTNNG, DP3Junction plakoglobinNP_034723(K)AAMIVNQLSKKEASR(R)   peptide count: 6
A1928DNM3Dynamin 3NP_001033708(K)AAMLAER(K)   peptide count: 1
A3584FASN, FASFatty acid synthaseNP_032014(K)AAMLGQEDPPQHGLPR(L)   peptide count: 4
A6534FHFumarate hydratase, mitochondrial precursorNP_034339(K)AAMPRIYELAAGGTAVGTGLNTRIGFAEK(V)   peptide count: 1
A1984GABRB2Gamma-aminobutyric-acid receptor beta-2 subunit precursorNP_032096(K)AANANNEKMRLDVNK(M)   peptide count: 1
A7979ACAA2Acetyl-CoA acyltransferase 2NP_803421(K)AANEAGYFNEEMAPIEVK(T)   peptide count: 32
A3572LSAMP, IGLON3, LAMPLimbic system-associated membrane protein precursorNP_780757(K)AANEVSSADVK(Q)   peptide count: 3
A7519PSMA2, HC3, PSC3Proteasome subunit alpha type 2NP_032970(K)AANGVVLATEK(K)   peptide count: 2
A5602TMC1Transmembrane channel-like 1NP_083229(K)AANLDLKK(K)   peptide count: 1
A6740ADHFE1, HMFT2263Hydroxyacid-oxoacid transdehydrogenase, mitochondrial precursorNP_780445(K)AANLYASSPHSEFLDYVNAPIGK(G)   peptide count: 4
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorNP_067370(K)AANSLKAFIFETQDK(L)   peptide count: 6
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialNP_663589(K)AAPAAAAAMAPPGPR(V)   peptide count: 92
A3607NPTN, SDFR1, SDR1Neuroplastin precursorNP_033171(K)AAPDITGHK(R)   peptide count: 1
A474DFUNDC1FUN14 domain-containing protein 1NP_082334(K)AAPEINNIIEEATDFIK(Q)   peptide count: 51
A474DFUNDC1FUN14 domain-containing protein 1NP_082334(K)AAPEINNIIEEATDFIK(Q)   peptide count: 2
A6210CRLS1, CLS1Cardiolipin synthaseNP_001019556(K)AAPEPAAGGGGAAAQAPSAR(W)   peptide count: 2
A6727HINT2HIT-17kDaNP_081147(K)AAPGGASPTIFSR(I)   peptide count: 34
A3902SV2ASynaptic vesicle glycoprotein 2NP_071313(K)AAPILFASAALALGSSLALK(L)   peptide count: 11
A3902SV2ASynaptic vesicle glycoprotein 2NP_071313(K)AAPILFASAALALGSSLALKLPETR(G)   peptide count: 11
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorNP_031402(K)AAPLSLCALTAVDQSVLLLKPEAK(L)   peptide count: 12
A7646CRYZCrystallin zetaNP_034098(K)AAQAHEDIIHGSGK(T)   peptide count: 11
A1923ALDOA, ALDAFructose-bisphosphate aldolase ANP_031464(K)AAQEEYIK(R)   peptide count: 8
A1923ALDOA, ALDAFructose-bisphosphate aldolase ANP_031464(K)AAQEEYIKR(A)   peptide count: 17
A3899LIN7B, MALS2, VELI2Protein LIN-7 homolog BNP_035828(K)AAQGSVKLVVRYTPR(V)   peptide count: 1
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialNP_080070(K)AAQIGAHTLSGACLDPAAFK(E)   peptide count: 20
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialNP_080070(K)AAQIGAHTLSGACLDPAAFKELFPDWK(E)   peptide count: 2
A3666DHTKD1Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial precursorXP_140800(K)AAQINPLFPGQALLDTVPEIQALVR(T)   peptide count: 16
A7902SISucrase-isomaltase, intestinalXP_143332(K)AAQIPYDVQYTDINYMER(Q)   peptide count: 1
A1517LAMB2, LAMSLaminin beta-2 chain precursorNP_032509(K)AAQLDGLEAR(M)   peptide count: 1
A5652ACAD8, ARC42, IBDAcyl-CoA dehydrogenase family member 8, mitochondrial precursorNP_080138(K)AAQLGFGGVYVR(T)   peptide count: 6
A535CSlco1b2Solute carrier organic anion transporter family member 1B2NP_065241(K)AAQPLRSEK(T)   peptide count: 1
A535CSlco1b2Solute carrier organic anion transporter family member 1B2NP_839953(K)AAQPLRSEK(T)   peptide count: 1
A6366DPP3Dipeptidyl peptidase 3NP_598564(K)AAQQRPEEVR(D)   peptide count: 1
A703CVPS53, HCCS1, PP13624Vacuolar protein sorting protein 53NP_080940(K)AAQTELGQQILADFEEAFPSQGTK(R)   peptide count: 1
A0098VCLVinculinNP_033528(K)AASDELSK(T)   peptide count: 1
A0280YWHAE14-3-3 protein epsilonNP_033562(K)AASDIAMTELPPTHPIR(L)   peptide count: 1
A9049SH2D4A, SH2A, PPP1R38SH2 domain-containing protein 4AXP_134197(K)AASEEASGQGPRAIPTRK(D)   peptide count: 3
A9049SH2D4A, SH2A, PPP1R38SH2 domain-containing protein 4AXP_900759(K)AASEEASGQGPRAIPTRK(D)   peptide count: 3
A0216SLMAP, SLAP, UNQ1847/PRO3577Sarcolemmal associated protein 1NP_114397(K)AASEYENEIR(S)   peptide count: 6
A4575ANXA4, PIG28, ANX4Annexin A4NP_038499(K)AASGFNATEDAQTLR(K)   peptide count: 3
A5690ACSF2, UNQ493/PRO1009, UNQ493Acyl-CoA synthetase family member 2, mitochondrial precursorNP_722502(K)AASGLLSIGLR(K)   peptide count: 13
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorNP_034072(K)AASGTKEDPNLVPSISNK(R)   peptide count: 18
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorNP_034072(K)AASGTKEDPNLVPSISNKR(I)   peptide count: 85
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AASKDKEGVNFNEIASNLISDIR(R)   peptide count: 2
A5964CA2Carbonic anhydrase 2NP_033931(K)AASKSIVNNGHSFNVEFDDSQDNAVLK(G)   peptide count: 1
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2NP_034152(K)AASLGLLQFPILNASVDENCQNITYK(A)   peptide count: 1
A4019SDHD, SDH4Succinate dehydrogenase[ubiquinone] cytochrome B small subunit, mitochondrial precursorNP_080124(K)AASLHWTSER(V)   peptide count: 45
A473DFSIP2Fibrous sheath-interacting protein 2XP_485018(K)AASSTVAEDSQQCVDGR(H)   peptide count: 2
A214ER3HDM1, R3HDMR3H domain (binds single-stranded nucleic acids) containing protein 1NP_861415(K)AASTDLGAGEAVVGK(V)   peptide count: 1
A0568PCLO, ACZProtein piccoloNP_036125(K)AASVQPATASK(S)   peptide count: 1
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorNP_082235(K)AATALKDVVK(V)   peptide count: 1
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AATEALQDFQK(Y)   peptide count: 2
A6635GPAM, GPAT1Glycerol-3-phosphate acyltransferase 1, mitochondrial precursorNP_032175(K)AATETNLPLLFLPVHR(S)   peptide count: 1
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorNP_084302(K)AATGEEVSAEDLGGADLHCR(K)   peptide count: 15
A7767SLC27A2, ACSVL1, FACVL1Very long-chain acyl-CoA synthetaseNP_036108(K)AATINHHR(L)   peptide count: 5
A3962MYH14, FP17425Myosin-14NP_082297(K)AATLEEKR(Q)   peptide count: 1
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3NP_034386(K)AAVAGLDR(A)   peptide count: 1
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIANP_035716(K)AAVAQASR(D)   peptide count: 1
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)AAVAVPNRPPDAVLR(D)   peptide count: 9
A3701DECR2, PDCRPeroxisomal 2,4-dienoyl-CoA reductaseNP_036063(K)AAVDAMTR(H)   peptide count: 8
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorNP_084501(K)AAVEDPR(V)   peptide count: 101
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-likeNP_758512(K)AAVELVEK(S)   peptide count: 9
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)AAVFNHFISDGVK(K)   peptide count: 8
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)AAVFNHFISDGVKK(T)   peptide count: 6
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)AAVGKEEIQER(L)   peptide count: 1
A0098VCLVinculinNP_033528(K)AAVHLEGK(I)   peptide count: 8
A3709BDH2, DHRS6, UNQ6308/PRO209333-hydroxybutyrate dehydrogenase type 2NP_081484(K)AAVIGLTK(S)   peptide count: 1
A1298PGLS6-phosphogluconolactonaseNP_079672(K)AAVLKR(I)   peptide count: 1
A5725Adh1Alcohol dehydrogenase 1NP_031435(K)AAVLWELHKPFTIEDIEVAPPK(A)   peptide count: 1
A0112CTNNB1, CTNNB, PRO2286Beta-cateninNP_031640(K)AAVMVHQLSK(K)   peptide count: 3
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1NP_032854(K)AAVPSIK(F)   peptide count: 1
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1XP_001001423(K)AAVPSIK(F)   peptide count: 1
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseNP_038820(K)AAVSEAEAQFYEQNSR(Y)   peptide count: 1
A016CHbb-b1, Hbbt1Hemoglobin subunit beta-1NP_032246(K)AAVSGLWGK(V)   peptide count: 29
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)AAVSQYEK(I)   peptide count: 1
A487EWDR47WD repeat-containing protein 47NP_852065(K)AAYADLLTPLISK(L)   peptide count: 1
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1NP_032538(K)AAYCACR(S)   peptide count: 1
A3662PCPyruvate carboxylase, mitochondrial precursorNP_032823(K)AAYGGGGR(G)   peptide count: 9
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIANP_035716(K)AAYLLGCSLEELSSAIFK(H)   peptide count: 3
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)AAYLQGLNSADLLK(A)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)AAYLQNLNSADLLK(A)   peptide count: 2
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AAYLTSLNSADLLK(A)   peptide count: 5
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1NP_032168(K)ACADATLSQITNNIDPVGR(I)   peptide count: 3
A6813IVDIsovaleryl-CoA dehydrogenase, mitochondrial precursorNP_062800(K)ACDEGHIIPK(D)   peptide count: 35
A063D Uncharacterized protein C7ORF31NP_081840(K)ACDTTILK(T)   peptide count: 1
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)ACEPGVDYVYK(T)   peptide count: 4
A0049GNALGuanine nucleotide-binding protein G(olf), alpha subunitNP_034437(K)ACFER(S)   peptide count: 1
A0049GNALGuanine nucleotide-binding protein G(olf), alpha subunitNP_796111(K)ACFER(S)   peptide count: 1
A6877L2HGDHL-2-hydroxyglutarate dehydrogenase, mitochondrial precursorNP_663418(K)ACFLSETVK(H)   peptide count: 1
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicNP_031966(K)ACGANLPENFSISQIFSQAMAAR(S)   peptide count: 4
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2NP_034442(K)ACGDSTLTQITAGLDPVGR(I)   peptide count: 1
A002AMYOF, FER1L3MyoferlinXP_283556(K)ACGDVLVTAELILR(N)   peptide count: 1
A7785SCCPDH, CGI-49Saccharopine dehydrogenaseNP_848768(K)ACIENGTSCIDICGEPQFLELMHAK(Y)   peptide count: 3
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)ACIESR(V)   peptide count: 2
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2NP_077217(K)ACIPFLK(K)   peptide count: 1
A152DTEX26Chromosome 13 open reading frame 26XP_132524(K)ACLDFLTILDSFTPSQVHDYLQSVSYK(D)   peptide count: 1
A152DTEX26Chromosome 13 open reading frame 26XP_999113(K)ACLDFLTILDSFTPSQVHDYLQSVSYK(D)   peptide count: 1
A5985CTSFCathepsin F precursorNP_063914(K)ACLGGLPSNAYAAIK(N)   peptide count: 7
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)ACLSR(F)   peptide count: 1
A581DVWA8Uncharacterized protein KIAA0564XP_001002205(K)ACLSR(F)   peptide count: 1
A296CPTTG1IPPituitary tumor-transforming gene 1 protein-interacting proteinNP_666037(K)ACMDYPVR(K)   peptide count: 7
A296CPTTG1IPPituitary tumor-transforming gene 1 protein-interacting proteinNP_666037(K)ACMDYPVRK(I)   peptide count: 1
A3616ENO2Gamma enolaseNP_038537(K)ACNCLLLK(V)   peptide count: 1
A3617ENO3Beta enolaseNP_031959(K)ACNCLLLK(V)   peptide count: 1
A3617ENO3Beta enolaseNP_031959(K)ACNCLLLKVNQIGSVTESIQACK(L)   peptide count: 3
A0072GNB4Guanine nucleotide-binding protein beta subunit 4NP_038559(K)ACNDATLVQITSNMDSVGRIQMR(T)   peptide count: 2
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)ACPPKPFR(W)   peptide count: 1
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ANP_058655(K)ACQSIYPLHDVFVR(K)   peptide count: 3
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3AXP_999639(K)ACQSIYPLHDVFVR(K)   peptide count: 3
A0361YWHAZ14-3-3 protein zeta/deltaNP_035870(K)ACSLAK(T)   peptide count: 1
A0467YWHAB14-3-3 protein beta/alphaNP_061223(K)ACSLAK(T)   peptide count: 1
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalNP_056544(K)ACTIAIR(Y)   peptide count: 3
A5680ACOX2, BRCOXAcyl-coenzyme A oxidase 2, peroxisomalNP_444345(K)ACTIAVR(Y)   peptide count: 1
A3584FASN, FASFatty acid synthaseNP_032014(K)ACVDTALENLSTLK(M)   peptide count: 2
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)ACVIHGTDLK(D)   peptide count: 10
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)ACVIHGTDLKDFTSEQIDEILQNHTEIVFAR(T)   peptide count: 9
A7370FAM213BUncharacterized protein C1ORF93NP_079858(K)ACVVAGLR(R)   peptide count: 6
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorNP_659149(K)ACVVHGSDLK(D)   peptide count: 10
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorNP_848492(K)ACVVHGSDLK(D)   peptide count: 10
A489BJPH1, JP1Junctophilin 1NP_065629(K)ADAADQAALAAR(Q)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)ADAEGESDLENSR(K)   peptide count: 5
A0097TLN1, TLNTalin 1NP_035732(K)ADAEGESDLENSRK(L)   peptide count: 8
A370ATUFMElongation factor Tu, mitochondrial precursorNP_766333(K)ADAVQDSEMVELVELEIR(E)   peptide count: 5
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorNP_666253(K)ADCKEEHDIPR(K)   peptide count: 17
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNP_035457(K)ADCTITMADSDLLALMTGK(M)   peptide count: 21
A1923ALDOA, ALDAFructose-bisphosphate aldolase ANP_031464(K)ADDGRPFPQVIK(S)   peptide count: 12
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialNP_062668(K)ADDKLISEEGVDSLTVK(E)   peptide count: 41
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)ADDPSSYMEVVQAANASGNWEELVK(Y)   peptide count: 5
A0238STXBP1, UNC18A, stxbp1Syntaxin binding protein 1NP_033321(K)ADDPTMGEGPDK(A)   peptide count: 9
A3662PCPyruvate carboxylase, mitochondrial precursorNP_032823(K)ADEAYLIGR(G)   peptide count: 50
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1NP_035164(K)ADEGISFR(G)   peptide count: 15
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1XP_001003382(K)ADEGISFR(G)   peptide count: 15
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1XP_001003388(K)ADEGISFR(G)   peptide count: 15
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)ADEMYDK(C)   peptide count: 2
A0121AMPH, AMPH1Amphiphysin INP_778172(K)ADETKDEQFEEYVQNFK(R)   peptide count: 1
A0121AMPH, AMPH1Amphiphysin INP_778172(K)ADETKDEQFEEYVQNFKR(Q)   peptide count: 2
A4769DNAH7Dynein heavy chain 7, axonemalXP_910605(K)ADETVANDQAMAAK(A)   peptide count: 1
A4769DNAH7Dynein heavy chain 7, axonemalXP_897673(K)ADETVANDQAMAAK(A)   peptide count: 1
A328ACUX2, CUTL2Homeobox protein Cut-like 2NP_031830(K)ADEVGLIMTNLEKANQRAEAAQREVESLR(E)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ADEWLMK(N)   peptide count: 1
A3961MYH10, SmembMyosin-10NP_780469(K)ADEWLMK(N)   peptide count: 1
A6108CYP11A1, CYP11ACytochrome P450 11A1, mitochondrial precursorNP_062753(K)ADEYTQNFYWDLR(Q)   peptide count: 2
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ADFCIIHYAGK(V)   peptide count: 2
A3961MYH10, SmembMyosin-10NP_780469(K)ADFCIIHYAGK(V)   peptide count: 2
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorNP_032904(K)ADFHGGK(T)   peptide count: 1
A6239DAD1Defender against cell death 1NP_034145(K)ADFQGISPER(A)   peptide count: 4
A5681ACOX3, BRCOX, PRCOXAcyl-coenzyme A oxidase 3, peroxisomalNP_109646(K)ADGELYK(N)   peptide count: 3
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorNP_033213(K)ADGFHLK(R)   peptide count: 3
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorNP_033213(K)ADGFHLKR(G)   peptide count: 10
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorNP_033213(K)ADGFHLKRGLPDQMLYR(T)   peptide count: 1
A9639RPS2140S ribosomal protein S21NP_079863(K)ADGIVSK(N)   peptide count: 1
A9639RPS2140S ribosomal protein S21NP_079863(K)ADGIVSK(N)   peptide count: 1
A9639RPS2140S ribosomal protein S21XP_001002128(K)ADGIVSK(N)   peptide count: 1
A5959CA1Carbonic anhydrase 1NP_033929(K)ADGLAILGVLMK(V)   peptide count: 8
A670DLRRC23, B7, LRPB7Leucine-rich repeat-containing protein 23NP_038616(K)ADGNQLR(S)   peptide count: 1
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1NP_032538(K)ADGSGSVVLR(N)   peptide count: 1
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)ADGSTQVIDTK(N)   peptide count: 146
A6451Gm4738Liver carboxylesterase 31-likeNP_653094(K)ADHSSENAFVFGGPFLTDESSLLAFPEATEEEK(Q)   peptide count: 1
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3XP_356125(K)ADHSSENAFVFGGPFLTDESSLLAFPEATEEEK(Q)   peptide count: 1
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3XP_907087(K)ADHSSENAFVFGGPFLTDESSLLAFPEATEEEK(Q)   peptide count: 1
A0297GRIA2, GLUR2Glutamate receptor 2 precursorNP_001034284(K)ADIAIAPLTITLVR(E)   peptide count: 2
A0297GRIA2, GLUR2Glutamate receptor 2 precursorNP_038568(K)ADIAIAPLTITLVR(E)   peptide count: 2
A3376MAP6Microtubule-associated protein 6NP_001041632(K)ADIAVPLVFTK(Y)   peptide count: 2
A3376MAP6Microtubule-associated protein 6NP_034967(K)ADIAVPLVFTK(Y)   peptide count: 2
A478BGLG1, CFR1, ESL1Golgi apparatus protein 1 precursorNP_033175(K)ADIFVDPVLHTACALDIK(H)   peptide count: 1
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)ADIGCTPGSGK(N)   peptide count: 4
A3469ATP4APotassium-transporting ATPase alpha chain 1NP_061201(K)ADIGVAMGIAGSDAAK(N)   peptide count: 3
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)ADIGVAMGIAGSDVSK(Q)   peptide count: 13
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorNP_659149(K)ADIGVAMGIVGSDVSK(Q)   peptide count: 5
A5643ABHD10Abhydrolase domain-containing protein 10, mitochondrial precursorNP_766099(K)ADIHLLICTIDDLIDK(L)   peptide count: 13
A5643ABHD10Abhydrolase domain-containing protein 10, mitochondrial precursorNP_766099(K)ADIHLLICTIDDLIDKLSTVVP(-)   peptide count: 6
A481EWDR16, WDRPUHWD repeat-containing protein 16NP_082239(K)ADIILWDFK(K)   peptide count: 1
A6940DMGDHDimethylglycine dehydrogenase, mitochondrialNP_083048(K)ADIINVVNGPITYSPDILPMVGPHQGVR(N)   peptide count: 1
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorNP_065640(K)ADIKAPEDK(K)   peptide count: 75
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorNP_065640(K)ADIKAPEDKK(K)   peptide count: 17
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorNP_065640(K)ADIKAPEDKKK(H)   peptide count: 11
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialNP_077136(K)ADIQDIFYQEDQIR(A)   peptide count: 14
A4768DNAH6, DNAHC6, DNHL1Dynein heavy chain 6, axonemalXP_918509(K)ADISEIR(V)   peptide count: 1
A3502AAK1AP2 associated kinase 1NP_001035195(K)ADIWALGCLLYK(L)   peptide count: 1
A3502AAK1AP2 associated kinase 1NP_808430(K)ADIWALGCLLYK(L)   peptide count: 1
A5934BMP2K, BIKEBMP-2 inducible protein kinaseNP_542439(K)ADIWALGCLLYK(L)   peptide count: 1
A7603UGT2B10UDP-glucuronosyltransferase 2B10 precursor, microsomalNP_705826(K)ADIWLIR(T)   peptide count: 3
A4357NPM1, NPMNucleophosminNP_032748(K)ADKDYHFK(V)   peptide count: 12
A4357NPM1, NPMNucleophosminXP_486188(K)ADKDYHFK(V)   peptide count: 12
A579BPEX11A, PEX11Peroxisomal membrane protein 11ANP_035198(K)ADKEAVVLK(L)   peptide count: 4
A131CIGF2R, MPRI, igf2RCation-independent mannose-6-phosphate receptor precursorNP_034645(K)ADKEVPCYAFDDKLQK(H)   peptide count: 1
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorNP_058054(K)ADKLAEEHGS(-)   peptide count: 198
A731CSLC30A9, HUELZinc transporter 9NP_848766(K)ADKVPSLTQTVENIGAELK(A)   peptide count: 1
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ADLAAVEAK(V)   peptide count: 2
A0359RAB5A, RAB5, HCC-10Ras-related protein Rab-5ANP_080163(K)ADLANKR(M)   peptide count: 3
A329CRAB5BRas-related protein Rab-5BNP_035359(K)ADLANKR(M)   peptide count: 3
A329CRAB5BRas-related protein Rab-5BNP_803130(K)ADLANKR(M)   peptide count: 3
A329CRAB5BRas-related protein Rab-5BXP_485050(K)ADLANKR(M)   peptide count: 3
A9832CER1, DAND4Cerberus precursorNP_034017(K)ADLCVDGCQSQGSLSFPLLERGRR(D)   peptide count: 1
A166ATOLLIPToll-interacting proteinNP_076253(K)ADLEAQR(D)   peptide count: 1
A310CRAB14Ras-related protein Rab-14NP_080973(K)ADLEAQR(D)   peptide count: 14
A310CRAB14Ras-related protein Rab-14NP_080973(K)ADLEAQR(D)   peptide count: 1
A4177OXR1Oxidation resistance protein 1NP_570955(K)ADLEPESFRPNLSDPSELLLPDQIEK(L)   peptide count: 2
A5005NEBNebulinXP_130232(K)ADLEWLR(G)   peptide count: 4
A9482SORT1Sortilin 1NP_064356(K)ADLGALELWR(T)   peptide count: 2
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaNP_034610(K)ADLINNLGTIAK(S)   peptide count: 16
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1NP_032328(K)ADLINNLGTIAK(S)   peptide count: 16
A223ERAB27BRas-related protein Rab-27BNP_085031(K)ADLPDQR(E)   peptide count: 1
A7031RHOT2, ARHT2, MIRO-2Mitochondrial Rho GTPase 2NP_666111(K)ADLPEGVAPPGLSPAEFCR(R)   peptide count: 1
A8420SERPINB1, ELANH2, MNEILeukocyte elastase inhibitorNP_079705(K)ADLSGMSGSR(D)   peptide count: 1
A8421Serpinb1bLeukocyte elastase inhibitor BNP_766640(K)ADLSGMSGSR(D)   peptide count: 1
A8422Serpinb1cLeukocyte elastase inhibitor CNP_766639(K)ADLSGMSGSR(D)   peptide count: 1
A7935TARSThreonyl-tRNA synthetase, cytoplasmicNP_149065(K)ADMETLQR(I)   peptide count: 1
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorNP_067482(K)ADMMPFLYWNMMLR(G)   peptide count: 4
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorNP_067482(K)ADMMPFLYWNMMLR(G)   peptide count: 2
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ADMVIEAVFEDLGVK(H)   peptide count: 243
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ADMVIEAVFEDLGVKHK(V)   peptide count: 1
A0166STK39, SPAKSTE20/SPS1-related proline-alanine rich protein kinaseNP_058562(K)ADMWSFGITAIELATGAAPYHK(Y)   peptide count: 1
A5800CD13, ANPEP, APNAminopeptidase NNP_032512(K)ADNSATGFGTGTR(A)   peptide count: 5
A3595ALDH1L2Aldehyde dehydrogenase 1 family, member L2NP_705771(K)ADPLALAAEK(D)   peptide count: 2
A5476SPEF2, KPL2Sperm flagellar protein 2XP_484441(K)ADPSASNAEATELPSLAVK(G)   peptide count: 1
A8897NCS1, FLUP, FREQNeuronal calcium sensor 1NP_062655(K)ADPSIVQALSLYDGLV(-)   peptide count: 2
A580AMTIF2Mitochondrial translational initiation factor 2 precursorNP_598528(K)ADPTGPVEGTVIESFTDK(G)   peptide count: 2
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)ADPVLLNNHSNLKPAPTVPAAPSSPDATSEPK(G)   peptide count: 13
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)ADPVLLNNHSNLKPAPTVPAAPSSPDATSEPK(G)   peptide count: 175
A8126USP47, My002Ubiquitin carboxyl-terminal hydrolase 47NP_598519(K)ADPYTADEGSGEGHK(W)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)ADQDSEAMK(R)   peptide count: 1
A1319EHD1, PAST, PAST1EH-domain containing protein 1NP_034249(K)ADQIETQQLMR(V)   peptide count: 1
A1331EHD3, EHD2, PAST3EH-domain containing protein 3NP_065603(K)ADQIETQQLMR(V)   peptide count: 1
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorNP_032836(K)ADQLYK(Q)   peptide count: 35
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorNP_032836(K)ADQLYK(Q)   peptide count: 1
A3686PDHA2, PDHALPyruvate dehydrogenase E1 component alpha subunit, testis-specific form, mitochondrial precursorNP_032837(K)ADQLYK(Q)   peptide count: 1
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14NP_065625(K)ADRDESSPYAAMLAAQDVAQR(C)   peptide count: 2
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)ADRDQYELLCLDNTR(K)   peptide count: 5
A5866ATAD3AATPase family, AAA domain containing, protein 3ANP_849534(K)ADRENADIIR(E)   peptide count: 16
A2468ENPP3, PDNP3Ectonucleotide pyrophosphatase/phosphodiesterase 3NP_598766(K)ADRPSFYTIYVEEPDSAGHSSGPVSAGVIK(A)   peptide count: 1
A2352FYB, SLAP130FYN-binding proteinNP_035945(K)ADSANSATK(S)   peptide count: 1
A6048CHDHCholine dehydrogenase, mitochondrial precursorNP_758468(K)ADSAYHPSCTCK(M)   peptide count: 10
A6048CHDHCholine dehydrogenase, mitochondrial precursorNP_780552(K)ADSAYHPSCTCK(M)   peptide count: 10
A9624MRPL5439S ribosomal protein L54, mitochondrial precursorNP_079593(K)ADSEYPTWLFQVNLGPPK(K)   peptide count: 14
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorXP_485821(K)ADSHFR(H)   peptide count: 1
A734AMug1Murinoglobulin-1NP_032671(K)ADSHFR(H)   peptide count: 1
A734AMug1Murinoglobulin-1XP_992804(K)ADSHFR(H)   peptide count: 1
A8441Mug2Murinoglobulin-2NP_032672(K)ADSHFR(H)   peptide count: 1
A4338HSCB, RP3-366L4.2, DNAJC20Iron-sulfur cluster co-chaperone protein HSCB, mitochondrial precursorNP_705799(K)ADSQFLVEIMEINER(L)   peptide count: 1
A0742TTNTitinNP_035782(K)ADTLLKPDQR(I)   peptide count: 2
A0742TTNTitinNP_082280(K)ADTLLKPDQR(I)   peptide count: 2
A0742TTNTitinNP_035782(K)ADTLLKPDQRITIENVPK(K)   peptide count: 1
A0742TTNTitinNP_082280(K)ADTLLKPDQRITIENVPK(K)   peptide count: 1
A3502AAK1AP2 associated kinase 1NP_001035195(K)ADVAVESLIPGLEPPVAQR(L)   peptide count: 1
A3502AAK1AP2 associated kinase 1NP_808430(K)ADVAVESLIPGLEPPVAQR(L)   peptide count: 1
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)ADVFHAYLSLLK(Q)   peptide count: 2
A0114ATP2B4, MXRA1Plasma membrane calcium-transporting ATPase 4NP_998781(K)ADVGFAMGIAGTDVAK(E)   peptide count: 7
A0508ATP2B2, PMCA2, PMCA2IPlasma membrane calcium-transporting ATPase 2NP_001031761(K)ADVGFAMGIAGTDVAK(E)   peptide count: 7
A0508ATP2B2, PMCA2, PMCA2IPlasma membrane calcium-transporting ATPase 2NP_033853(K)ADVGFAMGIAGTDVAK(E)   peptide count: 7
A3465ATP2B1, PMCA1Plasma membrane calcium-transporting ATPase 1NP_080758(K)ADVGFAMGIAGTDVAK(E)   peptide count: 7
A3466ATP2B3, PMCA3APlasma membrane calcium-transporting ATPase 3NP_796210(K)ADVGFAMGIAGTDVAK(E)   peptide count: 7
A013ANCSTN, UNQ1874/PRO4317, UNQ1874Nicastrin precursorNP_067620(K)ADVLFVAPR(E)   peptide count: 2
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainNP_001070022(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993410(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993594(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993634(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993666(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993705(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993740(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993773(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993811(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993853(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993888(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993920(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993959(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994000(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994029(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994106(K)ADVVESWIGEK(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994149(K)ADVVESWIGEK(E)   peptide count: 1
A4372PPIF, CYP3Peptidyl-prolyl cis-trans isomerase FNP_598845(K)ADVVPK(T)   peptide count: 15
A523BMPV17L2, FKSG24MPV17-like protein 2NP_898993(K)ADWCVWPAAQLVNFLFIPSHFR(V)   peptide count: 5
A7301PARL, PSARL, PRO2207Presenilins associated rhomboid-like protein, mitochondrial precursorNP_001005767(K)ADWLDSIRPQK(E)   peptide count: 5
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ADWSSLSR(D)   peptide count: 77
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ADWSSLSRDEK(V)   peptide count: 12
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ADWSSLSRDEKVQLYR(I)   peptide count: 1
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformNP_031534(K)ADYAQLLEDMQNAFR(S)   peptide count: 9
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaNP_034610(K)AEADKNDK(A)   peptide count: 1
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1NP_032328(K)AEADKNDK(A)   peptide count: 1
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AEAEEGELLVR(D)   peptide count: 1
A9506TOMM22, TOM22, MST065Mitochondrial import receptor subunit TOM22 homologNP_766197(K)AEAEKAEEELEEDDDDELDETLSER(L)   peptide count: 21
A4760DNAH10Dynein heavy chain 10, axonemalXP_983660(K)AEAETALAEVMPILEAAK(L)   peptide count: 1
A3849KRT1, KRTAKeratin, type II cytoskeletal 1NP_032499(K)AEAETFYQSK(Y)   peptide count: 1
A1668RPS1040S ribosomal protein S10NP_080239(K)AEAGAGSATEFQFR(G)   peptide count: 1
A7350PDXK, PKH, PNKPyridoxal kinaseNP_742146(K)AEAGEGQKPSPAQLELR(M)   peptide count: 3
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AEAHFSLVHYAGTVDYNIIGWLDK(N)   peptide count: 3
A812CARMC1, ARCPArmadillo repeat-containing protein 1NP_083116(K)AEALASAIASTK(V)   peptide count: 6
A1815MTP, MTTPMicrosomal triglyceride transfer protein, large subunit precursorNP_032668(K)AEAPLR(Q)   peptide count: 1
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)AEAQIAAK(N)   peptide count: 3
A1815MTP, MTTPMicrosomal triglyceride transfer protein, large subunit precursorNP_032668(K)AEAVQSFLAFIQHLR(T)   peptide count: 16
A781BABCD2, ALD1, ALDL1ATP-binding cassette, sub-family D, member 2NP_036124(K)AEAYSPAENR(E)   peptide count: 2
A9011RASGRF2, GRF2RAS-specific guanine nucleotide-releasing factor 2NP_033053(K)AECFETLSAMELAEQITLLDHIVFR(S)   peptide count: 1
A016ANOMO1, PM5Nodal modulator 1NP_694697(K)AEDDQPLPGVLLSLSGGVFR(S)   peptide count: 2
A4236SURF-1, SURF1Surfeit locus protein 1NP_038705(K)AEDDSFLQWFLLLIPATAFGLGTWQVQR(R)   peptide count: 2
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateNP_032564(K)AEDGAAPSPSSETPK(K)   peptide count: 7
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateNP_032564(K)AEDGAAPSPSSETPKK(K)   peptide count: 3
A3815RPS2, rps2, RPS440S ribosomal protein S2NP_032529(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_145024(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_618996(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_620794(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_907394(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_620258(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_990375(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_993544(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_001002026(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_997963(K)AEDKEWIPVTK(L)   peptide count: 2
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_001004356(K)AEDKEWIPVTK(L)   peptide count: 2
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)AEDLFR(R)   peptide count: 1
A3990CASKIN1Cask-interacting protein 1NP_082213(K)AEDVGTAQR(L)   peptide count: 1
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 1NP_038587(K)AEDVSAIEIVGGATR(I)   peptide count: 1
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursorNP_080798(K)AEDVVLEHR(S)   peptide count: 1
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AEECSSIPILLSLFK(H)   peptide count: 3
A0452CANXCalnexin precursorNP_031623(K)AEEDEILNR(S)   peptide count: 8
A0568PCLO, ACZProtein piccoloNP_036125(K)AEEDPMEDPYELK(L)   peptide count: 9
A8681ATPIF1, ATPI, ASIATPase inhibitor, mitochondrial precursorNP_031538(K)AEEDRYFR(E)   peptide count: 21
A0121AMPH, AMPH1Amphiphysin INP_778172(K)AEEEFQK(A)   peptide count: 4
A9506TOMM22, TOM22, MST065Mitochondrial import receptor subunit TOM22 homologNP_766197(K)AEEELEEDDDDELDETLSER(L)   peptide count: 14
A501EWDR96WD repeat-containing protein 96XP_129357(K)AEEFPLPDGAPLINPLTLVYQK(D)   peptide count: 1
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinNP_573479(K)AEEFRR(Q)   peptide count: 1
A9540RPL1160S ribosomal protein L11NP_080195(K)AEEILEK(G)   peptide count: 4
A9540RPL1160S ribosomal protein L11XP_286185(K)AEEILEK(G)   peptide count: 4
A9540RPL1160S ribosomal protein L11XP_981252(K)AEEILEK(G)   peptide count: 4
A178CMYO7A, USH1BUnconventional myosin-VIIaNP_032689(K)AEEILMR(E)   peptide count: 1
A6279DDX50DEAD-box protein 50XP_985006(K)AEEILMR(E)   peptide count: 1
A7976ACAA1, ACAA, PTHIO3-ketoacyl-CoA thiolase, peroxisomal precursorNP_666342(K)AEELGLPILGVLR(S)   peptide count: 13
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalNP_570934(K)AEELGLPILGVLR(S)   peptide count: 13
A3511RMDN3, FAM82A2, FAM82CRegulator of microtubule dynamics protein 3NP_001028308(K)AEELQPGFSK(A)   peptide count: 2
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorNP_031599(K)AEEQEPELTSTPNFVVEVTK(T)   peptide count: 33
A5112RMDN1, FAM82B, CGI-90Regulator of microtubule dynamics protein 1NP_079752(K)AEEVDPNFYSK(N)   peptide count: 9
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6NP_082770(K)AEEVVCFVK(K)   peptide count: 2
A209EQIL1QIL1 proteinNP_694792(K)AEEVVPPAMYQFSQYVCQQTGLEMPQLPTPPK(I)   peptide count: 1
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6NP_080402(K)AEEVVSFVK(K)   peptide count: 10
A3574BASP1, NAP22Brain acid soluble protein 1NP_081671(K)AEGAGTEEEGTPK(E)   peptide count: 4
A0742TTNTitinNP_035782(K)AEGILTER(A)   peptide count: 1
A0742TTNTitinNP_082280(K)AEGILTER(A)   peptide count: 1
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)AEGIVFNTQSTIK(L)   peptide count: 2
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)AEGIVFNTQSTIKL(-)   peptide count: 2
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AEGLGMVNEDGTVINR(Q)   peptide count: 1
A5360IFT172, SLBIntraflagellar transport protein 172 homologNP_080574(K)AEGLLLR(A)   peptide count: 1
A5660ACAD11Acyl-CoA dehydrogenase family member 11NP_780533(K)AEGLWNLFLPAVSGLSQVDYALIAEETGK(C)   peptide count: 7
A5659ACAD10Acyl-CoA dehydrohenase family member 10NP_082313(K)AEGLWNLFLPLETDPEK(K)   peptide count: 12
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_488540(K)AEGLWNLFLPLETDPEK(K)   peptide count: 12
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_904660(K)AEGLWNLFLPLETDPEK(K)   peptide count: 12
A5659ACAD10Acyl-CoA dehydrohenase family member 10NP_082313(K)AEGLWNLFLPLETDPEKK(Y)   peptide count: 23
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_488540(K)AEGLWNLFLPLETDPEKK(Y)   peptide count: 23
A5659ACAD10Acyl-CoA dehydrohenase family member 10XP_904660(K)AEGLWNLFLPLETDPEKK(Y)   peptide count: 23
A016ANOMO1, PM5Nodal modulator 1NP_694697(K)AEGNDHIER(A)   peptide count: 1
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKNP_033773(K)AEGPEVDVNLPK(A)   peptide count: 8
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AEGQPVGSALK(Q)   peptide count: 28
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorNP_035162(K)AEGSEIR(L)   peptide count: 1
A0289PPP5C, PPP5Serine/threonine protein phosphatase 5NP_035285(K)AEGYEVAHGGR(C)   peptide count: 1
A4430CACNA1S, CACH1, CACN1Voltage-dependent L-type calcium channel alpha-1S subunitXP_001002706(K)AEHPVQK(E)   peptide count: 1
A4388SCO1, SCOD1SCO1 protein homolog, mitochondrial precursorNP_001035115(K)AEIAGSIAAHMR(S)   peptide count: 7
A4388SCO1, SCOD1SCO1 protein homolog, mitochondrial precursorXP_906712(K)AEIAGSIAAHMR(S)   peptide count: 7
A2378SRGAP1, ARHGAP13SLIT-ROBO RHO GTPase-activating protein 1XP_001004446(K)AEIETEYSRNLEK(L)   peptide count: 1
A0556ATP2A3Sarcoplasmic/endoplasmic reticulum calcium ATPase 3NP_058025(K)AEIGIAMGSGTAVAK(T)   peptide count: 8
A3468ATP2A1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1NP_031530(K)AEIGIAMGSGTAVAK(T)   peptide count: 8
A391ETHNSL1Threonine synthase-like 1NP_808256(K)AEIIGSQR(E)   peptide count: 7
A4814FLNB, FLN3, TAPFilamin-BXP_995248(K)AEISCIDNK(D)   peptide count: 1
A4814FLNB, FLN3, TAPFilamin-BXP_995274(K)AEISCIDNK(D)   peptide count: 1
A4814FLNB, FLN3, TAPFilamin-BXP_995308(K)AEISCIDNK(D)   peptide count: 1
A3539CCT7, CCTH, NIP7-1T-complex protein 1, eta subunitNP_031664(K)AEKDNAEIR(V)   peptide count: 1
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialNP_062668(K)AEKEAAEVK(N)   peptide count: 1
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialNP_062668(K)AEKEAAEVKN(-)   peptide count: 5
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AEKQNVVFSSETYSTLIGLLLSK(D)   peptide count: 1
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35NP_075373(K)AELAELPLR(L)   peptide count: 2
A5840ASPHJunctinNP_075553(K)AELDAAEK(L)   peptide count: 1
A1493FGBFibrinogen beta chain precursorNP_862897(K)AELEDLR(Q)   peptide count: 2
A1840TAPL, ABCB9ATP-binding cassette, sub-family B, member 9 precursorNP_063928(K)AELEDLR(Q)   peptide count: 2
A5941RNF20, BRE1AE3 ubiquitin-protein ligase BRE1ANP_892044(K)AELEDLR(Q)   peptide count: 2
A2317MICAL3Microtubule associated monoxygenase, Calponin and LIM domain containing 3XP_622935(K)AELELR(V)   peptide count: 1
A7152NLN, AGTBPNeurolysin, mitochondrial precursorNP_083723(K)AELGALPDDFIDSLEK(T)   peptide count: 12
A7152NLN, AGTBPNeurolysin, mitochondrial precursorNP_083723(K)AELGALPDDFIDSLEKTDEDKYK(V)   peptide count: 2
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_663335(K)AELGIPLEEVDLNEMDYLTR(I)   peptide count: 7
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_808875(K)AELGIPLEEVDLNEMDYLTR(I)   peptide count: 7
A6760HK2Hexokinase, type IINP_038848(K)AELLFQGK(L)   peptide count: 3
A5154SPTBN4, SPTBN3, SPNB4Spectrin beta chain, brain 3NP_115999(K)AELLR(S)   peptide count: 1
A6875DTYMK, CDC8, TMPKThymidylate kinaseNP_075625(K)AELLR(S)   peptide count: 1
A797DPHLDB1, LL5A, DLNB07Pleckstrin homology-like domain family B member 1NP_705765(K)AELLR(S)   peptide count: 1
A3816RPS340S ribosomal protein S3NP_036182(K)AELNEFLTR(E)   peptide count: 3
A424BMICU3, EFHA2EF-hand domain-containing family member A2XP_357872(K)AELNFEDFYR(F)   peptide count: 5
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)AELNNEKK(E)   peptide count: 3
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)AELNNEKK(E)   peptide count: 3
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1NP_031480(K)AELNSDKK(E)   peptide count: 2
A350BMGARP, OSAP, GS3582Ovary-specific acidic proteinNP_080634(K)AELQPLPGEK(E)   peptide count: 3
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)AELSVIFADKPEK(A)   peptide count: 20
A4295DNAJC13, RME8DnaJ homolog subfamily C member 13XP_135146(K)AELVPYLLK(L)   peptide count: 2
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorNP_598803(K)AEMDAAVESCK(R)   peptide count: 81
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorNP_598803(K)AEMDAAVESCKR(A)   peptide count: 80
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)AEMEDLVSSK(D)   peptide count: 4
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorNP_083299(K)AEMIIEK(N)   peptide count: 4
A157CMYO18BMyosin XVIIIBXP_995297(K)AEMQELAQR(E)   peptide count: 1
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2XP_129477(K)AENDMAMK(R)   peptide count: 2
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2XP_904182(K)AENDMAMK(R)   peptide count: 2
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2XP_904199(K)AENDMAMK(R)   peptide count: 2
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2XP_904209(K)AENDMAMK(R)   peptide count: 2
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2XP_904214(K)AENDMAMK(R)   peptide count: 2
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31NP_036190(K)AENEALAMQK(Q)   peptide count: 8
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseNP_032110(K)AENGKLVINGKPITIFQERDPTNIK(W)   peptide count: 1
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseNP_001001303(K)AENGKLVINGKPITIFQERDPTNIK(W)   peptide count: 1
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseXP_484436(K)AENGKLVINGKPITIFQERDPTNIK(W)   peptide count: 1
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseXP_620532(K)AENGKLVINGKPITIFQERDPTNIK(W)   peptide count: 1
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseXP_001004821(K)AENGKLVINGKPITIFQERDPTNIK(W)   peptide count: 1
A873ABAT2, PRRC2A, G2Large proline-rich protein BAT2NP_064411(K)AENKGNDPNVSLVPK(D)   peptide count: 2
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AENLIYWITEEFSK(A)   peptide count: 7
A0117NSFVesicle-fusing ATPaseNP_032766(K)AENSSLNLIGK(A)   peptide count: 7
A3469ATP4APotassium-transporting ATPase alpha chain 1NP_061201(K)AENYELYSVELGSGPGGDMTAK(M)   peptide count: 1
A7751POLRMTDNA-directed RNA polymerase, mitochondrialNP_766139(K)AEPAFRPPPQAPSPVNTSTLLK(D)   peptide count: 2
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AEPALLAAQEALDTLNK(N)   peptide count: 5
A1292UBE2N, BLUUbiquitin-conjugating enzyme E2 NNP_542127(K)AEPDESNAR(Y)   peptide count: 1
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5NP_080890(K)AEPDVK(K)   peptide count: 4
A3574BASP1, NAP22Brain acid soluble protein 1NP_081671(K)AEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPK(A)   peptide count: 1
A1018DIAPH1, DIAP1Diaphanous 1NP_031884(K)AEPHFLSILQHLLLVR(N)   peptide count: 1
A178CMYO7A, USH1BUnconventional myosin-VIIaNP_032689(K)AEPLKDEAYVQILK(Q)   peptide count: 2
A178CMYO7A, USH1BUnconventional myosin-VIIaNP_032689(K)AEPLKDEAYVQILKQLTDNHIR(Y)   peptide count: 1
A837DPRR12Proline-rich protein 12XP_001003082(K)AEPPPK(K)   peptide count: 1
A176ATEX101, SGRG, UNQ867/PRO1884Testis-specific protein TES101RPNP_064365(K)AEQCNPGELCQETVLLIK(A)   peptide count: 2
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorNP_035086(K)AEQFYCGDTEGK(K)   peptide count: 36
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorNP_035086(K)AEQFYCGDTEGKK(V)   peptide count: 38
A3665OGDHL2-oxoglutarate dehydrogenase E1 component-like, mitochondrial precursorXP_138959(K)AEQFYR(G)   peptide count: 14
A3665OGDHL2-oxoglutarate dehydrogenase E1 component-like, mitochondrial precursorXP_138959(K)AEQFYR(G)   peptide count: 1
A9267CELSR2, CDHF10, EGFL2Cadherin EGF LAG seven-pass G-type receptor 2 precursorNP_001004177(K)AEQFYR(G)   peptide count: 1
A9267CELSR2, CDHF10, EGFL2Cadherin EGF LAG seven-pass G-type receptor 2 precursorNP_059088(K)AEQFYR(G)   peptide count: 1
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2NP_075720(K)AEQINQAAGEASAVLAK(A)   peptide count: 16
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteNP_038703(K)AEQLSAAR(S)   peptide count: 1
A3776SLC25A3, PHCSolute carrier family 25 member 3NP_598429(K)AEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNK(E)   peptide count: 21
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorNP_034813(K)AEQQTADQLLAR(A)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AERPDGLILGMGGQTALNCGVELFK(R)   peptide count: 70
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AERPDGLILGMGGQTALNCGVELFKR(G)   peptide count: 28
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AERPDVDEK(R)   peptide count: 1
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AERPDVDEKR(S)   peptide count: 2
A4992MUC2, mucin, MLPMucin 2 precursorXP_980706(K)AERPTCLLGFEVK(T)   peptide count: 2
A506CSLC9A6, NHE6, NHE6.1Sodium/hydrogen exchanger 6NP_766368(K)AESAWLFR(M)   peptide count: 1
A3469ATP4APotassium-transporting ATPase alpha chain 1NP_061201(K)AESDIMHLRPR(N)   peptide count: 1
A5683APEH, D3F15S2, D3S48EAcylamino-acid-releasing enzymeNP_666338(K)AESFFQTK(A)   peptide count: 1
A469AHIST1H1A, H1F1Histone H1.1NP_085112(K)AESKAITTKVSVK(A)   peptide count: 1
A0117NSFVesicle-fusing ATPaseNP_032766(K)AESLQVTR(G)   peptide count: 11
A0276CIT, CRIK, STK21Citron proteinNP_031734(K)AESLSDK(L)   peptide count: 1
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorNP_031402(K)AESPVFVQTDKPIYKPGQIVK(F)   peptide count: 5
A3994CHCHD6, CHCM1Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialNP_079627(K)AESTIKPR(R)   peptide count: 21
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)AETELKELEQK(H)   peptide count: 1
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AETFTFHSDICTLPEK(E)   peptide count: 3
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AETFTFHSDICTLPEKEK(Q)   peptide count: 8
A464BFRAS1Extracellular matrix protein FRAS1NP_780682(K)AETMSSSAREIK(H)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_001003815(K)AETMTVSSLAIR(K)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_001006665(K)AETMTVSSLAIR(K)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_038538(K)AETMTVSSLAIR(K)   peptide count: 1
A0787FKBP4, FKBP52FK506-binding protein 4NP_034349(K)AEVAAGDHPTDAEMKGER(N)   peptide count: 1
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitNP_033968(K)AEVARAQAALAVNISAARGLQDVLR(T)   peptide count: 1
A5016ODF2Outer dense fiber of sperm tails 2NP_038643(K)AEVEAIMEQLK(E)   peptide count: 3
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)AEVGQEGEAGQFDGEK(V)   peptide count: 2
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_126589(K)AEVGSPL(-)   peptide count: 14
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_900236(K)AEVGSPL(-)   peptide count: 14
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_999390(K)AEVGSPL(-)   peptide count: 14
A802BAP3B2Adapter-related protein complex 3 beta 2 subunitNP_067467(K)AEVGVIAK(A)   peptide count: 1
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)AEVITCDVLLVCIGR(R)   peptide count: 125
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseNP_032088(K)AEVRLQFR(D)   peptide count: 1
A6549G6pd2Glucose-6-phosphate 1-dehydrogenase 2NP_062341(K)AEVRLQFR(D)   peptide count: 1
A9093TBC1D21TBC1 domain family member 21XP_134945(K)AEWDSFFDENGHLAK(S)   peptide count: 3
A1928DNM3Dynamin 3NP_001033708(K)AEYAEFLHCK(G)   peptide count: 1
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)AFAAGADIK(E)   peptide count: 39
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)AFAAGADIKEMQNR(T)   peptide count: 25
A9678MRPS31, IMOGN3828S ribosomal protein S31, mitochondrial precursorNP_065585(K)AFADEPPEPEASPSLWEIEFAK(Q)   peptide count: 4
A5269ANKRD17, GTAR, NY-BR-16Ankyrin repeat domain protein 17NP_112148(K)AFADPEVLR(R)   peptide count: 6
A5269ANKRD17, GTAR, NY-BR-16Ankyrin repeat domain protein 17NP_932127(K)AFADPEVLR(R)   peptide count: 6
A6888LDHDD-lactate dehydrogenase, mitochondrialNP_081846(K)AFAENLGR(R)   peptide count: 14
A6888LDHDD-lactate dehydrogenase, mitochondrialNP_081846(K)AFAENLGRR(A)   peptide count: 1
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorNP_031408(K)AFAGDIANQLATDAVQIFGGYGFNTEYPVEK(L)   peptide count: 176
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AFAISGPFNVQFLVK(G)   peptide count: 54
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_906671(K)AFAISGPFNVQFLVK(G)   peptide count: 54
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorNP_666253(K)AFALDVINSAHER(W)   peptide count: 29
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AFAMTNQILVER(S)   peptide count: 68
A0367RPL13, BBC160S ribosomal protein L13NP_058018(K)AFASLR(M)   peptide count: 3
A0367RPL13, BBC160S ribosomal protein L13XP_981396(K)AFASLR(M)   peptide count: 3
A0367RPL13, BBC160S ribosomal protein L13XP_999884(K)AFASLR(M)   peptide count: 3
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialNP_666220(K)AFCAGGDIK(A)   peptide count: 11
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorNP_034813(K)AFDITYVR(L)   peptide count: 1
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialNP_077136(K)AFDLFNPNFK(S)   peptide count: 14
A6419ELOVL2, SSC2Elongation of very long chain fatty acids protein 2NP_062296(K)AFDNEVNAFLDNMFGPR(D)   peptide count: 4
A0013DLG4, PSD95, TIP15Presynaptic density protein 95NP_031890(K)AFDRATK(L)   peptide count: 1
A3586ACLYATP-citrate synthaseNP_598798(K)AFDSGIIPMEFVNK(M)   peptide count: 1
A497DGLOD5Glyoxalase domain-containing protein 5NP_081503(K)AFDVPIEEGPVFR(T)   peptide count: 2
A258D Uncharacterized protein CXorf22XP_916479(K)AFDYFQK(V)   peptide count: 1
A3918VCPTransitional endoplasmic reticulum ATPaseNP_033529(K)AFEEAEK(N)   peptide count: 5
A6404ECE1Endothelin-converting enzyme 1NP_955011(K)AFEESLSTLK(W)   peptide count: 1
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1NP_064377(K)AFEPATGR(V)   peptide count: 19
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorNP_034404(K)AFEVAK(M)   peptide count: 16
A5242VIL1, VILVillin 1NP_033535(K)AFEVTAR(A)   peptide count: 1
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseNP_032968(K)AFFESHPAPSAER(T)   peptide count: 8
A3982CSF1Macrophage colony-stimulating factor 1NP_031804(K)AFFLVQDIIDETMR(F)   peptide count: 6
A2454SYNE2, NUA, TROPHNesprin 2XP_922176(K)AFFQK(L)   peptide count: 1
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)AFFSGR(L)   peptide count: 2
A4356NPLOC4, NPL4Nuclear protein localization protein 4 homologNP_955763(K)AFGAPNVVEDEIDQYLSK(Q)   peptide count: 1
A6076CLYBL, CLBCitrate lyase beta like protein, mitochondrialNP_083832(K)AFGLQAIDLVYIDFR(D)   peptide count: 1
A6076CLYBL, CLBCitrate lyase beta like protein, mitochondrialNP_083832(K)AFGLQAIDLVYIDFRDEDGLLR(Q)   peptide count: 8
A4815FLNC, ABPL, FLN2Filamin CXP_284175(K)AFGPGLEPTGCIVDRPAEFTIDAR(A)   peptide count: 1
A7179NSDHL, H105E3NAD(P)-dependent steroid dehydrogenaseNP_035071(K)AFHITNDEPIPFWTFLSR(I)   peptide count: 1
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)AFIDCCNHITK(L)   peptide count: 4
A723DMPTX1, MPTXPutative mucosal pentraxin homologNP_079746(K)AFIFPQESSTAYVSLIPK(V)   peptide count: 2
A723DMPTX1, MPTXPutative mucosal pentraxin homologXP_136329(K)AFIFPQESSTAYVSLIPK(V)   peptide count: 2
A2847ZNF354BZinc finger protein 354BNP_038772(K)AFIHNSSLR(K)   peptide count: 1
A7040MMABCob(I)alamin adenosyltransferase, mitochondrial precursorNP_084232(K)AFILPSGGK(S)   peptide count: 10
A6775IDEInsulin-degrading enzymeNP_112419(K)AFIPQLLSR(L)   peptide count: 7
A1645ZNF192, ZKSCAN8Zinc finger protein 192NP_631880(K)AFIQR(S)   peptide count: 1
A3951SFXN1Sideroflexin 1NP_081600(K)AFIQR(S)   peptide count: 1
A0637GPHRYN, GPHN, GPHGephyrinNP_766540(K)AFITVLEMTPVLGTEIINYR(D)   peptide count: 1
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_058566(K)AFIVLNPDYK(S)   peptide count: 4
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_997606(K)AFIVLNPDYK(S)   peptide count: 4
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_997607(K)AFIVLNPDYK(S)   peptide count: 4
A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrialNP_473435(K)AFIVLNPEFLSHDQEQLIK(E)   peptide count: 8
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AFKPYQGNPTFDPEFIR(S)   peptide count: 3
A3807RPLP060S acidic ribosomal protein P0NP_031501(K)AFLADPSAFAAAAPAAAATTAAPAAAAAPAK(A)   peptide count: 2
A3807RPLP060S acidic ribosomal protein P0XP_996602(K)AFLADPSAFAAAAPAAAATTAAPAAAAAPAK(A)   peptide count: 2
A7232OGT, HRNT1UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunitNP_631883(K)AFLDSLPDVK(I)   peptide count: 1
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorNP_080784(K)AFLEALQNQAETSSK(I)   peptide count: 29
A486DGBP6Guanylate-binding protein 6NP_919317(K)AFLEEGFKKK(A)   peptide count: 1
A486DGBP6Guanylate-binding protein 6NP_001034735(K)AFLEEGFKKK(A)   peptide count: 1
A2678Zfp59Zinc finger protein 59NP_035892(K)AFLLPSQLNSHKIVHTSK(R)   peptide count: 1
A1521VWF, F8VWFVon Willebrand factor precursorNP_035838(K)AFLLSGVDELEQR(R)   peptide count: 1
A7152NLN, AGTBPNeurolysin, mitochondrial precursorNP_083723(K)AFLMSR(G)   peptide count: 2
A7924LARS2Leucyl-tRNA synthetase, mitochondrial precursorNP_694808(K)AFLSPR(T)   peptide count: 5
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PNP_861461(K)AFLSSPEHVNRPINGNGKQ(-)   peptide count: 13
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PNP_038569(K)AFLSSPEHVNRPINGNGKQ(-)   peptide count: 13
A0621RAB10Ras-related protein Rab-10NP_057885(K)AFLTLAEDILR(K)   peptide count: 60
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(K)AFLVGIVVPDPEVMPSWAQK(K)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(K)AFLVGIVVPDPEVMPSWAQK(K)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(K)AFLVGIVVPDPEVMPSWAQK(K)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(K)AFLVGIVVPDPEVMPSWAQK(K)   peptide count: 3
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)AFMTADLPNELIELLEK(I)   peptide count: 51
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AFNVVFEK(A)   peptide count: 1
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialNP_077136(K)AFPPLREPVFR(R)   peptide count: 3
A6650GZMA, CTLA3, HFSPGranzyme ANP_034500(K)AFPYPCYDEYTR(E)   peptide count: 1
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorNP_031478(K)AFQFVETHGEVCPANWTPESPTIKPSPTASK(E)   peptide count: 44
A7290PAPD1, MTPAPPolyA) RNA polymerase, mitochondrial precursorNP_080433(K)AFQLTEENIR(L)   peptide count: 4
A5772Akr1b7Aldose reductase-related protein 1NP_765986(K)AFQNTLSDLK(L)   peptide count: 4
A2489GNSN-acetylglucosamine-6-sulfatase precursorNP_083640(K)AFQNVIAPR(N)   peptide count: 1
A581DVWA8Uncharacterized protein KIAA0564XP_001002205(K)AFQQR(L)   peptide count: 2
A0120SYNJ1Synaptojanin 1XP_358889(K)AFQSHLK(A)   peptide count: 2
A088CLBPLipopolysaccharide-binding protein precursorNP_032515(K)AFRPFTPQIYK(K)   peptide count: 2
A044DARMC12Uncharacterized protein C6ORF81NP_080566(K)AFSGIR(K)   peptide count: 2
A0121AMPH, AMPH1Amphiphysin INP_778172(K)AFSIQGAPSDSGPLR(I)   peptide count: 5
A450CSEC61A1, SEC61AProtein transport protein Sec61 alpha subunitNP_058602(K)AFSPTTVNTGR(G)   peptide count: 1
A0684SNAP91Clathrin coat assembly protein AP180NP_038697(K)AFSYR(H)   peptide count: 7
A1645ZNF192, ZKSCAN8Zinc finger protein 192NP_631880(K)AFSYR(H)   peptide count: 7
A313DZfp961Uncharacterized proteinXP_986125(K)AFSYR(H)   peptide count: 7
A723DMPTX1, MPTXPutative mucosal pentraxin homologXP_136329(K)AFTDLTRPYSIFSYSTR(T)   peptide count: 1
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorNP_031408(K)AFTGFIVEADTPGIHIGK(K)   peptide count: 15
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorNP_031408(K)AFTGFIVEADTPGIHIGKK(E)   peptide count: 3
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AFTMSAAETAR(R)   peptide count: 1
A3633HSD17B12Hydroxysteroid (17-beta) dehydrogenase 12NP_062631(K)AFVDFFSQCLHEEYK(S)   peptide count: 5
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorNP_031599(K)AFVEFLTDEIK(E)   peptide count: 19
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorNP_031599(K)AFVEFLTDEIKEEK(K)   peptide count: 46
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorNP_031599(K)AFVEFLTDEIKEEKK(I)   peptide count: 10
A6212CRP, PTX1C-reactive protein precursorNP_031794(K)AFVFPK(E)   peptide count: 1
A3501ROCK2Rho-associated protein kinase 2NP_033098(K)AFVGNQLPFIGFTYFR(E)   peptide count: 1
A1521VWF, F8VWFVon Willebrand factor precursorNP_035838(K)AFVVGMMER(L)   peptide count: 1
A5686ACSM2A, ACSM2, MACS2Acyl-CoA synthetase medium chain family member 2ANP_666309(K)AFVVLAPEFLSHDR(D)   peptide count: 4
A5686ACSM2A, ACSM2, MACS2Acyl-CoA synthetase medium chain family member 2ANP_666309(K)AFVVLAPEFLSHDRDQLTK(V)   peptide count: 13
A5360IFT172, SLBIntraflagellar transport protein 172 homologNP_080574(K)AFYEAGTAAK(E)   peptide count: 1
A2008HSPA1LHeat shock 70 kDa protein 1-HOMNP_038586(K)AFYPEEISSMVLTK(M)   peptide count: 1
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorNP_941055(K)AFYTR(E)   peptide count: 13
A6751HTATIP2, CC3, TIP30Oxidoreductase HTATIP2NP_058561(K)AGAEGFVR(V)   peptide count: 8
A1539KNG1, BDK, KNGKininogen-1NP_075614(K)AGAEPAPER(Q)   peptide count: 1
A0396SLC25A5, ANT2ADP/ATP translocase 2NP_031477(K)AGAEREFK(G)   peptide count: 9
A0396SLC25A5, ANT2ADP/ATP translocase 2XP_892944(K)AGAEREFK(G)   peptide count: 9
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2XP_485652(K)AGAEREFK(G)   peptide count: 9
A534EPINLYPPhospholipase A2 inhibitor and Ly6/PLAUR domain-containing proteinNP_001032220(K)AGAEVPSAFYLYFLR(R)   peptide count: 1
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialNP_083548(K)AGAGAVVPK(L)   peptide count: 81
A3696MDH2Malate dehydrogenase, mitochondrial precursorNP_032643(K)AGAGSATLSMAYAGAR(F)   peptide count: 219
A610CTIMM22, TEX4, TIM22Mitochondrial import inner membrane translocase subunit TIM22NP_062792(K)AGAIGCGGFAAFSAAIDYYLR(-)   peptide count: 3
A0097TLN1, TLNTalin 1NP_035732(K)AGALQCSPSDVYTK(K)   peptide count: 3
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1NP_064377(K)AGAPPGLFNVVQGGAATGQFLCHHR(E)   peptide count: 5
A5923GLB1, ELNR1Beta-galactosidase precursorNP_033882(K)AGATLDILVENMGR(V)   peptide count: 1
A0784DYNC1LI1, DNCLI1Dynein light intermediate chain 1, cytosolicNP_666341(K)AGATSEGVLANFFNSLLSK(K)   peptide count: 1
A6317DHRS1Dehydrogenase/reductase SDR family member 1NP_081095(K)AGATVYITGR(H)   peptide count: 1
A6993ABCB1, MDR1, PGY1Multidrug resistance protein 1NP_035205(K)AGAVAEEVLAAIR(T)   peptide count: 4
A6995ABCB4, MDR3, PGY3Multidrug resistance protein 3NP_035206(K)AGAVAEEVLAAIR(T)   peptide count: 4
A6367DPP4, ADCP2, CD26Dipeptidyl peptidase 4NP_034204(K)AGAVNPTVK(F)   peptide count: 5
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainNP_803126(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBNP_031621(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainNP_001034227(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainNP_001034228(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainNP_848712(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainNP_001020609(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainNP_001020610(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainNP_076302(K)AGAYDFPSPEWDTVTPEAK(N)   peptide count: 2
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialNP_032238(K)AGDEFVEK(T)   peptide count: 120
A0848FHITBis(5'-adenosyl)-triphosphataseNP_034340(K)AGDFPR(N)   peptide count: 3
A3498TTC7B, TTC7L1Tetratricopeptide repeat protein 7BXP_127105(K)AGDIALLYLQEIER(V)   peptide count: 1
A962BETFB, FP585Electron transfer flavoprotein beta-subunitNP_080971(K)AGDLGVDLTSK(V)   peptide count: 59
A0742TTNTitinNP_035782(K)AGDSIVLSAISILGKPLPK(S)   peptide count: 1
A0742TTNTitinNP_082280(K)AGDSIVLSAISILGKPLPK(S)   peptide count: 1
A9582MRPL2, CGI-2239S ribosomal protein L2, mitochondrial precursorNP_079578(K)AGDTILNSNHIGR(M)   peptide count: 1
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorNP_659093(K)AGDTVGEGDLLVELE(-)   peptide count: 7
A3574BASP1, NAP22Brain acid soluble protein 1NP_081671(K)AGEASAESTGAADGAAPEEGEAK(K)   peptide count: 7
A6957MANBA, MANB1Beta-mannosidase precursorNP_081564(K)AGEAVVLFQMPVSELLK(R)   peptide count: 8
A6957MANBA, MANB1Beta-mannosidase precursorNP_081564(K)AGEAVVLFQMPVSELLKR(C)   peptide count: 1
A0742TTNTitinNP_035782(K)AGEDVQLLIPFK(G)   peptide count: 1
A0742TTNTitinNP_082280(K)AGEDVQLLIPFK(G)   peptide count: 1
A6893LIAS, LAS, HUSSY-01Lipoic acid synthetase, mitochondrial precursorNP_077791(K)AGEFFLK(N)   peptide count: 1
A176BYBEYPutative Metalloprotease C21ORF57NP_766138(K)AGEFPQPHSPDDYNLGDIFLGVEYILQHCR(E)   peptide count: 2
A5921BCO2, BCDO2Beta,beta-carotene 9',10'-dioxygenaseNP_573480(K)AGEGLDQVYELK(A)   peptide count: 1
A5771GPT2, AAT2, ALT2Alanine aminotransferase 2NP_776291(K)AGEIEMELQR(G)   peptide count: 4
A6774ICT1, DS1Immature colon carcinoma transcript 1 precursorNP_081005(K)AGELVLTSESSR(Y)   peptide count: 13
A3884NCAM1, NCAMNeural cell adhesion molecule 1, 120/140 kDa isoform precursorNP_035005(K)AGEQDASIHLK(V)   peptide count: 8
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AGEQEEEEEEVEEK(K)   peptide count: 1
A8390SERPINA6, CBGCorticosteroid-binding globulin precursorNP_031644(K)AGEQINNHVK(N)   peptide count: 2
A9997MTFP1, MTP18, HSPC242Mitochondrial protein 18 kDaNP_080719(K)AGEVPSPEAGR(N)   peptide count: 17
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorNP_031407(K)AGEVSR(E)   peptide count: 3
A150CMup1Major urinary protein 1NP_112465(K)AGEYSVTYDGFNTFTIPK(T)   peptide count: 9
A155CMup6Major urinary protein 6NP_001039015(K)AGEYSVTYDGFNTFTIPK(T)   peptide count: 9
A155CMup6Major urinary protein 6NP_032673(K)AGEYSVTYDGFNTFTIPK(T)   peptide count: 9
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleNP_031418(K)AGFAGDDAPR(A)   peptide count: 85
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1NP_031419(K)AGFAGDDAPR(A)   peptide count: 85
A4551ACTC1, ACTCActin, alpha cardiac muscle 1NP_033738(K)AGFAGDDAPR(A)   peptide count: 85
A4552ACTG1, ACTGActin, cytoplasmic 2NP_033739(K)AGFAGDDAPR(A)   peptide count: 85
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideNP_033740(K)AGFAGDDAPR(A)   peptide count: 85
A4555ACTA1, ACTAActin, alpha skeletal muscleNP_033736(K)AGFAGDDAPR(A)   peptide count: 85
A0660ACTR1A, CTRN1Alpha-centractinNP_058556(K)AGFAGDQIPK(Y)   peptide count: 1
A4295DNAJC13, RME8DnaJ homolog subfamily C member 13XP_135146(K)AGFLAFTQLPK(F)   peptide count: 2
A0097TLN1, TLNTalin 1NP_035732(K)AGFLDLKDFLPK(E)   peptide count: 1
A4300DNAJC28DnaJ homolog subfamily C member 28NP_619605(K)AGFLNWLNLWK(S)   peptide count: 1
A205DCRYBG3Beta/gamma crystallin domain-containing protein 3NP_777273(K)AGFQGECIDFVK(E)   peptide count: 1
A3595ALDH1L2Aldehyde dehydrogenase 1 family, member L2NP_705771(K)AGFSVFWADDGLDTGPILLQR(S)   peptide count: 4
A1675FBLN1, PP213Fibulin-1 precursorNP_034310(K)AGFYFDGISR(T)   peptide count: 2
A0288SYNGR1Synaptogyrin 1NP_033329(K)AGGAFDPYTLVR(Q)   peptide count: 7
A0288SYNGR1Synaptogyrin 1NP_997591(K)AGGAFDPYTLVR(Q)   peptide count: 7
A4725COTL1, CLPCoactosin-like proteinNP_082347(K)AGGANYDAQSE(-)   peptide count: 1
A5683APEH, D3F15S2, D3S48EAcylamino-acid-releasing enzymeNP_666338(K)AGGAVSGEEK(Q)   peptide count: 1
A610CTIMM22, TEX4, TIM22Mitochondrial import inner membrane translocase subunit TIM22NP_062792(K)AGGSAPEAAGSAEAPLQYSLLLQYLVGDK(R)   peptide count: 19
A610CTIMM22, TEX4, TIM22Mitochondrial import inner membrane translocase subunit TIM22NP_062792(K)AGGSAPEAAGSAEAPLQYSLLLQYLVGDKR(Q)   peptide count: 9
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorNP_083299(K)AGHMVPSDQGEMALK(M)   peptide count: 13
A6543GAPDHS, GAPD2, GAPDH2Glyceraldehyde 3-phosphate dehydrogenase, testis-specificNP_032111(K)AGIALNDNFVK(L)   peptide count: 2
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)AGIFQSAK(-)   peptide count: 130
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)AGIFQSAK(-)   peptide count: 130
A3804EEF2, EF2Elongation factor 2NP_031933(K)AGIIASAR(A)   peptide count: 8
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorNP_659033(K)AGIPKEEVK(E)   peptide count: 39
A8048TXNRD2, TRXR2Thioredoxin reductase 2, mitochondrial precursorNP_038739(K)AGISTNPK(N)   peptide count: 6
A0419GSNGelsolin precursor, plasmaNP_666232(K)AGKEPGLQIWR(V)   peptide count: 1
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2NP_056644(K)AGKGEVTFEDVK(Q)   peptide count: 8
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_484535(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_898195(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905670(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905673(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905675(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905678(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905681(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905688(K)AGKLSENPSENKK(G)   peptide count: 1
A705CVPS8Vacuolar protein sorting-associated protein 8 homologXP_905691(K)AGKLSENPSENKK(G)   peptide count: 1
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorNP_082664(K)AGKVPKPGPR(S)   peptide count: 4
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)AGKYEQAIQCYTEAISLCPTEK(N)   peptide count: 2
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)AGLEQGSDAGYLAESQK(F)   peptide count: 122
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1NP_081682(K)AGLILFGNDDR(M)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)AGLLGLLEEMR(D)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)AGLLGLLEEMR(D)   peptide count: 1
A3198MYH8Myosin-8NP_796343(K)AGLLGLLEEMR(D)   peptide count: 1
A3200MYH13Myosin-13XP_618893(K)AGLLGLLEEMR(D)   peptide count: 1
A3201MYH6, MYHCA, alpha-MHCMyosin-6NP_034986(K)AGLLGLLEEMR(D)   peptide count: 1
A3202MYH7, MYHCBMyosin-7NP_542766(K)AGLLGLLEEMR(D)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)AGLLGLLEEMRDDK(L)   peptide count: 2
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)AGLLGLLEEMRDDK(L)   peptide count: 2
A4402TIMM9, TIM9, TIM9AMitochondrial import inner membrane translocase subunit TIM9 ANP_001020024(K)AGLLGQPR(-)   peptide count: 20
A4402TIMM9, TIM9, TIM9AMitochondrial import inner membrane translocase subunit TIM9 ANP_001020025(K)AGLLGQPR(-)   peptide count: 20
A4402TIMM9, TIM9, TIM9AMitochondrial import inner membrane translocase subunit TIM9 ANP_038924(K)AGLLGQPR(-)   peptide count: 20
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AGLLGTLEEMR(D)   peptide count: 4
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)AGLLGTLEEMR(D)   peptide count: 4
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AGLLGTLEEMRDEK(L)   peptide count: 5
A5738FDXR, ADXRNADPH:adrenodoxin oxidoreductase, mitochondrial precursorNP_032023(K)AGLLPSGPRPGYVAIQALLSNR(G)   peptide count: 5
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)AGLLQR(A)   peptide count: 2
A7412PLB1, PLBPhospholipase B1, membrane-associatedXP_984475(K)AGLNVAEEGAR(A)   peptide count: 1
A7412PLB1, PLBPhospholipase B1, membrane-associatedXP_984514(K)AGLNVAEEGAR(A)   peptide count: 1
A7412PLB1, PLBPhospholipase B1, membrane-associatedXP_984553(K)AGLNVAEEGAR(A)   peptide count: 1
A6042CPCeruloplasmin precursorNP_001036076(K)AGLQAFFQVR(D)   peptide count: 2
A6042CPCeruloplasmin precursorNP_031778(K)AGLQAFFQVR(D)   peptide count: 2
A7304PARP4, ADPRTL1, PARPLPoly [ADP]-ribose polymerase 4XP_999380(K)AGLQDASANPVPLDSVHIK(G)   peptide count: 1
A4759DNAH1, DHC7, DNAHC1Dynein heavy chain 1, axonemalXP_982687(K)AGLQNLPITFLFSDTQIK(N)   peptide count: 2
A7979ACAA2Acetyl-CoA acyltransferase 2NP_803421(K)AGLSLKDMDLIDVNEAFAPQFLSVQK(A)   peptide count: 11
A994BSLC37A4, G6PT, G6PT1Solute carrier family 37 (glucose-6-phosphate transporter), memberNP_032089(K)AGLSLYGNPR(H)   peptide count: 1
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AGLTMNDIDAFEFHEAFSGQILANFK(A)   peptide count: 50
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AGLTMNDIDAFEFHEAFSGQILANFK(A)   peptide count: 50
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alphaNP_001001983(K)AGLTVDPVIVEAFLASLSNR(L)   peptide count: 5
A3584FASN, FASFatty acid synthaseNP_032014(K)AGLYGLPK(R)   peptide count: 1
A039BSPATA24Spermatogenesis-associated protein 24NP_082009(K)AGLYPNFCPR(L)   peptide count: 1
A7455POLK, DINB1DNA polymerase kappaNP_036178(K)AGMEGLDKEKINKIIMEATK(G)   peptide count: 1
A5632AADAT, KAT2L-kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursorNP_035964(K)AGMFLWIK(V)   peptide count: 4
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialNP_083831(K)AGMSTAQAQHFLEK(I)   peptide count: 37
A9559RPL3, rpl3, ASC-160S ribosomal protein L3NP_038790(K)AGMTHIVR(E)   peptide count: 1
A9559RPL3, rpl3, ASC-160S ribosomal protein L3XP_485430(K)AGMTHIVR(E)   peptide count: 1
A9559RPL3, rpl3, ASC-160S ribosomal protein L3XP_620346(K)AGMTHIVR(E)   peptide count: 1
A9559RPL3, rpl3, ASC-160S ribosomal protein L3XP_986664(K)AGMTHIVR(E)   peptide count: 1
A9559RPL3, rpl3, ASC-160S ribosomal protein L3XP_986703(K)AGMTHIVR(E)   peptide count: 1
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7NP_035421(K)AGNFYVPAEPK(L)   peptide count: 1
A9548RPL22, RPL22L260S ribosomal protein L22NP_033105(K)AGNLGGGVVTIER(S)   peptide count: 8
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 2NP_062732(K)AGNMSR(G)   peptide count: 1
A7889STK10, LOKSerine/threonine protein kinase 10NP_033314(K)AGNVLMTLEGDIR(L)   peptide count: 1
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_666301(K)AGPAENVMVK(E)   peptide count: 1
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_835168(K)AGPAENVMVK(E)   peptide count: 1
A0374NEFH, NFHNeurofilament heavy polypeptideNP_035034(K)AGPGGTR(S)   peptide count: 1
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorNP_031773(K)AGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV(-)   peptide count: 3
A8188GGCX, GCVitamin K-dependent gamma-carboxylaseNP_062776(K)AGPKPGLR(H)   peptide count: 3
A5926BHMTBetaine-homocysteine S-methyltransferase 1NP_057877(K)AGPWTPEAAVEHPEAVR(Q)   peptide count: 4
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_001003312(K)AGQAVDDFIEK(L)   peptide count: 1
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_622094(K)AGQAVDDFIEK(L)   peptide count: 1
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_907336(K)AGQAVDDFIEK(L)   peptide count: 1
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_907338(K)AGQAVDDFIEK(L)   peptide count: 1
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorNP_848492(K)AGQENISVSK(R)   peptide count: 2
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorNP_848492(K)AGQENISVSKR(D)   peptide count: 1
A4033DMXL2, RC3DmX-like protein 2XP_358382(K)AGQEQSASDPR(A)   peptide count: 1
A0300GRIA4, GLUR4, GluR4cGlutamate receptor 4 precursorNP_062665(K)AGQNGWHVSAICVENFNDVSYR(Q)   peptide count: 1
A7091MUTMethylmalonyl-CoA mutase, mitochondrialNP_032676(K)AGQQGLSVAFDLATHR(G)   peptide count: 25
A3502AAK1AP2 associated kinase 1NP_001035195(K)AGQTQPNPGILPIQPALTPR(K)   peptide count: 1
A3502AAK1AP2 associated kinase 1NP_808430(K)AGQTQPNPGILPIQPALTPR(K)   peptide count: 1
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)AGQYTDK(G)   peptide count: 1
A723CSLC30A1, ZNT1Zinc transporter 1NP_033605(K)AGRAGVEAGAPPGR(A)   peptide count: 5
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6NP_035420(K)AGSDAAASRPR(A)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_890389(K)AGSDAAASRPR(A)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_899749(K)AGSDAAASRPR(A)   peptide count: 1
A1062MRVI1, IRAG, JAW1LJAW1-related protein MRVI1NP_034956(K)AGSKAELR(S)   peptide count: 1
A1062MRVI1, IRAG, JAW1LJAW1-related protein MRVI1NP_919446(K)AGSKAELR(S)   peptide count: 1
A3960MYO6Unconventional myosin-VINP_001034635(K)AGSLKDPLLDDHGDFIR(M)   peptide count: 2
A017F1700027F06RikPREDICTED: hypothetical protein LOC72268XP_994674(K)AGSLVCELK(T)   peptide count: 1
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialNP_080175(K)AGSRYEDSNNLGTSHLLR(L)   peptide count: 14
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialNP_080175(K)AGSRYEDSNNLGTSHLLR(L)   peptide count: 2
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorNP_084363(K)AGSSKPEASRPLTTGAPK(I)   peptide count: 51
A4247TMEM14C, HSPC194, MSTP073Transmembrane protein 14CNP_079663(K)AGSVPSLAAGLFFGGLAGLGAYQLSQDPR(N)   peptide count: 39
A7159NIT2, CUA002Omega-amidase NIT2NP_075664(K)AGTEETILYSDIDLKK(L)   peptide count: 3
A0007ACTN2Alpha-actinin 2NP_150371(K)AGTQIENIEEDFR(N)   peptide count: 1
A2341ACTN1Alpha-actinin 1NP_598917(K)AGTQIENIEEDFR(N)   peptide count: 1
A2343ACTN3Alpha-actinin 3NP_038484(K)AGTQIENIEEDFR(N)   peptide count: 1
A1490ITGAV, MSK8, VNRAIntegrin alpha-V precursorNP_032428(K)AGTQLLAGLR(F)   peptide count: 1
A0474ITGA5, FNRAIntegrin alpha-5 precursorNP_034707(K)AGTSLWGGLR(F)   peptide count: 1
A6759HUWE1, UREB1, HSPC272E3 ubiquitin-protein ligase HUWE1NP_067498(K)AGTTQGGKR(S)   peptide count: 1
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)AGTVSMYTK(T)   peptide count: 2
A0168PRKCB1, PRKCB, PKCBProtein kinase C, beta typeNP_032881(K)AGVDGWFK(L)   peptide count: 1
A4814FLNB, FLN3, TAPFilamin-BXP_995248(K)AGVENGKPTHFTVHTK(G)   peptide count: 2
A7550PTPMT1, MOSP, PLIPProtein-tyrosine phosphatase mitochondrial 1 precursorNP_079852(K)AGVEQLR(L)   peptide count: 24
A6311HSD17B8, FABGL, HKE6Estradiol 17 beta-dehydrogenase 8NP_038571(K)AGVIGLTQTAAR(E)   peptide count: 22
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorNP_032159(K)AGVKINPK(N)   peptide count: 1
A6903LIPT2Putative Octanoyltransferase, mitochondrialNP_080286(K)AGVLLVCEPAGPVYTGGLR(G)   peptide count: 6
A8216ZADH2Zinc-binding alcohol dehydrogenase domain-containing protein 2NP_666202(K)AGVLPTK(L)   peptide count: 3
A6713CPOX, CPO, CPXCoproporphyrinogen III oxidase, mitochondrial precursorNP_031783(K)AGVSISVVHGNLSEEAANQMR(G)   peptide count: 8
A492BEIG121, UNQ2426/PRO4985, MABA1UPF0577 protein KIAA1324NP_001028476(K)AGVSSQPVSLADR(L)   peptide count: 2
A6206CPT2, CPT1Carnitine O-palmitoyltransferase II, mitochondrial precursorNP_034079(K)AGVTAAK(E)   peptide count: 3
A7766SLC27A1, ACSVL5, FATP1Long-chain fatty acid transport protein 1NP_036107(K)AGVVAALLNVNLR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_035247(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AGVVGPELHEK(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AGVVGPELHEK(L)   peptide count: 1
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AGVVSPVDFLQHQSWGGIK(A)   peptide count: 4
A5920BCAT2, BCATM, BCT2Branched-chain amino acid aminotransferase, mitochondrial precursorNP_033867(K)AGWGPPR(I)   peptide count: 4
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorNP_080237(K)AGWTIVTPPTPVIPDDHPLWMSSK(W)   peptide count: 9
A8653ALS2, ALS2CR6AlsinNP_082993(K)AGYGVFDDITRGEK(Y)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AGYPQYVSEILEK(I)   peptide count: 18
A3615ENO1, ENO1L1, MBPB1Alpha enolaseNP_075608(K)AGYTDQVVIGMDVAASEFYR(S)   peptide count: 1
A3615ENO1, ENO1L1, MBPB1Alpha enolaseNP_001020559(K)AGYTDQVVIGMDVAASEFYR(S)   peptide count: 1
A0024SYNGAP1Ras GTPase-activating protein SynGAPXP_990642(K)AGYVGLVTVPVATLAGR(H)   peptide count: 1
A1222RPL5, MSTP03060S ribosomal protein L5NP_058676(K)AHAAIR(E)   peptide count: 2
A1222RPL5, MSTP03060S ribosomal protein L5XP_981783(K)AHAAIR(E)   peptide count: 2
A1222RPL5, MSTP03060S ribosomal protein L5XP_001004898(K)AHAAIR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_035247(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958787(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958788(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958789(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958790(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958791(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958792(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958793(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958794(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958795(K)AHAFVVQQR(E)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958796(K)AHAFVVQQR(E)   peptide count: 2
A0042GNAQ, GAQGuanine nucleotide-binding protein G(q), alpha subunitNP_032165(K)AHAQLVR(E)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AHATGAGPAGR(Y)   peptide count: 4
A953BENY2, DC6Enhancer of Yellow 2 transcription factor homologNP_778174(K)AHCKEVIKEK(G)   peptide count: 1
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AHCLSEVEHDTMPADLPAIAADFVEDQEVCK(N)   peptide count: 4
A5680ACOX2, BRCOXAcyl-coenzyme A oxidase 2, peroxisomalNP_444345(K)AHCYFLTVR(N)   peptide count: 2
A0862TRAF3, CAP1, CRAF1TNF receptor associated factor 3NP_001041671(K)AHEASSAVQHVNLLKEWSNSLEKK(V)   peptide count: 1
A0862TRAF3, CAP1, CRAF1TNF receptor associated factor 3NP_035762(K)AHEASSAVQHVNLLKEWSNSLEKK(V)   peptide count: 1
A651BTMEM160Transmembrane protein 160NP_081214(K)AHETAFLSWFR(N)   peptide count: 1
A6097COX1, CO1, COICytochrome c oxidase subunit 1NP_904330(K)AHFAIMFVGVNMTFFPQHFLGLSGMPR(R)   peptide count: 6
A2481ARSAArylsulfatase A precursorNP_033843(K)AHFFTQGSAHSDTTSDPACHAANR(L)   peptide count: 3
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorNP_058054(K)AHGGYSVFAGVGER(T)   peptide count: 173
A4814FLNB, FLN3, TAPFilamin-BXP_995248(K)AHGPGLEGGLVGKPAEFTIDTK(G)   peptide count: 1
A4814FLNB, FLN3, TAPFilamin-BXP_995308(K)AHGPGLEGGLVGKPAEFTIDTK(G)   peptide count: 1
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)AHIEKR(I)   peptide count: 4
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)AHLEQR(I)   peptide count: 11
A5231TSGA10, CEP4LNucleoporin NYD-SP7NP_997111(K)AHLEQR(I)   peptide count: 1
A5231TSGA10, CEP4LNucleoporin NYD-SP7NP_997111(K)AHLEQR(I)   peptide count: 11
A9640RPS2340S ribosomal protein S23NP_077137(K)AHLGTALK(A)   peptide count: 8
A9640RPS2340S ribosomal protein S23XP_995532(K)AHLGTALK(A)   peptide count: 8
A0123PPP3CA, CALNA, CNACalcineurin subunit A alpha precursorNP_032939(K)AHLMK(E)   peptide count: 1
A6866KMOKynurenine 3-monooxygenaseNP_598570(K)AHLMK(E)   peptide count: 1
A2468ENPP3, PDNP3Ectonucleotide pyrophosphatase/phosphodiesterase 3NP_598766(K)AHLMVDR(Q)   peptide count: 1
A1521VWF, F8VWFVon Willebrand factor precursorNP_035838(K)AHLQSLVDLMQQEGGPSQIGDALAFAVR(Y)   peptide count: 1
A480DGLIPR2, GAPR1Golgi-associated plant pathogenesis-related protein 1NP_081726(K)AHNEYR(A)   peptide count: 1
A467DFMNL2, FHOD2Formin-like protein 2XP_906975(K)AHNVPLKLPMPEPGELEERFAIVLNAMNLPPDK(A)   peptide count: 2
A467DFMNL2, FHOD2Formin-like protein 2XP_906980(K)AHNVPLKLPMPEPGELEERFAIVLNAMNLPPDK(A)   peptide count: 2
A467DFMNL2, FHOD2Formin-like protein 2XP_906982(K)AHNVPLKLPMPEPGELEERFAIVLNAMNLPPDK(A)   peptide count: 2
A885BCLPB, HSP78, SKD3Suppressor of potassium transport defect 3NP_033217(K)AHPDVLTIMLQLFDEGR(L)   peptide count: 10
A6642GPX1Glutathione peroxidase 1NP_032186(K)AHPLFTFLR(N)   peptide count: 5
A545DHYDIN, HYDIN2, HYDIN1Hydrocephalus-inducing protein homologNP_766504(K)AHPLTLNVKAEGYTMNAEVKCR(D)   peptide count: 1
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2NP_035015(K)AHPNLPILIR(E)   peptide count: 39
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AHQANQLYPFAISLIESVR(T)   peptide count: 3
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)AHQDALPR(L)   peptide count: 12
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AHQLWLSVEALK(Y)   peptide count: 13
A492BEIG121, UNQ2426/PRO4985, MABA1UPF0577 protein KIAA1324NP_001028476(K)AHQPYGAQACVPCGPGTK(N)   peptide count: 1
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)AHQVTTR(N)   peptide count: 21
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AHSNILK(T)   peptide count: 145
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AHSNILKTAMDNSEIAGEK(K)   peptide count: 1
A9602MRPL30, MRPL28, RPML2839S ribosomal protein L30, mitochondrial precursorNP_081374(K)AHSPQIHK(N)   peptide count: 1
A9602MRPL30, MRPL28, RPML2839S ribosomal protein L30, mitochondrial precursorXP_892448(K)AHSPQIHK(N)   peptide count: 1
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)AHTMTDDVTFWK(W)   peptide count: 6
A6957MANBA, MANB1Beta-mannosidase precursorNP_081564(K)AHTSYR(V)   peptide count: 3
A6014HCCS, CCHLCytochrome c-type heme lyaseNP_032248(K)AHTVPAHQDR(A)   peptide count: 11
A7198ND4, NADH4, MT-ND4NADH-ubiquinone oxidoreductase chain 4NP_904337(K)AHVEAPIAGSMILAAILLK(L)   peptide count: 91
A8432ITIH2, IGHEP2Inter-alpha-trypsin inhibitor heavy chain H2 precursorNP_034712(K)AHVSFKPTVAQQR(K)   peptide count: 1
A0285BSN, ZNF231Bassoon proteinNP_031593(K)AHVSPQK(Q)   peptide count: 1
A1830 H-2 class I histocompatibility antigenNP_034520(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenNP_034524(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenNP_034528(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenNP_064293(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003817(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003826(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003837(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003842(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003847(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenXP_001003852(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenNP_997531(K)AHVTHHPR(S)   peptide count: 3
A1830 H-2 class I histocompatibility antigenNP_001030080(K)AHVTHHPR(S)   peptide count: 3
A1493FGBFibrinogen beta chain precursorNP_862897(K)AHYGGFTVQNEASK(Y)   peptide count: 2
A3469ATP4APotassium-transporting ATPase alpha chain 1NP_061201(K)AIAASVGIISEGSETVEDIAAR(L)   peptide count: 2
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicNP_032644(K)AIADHIR(D)   peptide count: 17
A337BTcr-alphaHypothetical proteinNP_941070(K)AIAEIK(K)   peptide count: 8
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorNP_075863(K)AIAEIK(K)   peptide count: 10
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorNP_075863(K)AIAEIK(K)   peptide count: 9
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorNP_083058(K)AIAEIK(K)   peptide count: 1
A337BTcr-alphaHypothetical proteinNP_941070(K)AIAEIKK(M)   peptide count: 12
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorNP_075863(K)AIAEIKK(M)   peptide count: 6
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorNP_075863(K)AIAEIKK(M)   peptide count: 12
A481DGATC, 15E1.2GATC-like proteinNP_083921(K)AIAFADQLHAVDTDGVEPLESVLEDR(C)   peptide count: 6
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1NP_035924(K)AIAGIINQPYYNYQAGPDAALGR(T)   peptide count: 2
A3542CCT8, CCTQT-complex protein 1, theta subunitNP_033970(K)AIAGTGANVIVTGGK(V)   peptide count: 1
A299DDNHD1, CCDC35, DHCD1Dynein heavy chain domain-containing protein 1XP_913886(K)AIAKENHK(A)   peptide count: 1
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1NP_659179(K)AIALLEQFASMTGIPEDIIPVAVEK(Y)   peptide count: 3
A3918VCPTransitional endoplasmic reticulum ATPaseNP_033529(K)AIANECQANFISIK(G)   peptide count: 2
A1562GPIa, ITGA2, CD49BIntegrin alpha-2 precursorNP_032422(K)AIASTPTER(Y)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AIAVTVQEMVTK(S)   peptide count: 3
A7913DARS2Aspartyl-tRNA synthetase, mitochondrial precursorNP_766232(K)AICVHDGAK(Y)   peptide count: 5
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13NP_598487(K)AIDLFTDAIK(L)   peptide count: 1
A0445RTN1, NSPReticulon 1NP_703187(K)AIDLLYWR(D)   peptide count: 2
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)AIDMFNK(A)   peptide count: 25
A6614GLYAT, ACGNAT, CATGlycine N-acyltransferaseNP_666047(K)AIDQDKFK(L)   peptide count: 29
A4430CACNA1S, CACH1, CACN1Voltage-dependent L-type calcium channel alpha-1S subunitXP_001002706(K)AIDSNEEDTGPVYNNR(V)   peptide count: 1
A4425CACNA1D, CACH3, CACN4Voltage-dependent L-type calcium channel alpha-1D subunitNP_083257(K)AIDSNGENVGPVYNYR(V)   peptide count: 2
A4425CACNA1D, CACH3, CACN4Voltage-dependent L-type calcium channel alpha-1D subunitNP_083257(K)AIDSNGENVGPVYNYR(V)   peptide count: 2
A5360IFT172, SLBIntraflagellar transport protein 172 homologNP_080574(K)AIEAALGAR(Q)   peptide count: 1
A6775IDEInsulin-degrading enzymeNP_112419(K)AIEDMTEEAFQK(H)   peptide count: 2
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)AIEIDNK(C)   peptide count: 18
A4760DNAH10Dynein heavy chain 10, axonemalXP_983660(K)AIEIEEQNK(I)   peptide count: 1
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1NP_034438(K)AIEKNLK(E)   peptide count: 2
A5112RMDN1, FAM82B, CGI-90Regulator of microtubule dynamics protein 1NP_079752(K)AIELNPK(D)   peptide count: 1
A3511RMDN3, FAM82A2, FAM82CRegulator of microtubule dynamics protein 3NP_001028308(K)AIELQPEDPR(G)   peptide count: 4
A0691AP1S1, AP19, CLAPS1Adapter-related protein complex 1 sigma 1A subunitNP_031483(K)AIEQADLLQEEDESPR(S)   peptide count: 2
A566CSTX1B, STX1B1, STX1B2Syntaxin 1BNP_077725(K)AIEQSIEQEEGLNR(S)   peptide count: 6
A167CMYO10Unconventionnal myosin-XNP_062345(K)AIESRTIVADVLAK(F)   peptide count: 2
A815CARMC4Armadillo repeat-containing protein 4XP_980630(K)AIETLVGLLTDQPEEVLVNVVGALGECCQEYENR(V)   peptide count: 6
A815CARMC4Armadillo repeat-containing protein 4XP_980682(K)AIETLVGLLTDQPEEVLVNVVGALGECCQEYENR(V)   peptide count: 6
A0492STIP1Stress-induced-phosphoprotein 1NP_058017(K)AIEVGR(E)   peptide count: 2
A9566RPL35A, GIG3360S ribosomal protein L35aNP_067313(K)AIFAGYK(R)   peptide count: 5
A9566RPL35A, GIG3360S ribosomal protein L35aXP_620305(K)AIFAGYK(R)   peptide count: 5
A1324AP3D1, PRO0039Adapter-related protein complex 3 delta 1 subunitNP_031486(K)AIFHEEEPR(H)   peptide count: 2
A995BGABARAPL2, FLC3A, GEF2Ganglioside expression factor 2NP_080969(K)AIFLFVDK(T)   peptide count: 3
A5995CPA3Mast cell carboxypeptidase ANP_031779(K)AIFMDCGIHAR(E)   peptide count: 1
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_001003312(K)AIFQAIAAK(V)   peptide count: 2
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingXP_622094(K)AIFQAIAAK(V)   peptide count: 2
A6325DHX30, DDX30, MLAA-43Putative ATP-dependent RNA helicase DHX30NP_579925(K)AIFQQPPLGVR(K)   peptide count: 1
A8962PVALBParvalbuminNP_038673(K)AIGAFAAADSFDHK(K)   peptide count: 3
A8962PVALBParvalbuminNP_038673(K)AIGAFAAADSFDHKK(F)   peptide count: 7
A834C2410018M08RikSCAN domain containing 3NP_898911(K)AIGAHCMLHLQTLAMK(T)   peptide count: 1
A3214LUZP1Leucine zipper protein 1NP_077772(K)AIGALSSSQKASSEGLSK(G)   peptide count: 1
A5984CTSD, CPSDCathepsin D precursorNP_034113(K)AIGAVPLIQGEYMIPCEK(V)   peptide count: 43
A3784EXOG, ENDOGL1, ENDOGL2Nuclease EXOG, mitochondrialNP_766044(K)AIGFQSQLSEFQVSLHDLEK(M)   peptide count: 2
A1530MRC1L1, CLEC13DL, MRC1Macrophage mannose receptor 1-like protein 1NP_032651(K)AIGGELASIK(S)   peptide count: 1
A7111NAPSA, NAP1, NAPANapsin 1 precursorNP_032463(K)AIGGYPFLNGQYFIQCSK(T)   peptide count: 4
A3516SEPT3, SEP3Neuronal-specific septin-3NP_036019(K)AIGHVIEEGGVK(M)   peptide count: 2
A631AKif4Chromosome-associated kinesin KIF4NP_032472(K)AIGKKKK(R)   peptide count: 1
A0964ASB1Ankyrin repeat and SOCS box containing protein 1NP_001034215(K)AIGKYR(I)   peptide count: 3
A0964ASB1Ankyrin repeat and SOCS box containing protein 1NP_075533(K)AIGKYR(I)   peptide count: 3
A8678ASB2Ankyrin repeat and SOCS box containing protein 2NP_075536(K)AIGKYR(I)   peptide count: 3
A6866KMOKynurenine 3-monooxygenaseNP_598570(K)AIGLEDQIVSK(G)   peptide count: 2
A979BFABP1, FABPLFatty acid-binding protein, liverNP_059095(K)AIGLPEDLIQK(G)   peptide count: 4
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)AIGNALK(S)   peptide count: 6
A0387ATP5H, My032ATP synthase D chain, mitochondrialXP_136323(K)AIGNALK(S)   peptide count: 6
A0387ATP5H, My032ATP synthase D chain, mitochondrialXP_891471(K)AIGNALK(S)   peptide count: 6
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)AIGNALKSWNETFHAR(L)   peptide count: 1
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)AIGNALKSWNETFHARLASLSEKPPAIDWAYYR(A)   peptide count: 1
A1164IPO5, KPNB3, RANBP5Importin 5NP_076068(K)AIGTEPDSDVLSEIMHSFAK(C)   peptide count: 3
A3918VCPTransitional endoplasmic reticulum ATPaseNP_033529(K)AIGVKPPR(G)   peptide count: 6
A1925PFKLPhosphofructokinase, liverNP_032852(K)AIGVLTSGGDAQGMNAAVR(A)   peptide count: 3
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type CNP_062677(K)AIGVLTSGGDAQGMNAAVR(A)   peptide count: 3
A6605GKGlycerol kinaseNP_032220(K)AIGVSNQR(E)   peptide count: 8
A6605GKGlycerol kinaseNP_997609(K)AIGVSNQR(E)   peptide count: 8
A6606GK2, GKP2, GKTAGlycerol kinase, testis specific 2NP_034424(K)AIGVSNQR(E)   peptide count: 8
A7601Gykl1Glycerol kinase-like 1NP_034423(K)AIGVTNQR(E)   peptide count: 4
A3957MTX2Metaxin 2NP_058084(K)AIGWGNK(T)   peptide count: 14
A5303Catsperg2Cation channel sperm-associated protein subunit gamma 2NP_001034810(K)AIHAVDVPK(K)   peptide count: 13
A999E PREDICTED: similar to Ankyrin repeat domain-containing protein 26XP_918883(K)AIHELK(E)   peptide count: 1
A6552ABAT, GABAT4-aminobutyrate aminotransferase, mitochondrial precursorNP_766549(K)AIHKIDIPSFDWPIAPFPR(L)   peptide count: 3
A9581MRPL1, BM-022, BM02239S ribosomal protein L1, mitochondrialNP_001034173(K)AIHLLK(K)   peptide count: 2
A9581MRPL1, BM-022, BM02239S ribosomal protein L1, mitochondrialNP_444388(K)AIHLLK(K)   peptide count: 2
A302BZZEF1Zinc finger ZZ-type and EF-hand domain-containing protein 1XP_111053(K)AIHLLLR(I)   peptide count: 1
A302BZZEF1Zinc finger ZZ-type and EF-hand domain-containing protein 1NP_001039001(K)AIHLLLR(I)   peptide count: 1
A4295DNAJC13, RME8DnaJ homolog subfamily C member 13XP_135146(K)AIIEEGDREIATK(M)   peptide count: 1
A6003CPDCarboxypeptidase D precursorNP_031780(K)AIIENLIQK(Q)   peptide count: 2
A9653RPS740S ribosomal protein S7NP_035430(K)AIIIFVPVPQLK(S)   peptide count: 9
A9653RPS740S ribosomal protein S7XP_894928(K)AIIIFVPVPQLK(S)   peptide count: 9
A6829CCBL2, KAT3, RBMXL1Kynurenine--oxoglutarate transaminase 3NP_776124(K)AIILNTPHNPLGK(V)   peptide count: 4
A4769DNAH7Dynein heavy chain 7, axonemalXP_910605(K)AIKDECDADLAEALPILESALAALDTLTAQDITVVK(S)   peptide count: 2
A4769DNAH7Dynein heavy chain 7, axonemalXP_897673(K)AIKDECDADLAGALPILESALAALDTLTAQDITVVK(S)   peptide count: 1
A9320GPR116G-protein coupled receptor 116 precursorXP_001003985(K)AILAQDVQR(K)   peptide count: 1
A9320GPR116G-protein coupled receptor 116 precursorXP_283438(K)AILAQDVQR(K)   peptide count: 1
A7191NT5M, DNT25'(3')-deoxyribonucleotidase, mitochondrial precursorNP_598790(K)AILDSK(R)   peptide count: 1
A7191NT5M, DNT25'(3')-deoxyribonucleotidase, mitochondrial precursorNP_598790(K)AILDSKR(L)   peptide count: 1
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AILENVLAK(L)   peptide count: 4
A9907FGF1, FGFAHeparin-binding growth factor 1 precursorNP_034327(K)AILFLPLPVSSD(-)   peptide count: 3
A6751HTATIP2, CC3, TIP30Oxidoreductase HTATIP2NP_058561(K)AILHLGK(D)   peptide count: 3
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorNP_780386(K)AILITGCDSGFGFSLAK(H)   peptide count: 24
A1950GSTA3Glutathione S-transferase A3-3NP_001070821(K)AILNYIASK(Y)   peptide count: 1
A1950GSTA3Glutathione S-transferase A3-3NP_034486(K)AILNYIASK(Y)   peptide count: 1
A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrialNP_473435(K)AILPFDLQIIDEK(G)   peptide count: 5
A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrialNP_473435(K)AILPFDLQIIDEKGNILPPNTEGYIGIR(I)   peptide count: 1
A7601Gykl1Glycerol kinase-like 1NP_034423(K)AILQSVYECIEK(A)   peptide count: 7
A924CCARKDATP-dependent (S)-NAD(P)H-hydrate dehydrataseNP_081271(K)AILTPNHVEFSR(L)   peptide count: 12
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorNP_034404(K)AIMNLDVEQYR(M)   peptide count: 34
A766BABCA3, ABCA3 variant protein, ABC3ATP-binding cassette, sub-family A, member 3NP_001034670(K)AIMRYHANTSAQQLFQKLMVITK(R)   peptide count: 1
A766BABCA3, ABCA3 variant protein, ABC3ATP-binding cassette, sub-family A, member 3NP_038883(K)AIMRYHANTSAQQLFQKLMVITK(R)   peptide count: 1
A2341ACTN1Alpha-actinin 1NP_598917(K)AIMTYVSSFYHAFSGAQK(A)   peptide count: 2
A2344ACTN4Alpha-actinin 4NP_068695(K)AIMTYVSSFYHAFSGAQK(A)   peptide count: 2
A453DFAM25A, FAM25Protein FAM25ANP_899101(K)AINDALKK(A)   peptide count: 1
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)AINLAK(S)   peptide count: 13
A7522PSMA6, PROS27Proteasome subunit alpha type 6NP_036098(K)AINQGGLTSVAVR(G)   peptide count: 4
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1NP_058661(K)AINQIAAALFTIHK(G)   peptide count: 2
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AINTAVK(S)   peptide count: 1
A2524PABPC1L, PABPL1Poly(A)-binding protein, cytoplasmic 1XP_001005006(K)AINTMNGMLLNDRK(V)   peptide count: 2
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainNP_001070022(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993410(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993705(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993740(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993773(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993811(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993853(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993888(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993920(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993959(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994000(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994029(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994106(K)AINVQEEK(I)   peptide count: 3
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994149(K)AINVQEEK(I)   peptide count: 3
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorNP_031402(K)AINYLISGYQR(Q)   peptide count: 4
A0591CPLX2Complexin 2NP_034076(K)AIPAGCGDEEEEEEESILDTVLK(Y)   peptide count: 4
A495DGKN2, BLOT, GDDRGastrokine-2 precursorNP_079743(K)AIPALDK(L)   peptide count: 6
A0098VCLVinculinNP_033528(K)AIPDLTAPVAAVQAAVSNLVR(V)   peptide count: 17
A6652GzmcGranzyme CNP_034501(K)AIPHPDYNPDDR(S)   peptide count: 2
A1815MTP, MTTPMicrosomal triglyceride transfer protein, large subunit precursorNP_032668(K)AIPIVGQVLER(V)   peptide count: 3
A0911FRAP1, MTOR, FRAPSerine/threonine protein kinase MTORNP_064393(K)AIQIDTWLQVIPQLIAR(I)   peptide count: 1
A4759DNAH1, DHC7, DNAHC1Dynein heavy chain 1, axonemalXP_982687(K)AIQPYIDNEEFQPAAIAK(V)   peptide count: 1
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AIQTELNMNPPDCK(T)   peptide count: 1
A9616MRPL46, LIECG239S ribosomal protein L46, mitochondrialNP_075820(K)AIQTESDLGVK(V)   peptide count: 9
A5920BCAT2, BCATM, BCT2Branched-chain amino acid aminotransferase, mitochondrial precursorNP_033867(K)AIQYGASAHDWMFR(V)   peptide count: 17
A5920BCAT2, BCATM, BCT2Branched-chain amino acid aminotransferase, mitochondrial precursorNP_033867(K)AIQYGASAHDWMFRV(-)   peptide count: 2
A4283NDUFAF1, CIA30, CGI-65Complex I intermediate-associated protein 30, mitochondrial precursorNP_081451(K)AIRDEAIEHFR(R)   peptide count: 12
A4283NDUFAF1, CIA30, CGI-65Complex I intermediate-associated protein 30, mitochondrial precursorNP_081451(K)AIRDEAIEHFRR(L)   peptide count: 2
A955AMRRFRibosome recycling factor, mitochondrial precursorXP_896880(K)AIRGSRMNLNPEVEGTLIR(V)   peptide count: 1
A5222TPM2, TMSB, TPM2bTropomyosin beta chainNP_033442(K)AISEELDNALNDITSL(-)   peptide count: 1
A7051MMSADHA, ALDH6A1, MMSDHMethylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial precursorNP_598803(K)AISFVGSNQAGEYIFER(G)   peptide count: 86
A367DFAM166A, HSD46UPF0605 protein FAM166ANP_080900(K)AISGYAGFVPR(F)   peptide count: 1
A6175Cyp3a11Cytochrome P450 3A11NP_031844(K)AISISKDDEWKR(Y)   peptide count: 1
A7191NT5M, DNT25'(3')-deoxyribonucleotidase, mitochondrial precursorNP_598790(K)AISIWESK(D)   peptide count: 2
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AISKDHLYGTLDPNTR(E)   peptide count: 1
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)AISPDKDNFHFEVK(D)   peptide count: 8
A612ChTIM44, TIMM44, MIMT44Import inner membrane translocase subunit TIM44, mitochondrial precursorNP_035722(K)AISQGVESVK(K)   peptide count: 2
A612ChTIM44, TIMM44, MIMT44Import inner membrane translocase subunit TIM44, mitochondrial precursorNP_035722(K)AISQGVESVKK(E)   peptide count: 17
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteNP_038703(K)AITAATLQFAEGK(G)   peptide count: 1
A3783ENDOGEndonuclease G, mitochondrialNP_031957(K)AITAGSK(-)   peptide count: 1
A7013MFN1, hfzo2, FZOMitofusin-1NP_077162(K)AITAIFGQLLEFVTEGSHFVEATYR(N)   peptide count: 16
A4767DNAH5, DNAHC5, HL1Ciliary dynein heavy chain 5NP_579943(K)AITAPQMFGR(L)   peptide count: 2
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AITAPQMFGR(L)   peptide count: 2
A9213OR6X1Olfactory receptor 6X1NP_666826(K)AITCANR(H)   peptide count: 15
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AITDAAMMAEELK(K)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)AITDAAMMAEELK(K)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)AITDAAMMAEELK(K)   peptide count: 1
A3198MYH8Myosin-8NP_796343(K)AITDAAMMAEELK(K)   peptide count: 1
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)AITDAAMMAEELK(K)   peptide count: 1
A3200MYH13Myosin-13XP_618893(K)AITDAAMMAEELK(K)   peptide count: 1
A3201MYH6, MYHCA, alpha-MHCMyosin-6NP_034986(K)AITDAAMMAEELK(K)   peptide count: 1
A3202MYH7, MYHCBMyosin-7NP_542766(K)AITDAAMMAEELK(K)   peptide count: 1
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)AITDAAMMAEELKK(E)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)AITDAAMMAEELKK(E)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)AITDAAMMAEELKK(E)   peptide count: 5
A3198MYH8Myosin-8NP_796343(K)AITDAAMMAEELKK(E)   peptide count: 5
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)AITDAAMMAEELKK(E)   peptide count: 5
A3200MYH13Myosin-13XP_618893(K)AITDAAMMAEELKK(E)   peptide count: 5
A3201MYH6, MYHCA, alpha-MHCMyosin-6NP_034986(K)AITDAAMMAEELKK(E)   peptide count: 5
A3202MYH7, MYHCBMyosin-7NP_542766(K)AITDAAMMAEELKK(E)   peptide count: 5
A4766DNAH3, DNAHC3BDynein heavy chain 3, axonemalXP_355934(K)AITMGQLYGCFDAVSHEWTDGVLANAFR(E)   peptide count: 1
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursorNP_942602(K)AITTSLTTK(W)   peptide count: 1
A0685DNAJC6Putative tyrosine-protein phosphatase auxilinNP_940804(K)AITVSPVPFFNK(Q)   peptide count: 5
A8380A2mpAlpha-2-macroglobulin-PNP_783327(K)AITYLNTGYQR(Q)   peptide count: 2
A7566CADCarbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotaseNP_076014(K)AIVHAVGQELQVTGPFNLQLIAK(D)   peptide count: 1
A6325DHX30, DDX30, MLAA-43Putative ATP-dependent RNA helicase DHX30NP_579925(K)AIVLAAIFR(C)   peptide count: 3
A6887LDHC, LDH3, LDHXL-lactate dehydrogenase C chainNP_038608(K)AIVPGIVQNSPDCK(I)   peptide count: 5
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorNP_780647(K)AIVQEATR(M)   peptide count: 71
A1941PLEC1, PLECPlectinNP_035247(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AIVQLKPR(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AIVQLKPR(N)   peptide count: 1
A025E9930111J21RikNovel interferon-inducible GTPase (IIGP) family memberNP_775610(K)AIVQMNR(S)   peptide count: 1
A751CGm5431Novel interferon-inducible GTPase (IIGP) family memberNP_001019401(K)AIVQMNR(S)   peptide count: 1
A751CGm5431Novel interferon-inducible GTPase (IIGP) family memberXP_994157(K)AIVQMNR(S)   peptide count: 1
A908DGm12185Novel interferon-inducible GTPase (IIGP) family memberNP_001039005(K)AIVQMNR(S)   peptide count: 1
A6962ME1NADP-dependent malic enzymeNP_032641(K)AIVVTDGER(I)   peptide count: 4
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorNP_038699(K)AIWNVINWENVTER(Y)   peptide count: 126
A7357PEPD, PRDXaa-Pro dipeptidaseNP_032846(K)AIYEAVLR(S)   peptide count: 2
A3599ALDH1B1, ALDH5, ALDHXAldehyde dehydrogenase X, mitochondrialNP_082546(K)AIYFTQALQAGTVWVNTYNIVTCHTPFGGFK(E)   peptide count: 6
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1NP_058616(K)AIYHTLNLCNIDVTQK(C)   peptide count: 3
A7714DROSHA, RN3, RNASE3LRibonuclease 3NP_081075(K)AKAARPPWEPPKTK(L)   peptide count: 1
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2NP_075720(K)AKAEAIR(I)   peptide count: 4
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteNP_038703(K)AKAEQLSAAR(S)   peptide count: 1
A3696MDH2Malate dehydrogenase, mitochondrial precursorNP_032643(K)AKAGAGSATLSMAYAGAR(F)   peptide count: 2
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)AKCELSSSVQTDINLPYLTMDASGPK(H)   peptide count: 4
A9586MRPL11, CGI-11360S ribosomal protein L11, mitochondrial precursorNP_079829(K)AKDDAFAMQDVPLSSVVR(S)   peptide count: 6
A178CMYO7A, USH1BUnconventional myosin-VIIaNP_032689(K)AKDFCQNIASR(L)   peptide count: 1
A500DGNNTetratricopeptide repeat protein GNNNP_001003910(K)AKDFSWLPR(S)   peptide count: 1
A500DGNNTetratricopeptide repeat protein GNNNP_705823(K)AKDFSWLPR(S)   peptide count: 1
A1522ITGB5Integrin beta-5 precursorNP_034710(K)AKDGQICSDR(G)   peptide count: 2
A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrialNP_473435(K)AKDILYR(I)   peptide count: 9
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2NP_033852(K)AKDIVPGDIVEIAVGDKVPADIR(L)   peptide count: 3
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AKDLEYSLSLLNLPPLEECENR(L)   peptide count: 1
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaNP_080283(K)AKDPFAHLPK(S)   peptide count: 1
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaXP_139339(K)AKDPFAHLPK(S)   peptide count: 1
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaXP_484844(K)AKDPFAHLPK(S)   peptide count: 1
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaXP_902697(K)AKDPFAHLPK(S)   peptide count: 1
A359DFAM136APutative uncharacterized protein FAM136ANP_079867(K)AKDSMDAGTK(E)   peptide count: 1
A0149MYO5A, MYH12Unconventional myosin-VaNP_034994(K)AKEEERPQIR(G)   peptide count: 2
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainNP_033851(K)AKEEGSWK(K)   peptide count: 8
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainNP_033851(K)AKEEGSWKK(F)   peptide count: 1
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AKEELEK(M)   peptide count: 75
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AKEELEKMK(T)   peptide count: 2
A4524TMEM38ATrimeric intracellular cation channel type ANP_653117(K)AKEELGEGSR(K)   peptide count: 1
A0905SNCA, NACP, PARK1Alpha-synucleinNP_001035916(K)AKEGVVAAAEK(T)   peptide count: 5
A0905SNCA, NACP, PARK1Alpha-synucleinNP_033247(K)AKEGVVAAAEK(T)   peptide count: 5
A0905SNCA, NACP, PARK1Alpha-synucleinNP_001035916(K)AKEGVVAAAEKTK(Q)   peptide count: 1
A0905SNCA, NACP, PARK1Alpha-synucleinNP_033247(K)AKEGVVAAAEKTK(Q)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AKEIGFSDK(Q)   peptide count: 19
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformNP_031534(K)AKEILQEEEDLAEIVQLVGK(A)   peptide count: 8
A0132PPP2CASerine/threonine protein phosphatase 2A, catalytic subunit, alpha isoformNP_062284(K)AKELLTK(M)   peptide count: 1
A4338HSCB, RP3-366L4.2, DNAJC20Iron-sulfur cluster co-chaperone protein HSCB, mitochondrial precursorNP_705799(K)AKELLTK(M)   peptide count: 1
A0364RAB6A', RAB6B, RAB6ARas-related protein Rab-6ANP_077249(K)AKELNVMFIETSAKAGYNVK(Q)   peptide count: 2
A955AMRRFRibosome recycling factor, mitochondrial precursorNP_080698(K)AKENLR(K)   peptide count: 1
A955AMRRFRibosome recycling factor, mitochondrial precursorXP_896880(K)AKENLR(K)   peptide count: 1
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorNP_033821(K)AKEQLEIR(H)   peptide count: 1
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6NP_082770(K)AKEQLTIR(K)   peptide count: 1
A9002REEP5, DP1, TB2Receptor expression-enhancing protein 5NP_031900(K)AKETADAISK(E)   peptide count: 2
A533DHIGD1A, HIG1, HSPC010HIG1 domain family, member 1ANP_062788(K)AKETPFVPIGMAGFAAIVAYGLYK(L)   peptide count: 12
A0593CACNA1A, CACH4, CACN3Voltage-dependent P/Q-type calcium channel alpha-1A subunitNP_031604(K)AKEVAEVSPLSAANMSIAVKEQQK(N)   peptide count: 1
A7869ALDH5A1, SSADHSuccinate semialdehyde dehydrogenase, mitochondrial precursorNP_766120(K)AKEVGEVLCTDPLVSK(I)   peptide count: 3
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1NP_032328(K)AKFENLCK(L)   peptide count: 2
A946DSvs1Seminal vesicle secretory protein 1NP_766476(K)AKFPMPISK(G)   peptide count: 1
A3688CSCitrate synthase, mitochondrial precursorNP_080720(K)AKGGEEPLPEGLFWLLVTGQMPTEEQVSWLSR(E)   peptide count: 20
A5552MAGEB4, MAGEB1Melanoma-associated antigen B4XP_111935(K)AKGHSKAK(T)   peptide count: 2
A5005NEBNebulinXP_130232(K)AKGKHVGFR(S)   peptide count: 1
A6153Cyp2d9Cytochrome P450 2D9NP_034136(K)AKGNPESSFNDENLLMVVR(D)   peptide count: 2
A1042MYCBP2, PAM, HSPC026MYC binding protein 2NP_997098(K)AKGTTITGTAGTTVGK(G)   peptide count: 2
A5112RMDN1, FAM82B, CGI-90Regulator of microtubule dynamics protein 1NP_079752(K)AKGYPAHTEEDKQIQTEAAQLLTGL(-)   peptide count: 1
A5005NEBNebulinXP_130232(K)AKHEGEK(F)   peptide count: 8
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorNP_063936(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_356994(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_899768(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_989861(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1256UBBPolyubiquitin-BNP_035794(K)AKIQDKEGIPPDQQR(L)   peptide count: 4
A1256UBBPolyubiquitin-BNP_062613(K)AKIQDKEGIPPDQQR(L)   peptide count: 10
A1256UBBPolyubiquitin-BXP_984804(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1256UBBPolyubiquitin-BXP_985698(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A1256UBBPolyubiquitin-BXP_997313(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorNP_001029037(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorNP_077239(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_889611(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_984563(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorXP_001002242(K)AKIQDKEGIPPDQQR(L)   peptide count: 1
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)AKKAITDAAMMAEELK(K)   peptide count: 2
A3202MYH7, MYHCBMyosin-7NP_542766(K)AKKAITDAAMMAEELK(K)   peptide count: 2
A0452CANXCalnexin precursorNP_031623(K)AKKDDTDDEIAK(Y)   peptide count: 4
A9760TRDNTriadinXP_483889(K)AKKEMK(V)   peptide count: 3
A9760TRDNTriadinXP_895453(K)AKKEMK(V)   peptide count: 3
A9760TRDNTriadinXP_904053(K)AKKEMK(V)   peptide count: 3
A2461ASH1L, KMT2HAbsent, small, or homeotic 1-likeNP_619620(K)AKKLQRQAR(T)   peptide count: 1
A0630MAST1, SASTMicrotubule-associated serine/threonine-protein kinase 1NP_064329(K)AKKPPGESDFDTIK(L)   peptide count: 1
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialNP_062668(K)AKLEATLQEEAAIQQEHLEELKR(A)   peptide count: 9
A1164IPO5, KPNB3, RANBP5Importin 5NP_076068(K)AKLEEHFK(N)   peptide count: 3
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorNP_077798(K)AKLEEQLR(E)   peptide count: 31
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorNP_077798(K)AKLEEQLRETMEK(Y)   peptide count: 20
A3474CACNA2D1, CACNL2A, CCHL2AVoltage-dependent calcium channel subunit alpha-2/delta-1NP_033914(K)AKLEETITQAR(Y)   peptide count: 2
A1941PLEC1, PLECPlectinNP_035247(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AKLEQLFQDEVAK(A)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AKLEQLFQDEVAK(A)   peptide count: 1
A9612MRPL42, MRPL31, MRPS32Mitochondrial ribosomal protein L42NP_080341(K)AKLEVR(K)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)AKLQEMESAVK(S)   peptide count: 4
A2170BAZ2A, TIP5Bromodomain adjacent to zinc finger domain 2ANP_473419(K)AKMTKNK(K)   peptide count: 1
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)AKNEILDEVISLSQVTPK(H)   peptide count: 77
A9566RPL35A, GIG3360S ribosomal protein L35aNP_067313(K)AKNNTVTPGGKPNKTR(V)   peptide count: 1
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorNP_084501(K)AKPAETPAPAHK(A)   peptide count: 118
A105D UPF0691 protein C9orf116NP_081316(K)AKPAPEEPEPGEPK(A)   peptide count: 2
A878BCLCA1, CACC1, HCLCA1Chloride channel, calcium activated, family member 1 precursorNP_059502(K)AKPEYTRPK(L)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6NP_035420(K)AKPHCSR(N)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_483949(K)AKPHCSR(N)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_890389(K)AKPHCSR(N)   peptide count: 1
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_899749(K)AKPHCSR(N)   peptide count: 1
A400BHLC8, MIG3, HLC-8Uncharacterized protein C17orf80NP_808445(K)AKPHTALELR(N)   peptide count: 2
A0778MAP4Microtubule-associated protein 4NP_032659(K)AKPLATTQPAK(T)   peptide count: 2
A954AGFM2, EFG2, MSTP027Ribosome-releasing factor 2, mitochondrialNP_796240(K)AKPLILQLPIGEAR(T)   peptide count: 15
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicNP_031966(K)AKPNEVVFLDDFGSNLKPAR(D)   peptide count: 1
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorNP_057931(K)AKPNIPVYR(D)   peptide count: 1
A4189PLIN1, PERI, PLINPerilipinNP_783571(K)AKPSLVR(R)   peptide count: 1
A5695ACSL4, ACS4, FACL4Long-chain-fatty-acid--CoA ligase 4NP_001028772(K)AKPTSDKPGSPYR(S)   peptide count: 6
A5695ACSL4, ACS4, FACL4Long-chain-fatty-acid--CoA ligase 4NP_062350(K)AKPTSDKPGSPYR(S)   peptide count: 6
A5695ACSL4, ACS4, FACL4Long-chain-fatty-acid--CoA ligase 4NP_997508(K)AKPTSDKPGSPYR(S)   peptide count: 6
A5694ACSL3, ACS3, FACL3Long-chain-fatty-acid--CoA ligase 3NP_001028778(K)AKPVSSKPDSAYR(S)   peptide count: 1
A5694ACSL3, ACS3, FACL3Long-chain-fatty-acid--CoA ligase 3NP_083093(K)AKPVSSKPDSAYR(S)   peptide count: 1
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorNP_063932(K)AKPVVSFIAGITAPPGR(R)   peptide count: 81
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorNP_063932(K)AKPVVSFIAGITAPPGRR(M)   peptide count: 11
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BNP_034799(K)AKQEMARLLK(E)   peptide count: 1
A0439PHB2, BAP, REAProhibitin 2NP_031557(K)AKQEQR(Q)   peptide count: 2
A9674MRPS2728S ribosomal protein S27, mitochondrialNP_776118(K)AKQEYQALSAAEK(A)   peptide count: 9
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)AKQTLENER(G)   peptide count: 1
A7870SSH1, SSH1L, HSSH-1LProtein phosphatase Slingshot homolog 1NP_932777(K)AKRNHSK(C)   peptide count: 2
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(K)AKRPELR(E)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(K)AKRPELR(E)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(K)AKRPELR(E)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(K)AKRPELR(E)   peptide count: 4
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)AKRPELR(E)   peptide count: 4
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)AKRPELR(N)   peptide count: 3
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)AKRPELRNYFR(S)   peptide count: 1
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13NP_598487(K)AKSEENTK(E)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AKTAHIVLEDGTK(M)   peptide count: 1
A5686ACSM2A, ACSM2, MACS2Acyl-CoA synthetase medium chain family member 2ANP_666309(K)AKTGLEIR(E)   peptide count: 3
A1941PLEC1, PLECPlectinNP_035247(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958787(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958788(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958789(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958790(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958791(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958792(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958793(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958794(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958795(K)AKVEEAR(R)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958796(K)AKVEEAR(R)   peptide count: 2
A556BOTOP3Otopetrin 3NP_081247(K)AKVELR(A)   peptide count: 5
A6879LACTB, MRPL56, UNQ843/PRO1781Serine beta lactamase-like protein LACTB, mitochondrialNP_109642(K)AKVEQDSEAR(C)   peptide count: 15
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomeraseNP_035998(K)AKWDAWNALGSLPK(E)   peptide count: 4
A790BDBIAcyl-CoA-binding proteinNP_001033088(K)AKWDSWNK(L)   peptide count: 9
A790BDBIAcyl-CoA-binding proteinNP_031856(K)AKWDSWNK(L)   peptide count: 9
A934BDbil5Diazepam-binding inhibitor-like 5NP_067269(K)AKYEAWMVNK(G)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AKYESDMVIGGYAALINLCCR(H)   peptide count: 1
A4043PPP1CB, PPCS1DSerine/threonine protein phosphatase PP1-beta catalytic subunitNP_766295(K)AKYQYGGLNSGRPVTPPR(T)   peptide count: 1
A470AHIST1H1C, H1F2Histone H1.2NP_056601(K)ALAAAGYDVEK(N)   peptide count: 4
A471AHIST1H1D, H1F3Histone H1.3NP_663759(K)ALAAAGYDVEK(N)   peptide count: 4
A472AHIST1H1E, H1F4Histone H1.4NP_056602(K)ALAAAGYDVEK(N)   peptide count: 4
A475AHIST1H1T, H1FT, H1THistone H1TNP_034507(K)ALAAAGYDVEK(N)   peptide count: 4
A470AHIST1H1C, H1F2Histone H1.2NP_056601(K)ALAAAGYDVEKNNSR(I)   peptide count: 2
A471AHIST1H1D, H1F3Histone H1.3NP_663759(K)ALAAAGYDVEKNNSR(I)   peptide count: 2
A472AHIST1H1E, H1F4Histone H1.4NP_056602(K)ALAAAGYDVEKNNSR(I)   peptide count: 2
A475AHIST1H1T, H1FT, H1THistone H1TNP_034507(K)ALAAAGYDVEKNNSR(I)   peptide count: 2
A0534GFAPGlial fibrillary acidic protein, astrocyteNP_034407(K)ALAAELNQLR(A)   peptide count: 1
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitNP_080645(K)ALAAGGVGSIVR(V)   peptide count: 6
A523BMPV17L2, FKSG24MPV17-like protein 2NP_898993(K)ALAAGRPLFQGR(A)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)ALACDGR(A)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)ALACDGR(A)   peptide count: 1
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BNP_034078(K)ALADDVELYCFQFLPFGK(G)   peptide count: 22
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1NP_766307(K)ALADENEFVR(D)   peptide count: 1
A6714FECHFerrochelatase, mitochondrial precursorNP_032024(K)ALADLVHSHIQSNK(L)   peptide count: 7
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorNP_034813(K)ALAEEAAK(K)   peptide count: 1
A3698CYC1Cytochrome c1, heme protein, mitochondrialNP_079843(K)ALAEEVEVQDGPNDDGEMFMRPGK(L)   peptide count: 37
A3698CYC1Cytochrome c1, heme protein, mitochondrialNP_079843(K)ALAEEVEVQDGPNDDGEMFMRPGK(L)   peptide count: 4
A091ARHEB, RHEB2GTP-binding protein RhebNP_444305(K)ALAESWNAAFLESSAK(E)   peptide count: 1
A4761DNAH11, Dnahc11Dynein heavy chain 11, axonemalNP_034190(K)ALAEYLETK(R)   peptide count: 2
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ALAEYLETK(R)   peptide count: 2
A4761DNAH11, Dnahc11Dynein heavy chain 11, axonemalNP_034190(K)ALAEYLETKR(V)   peptide count: 3
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ALAEYLETKR(V)   peptide count: 3
A1031RRAGCRAS-related GTP-binding protein CNP_059503(K)ALAHNGTPR(N)   peptide count: 1
A3993ARMC10, SVHArmadillo repeat-containing protein 10NP_080310(K)ALAIKPK(F)   peptide count: 9
A201DOXLD1Uncharacterized protein C17ORF90NP_079836(K)ALAILEEHVTDENLK(A)   peptide count: 3
A3916NIPSNAP3A, NIPSNAP4, HSPC299NipSnap4 proteinXP_485380(K)ALAKDEDWQEQFLIPNLPLIDK(Q)   peptide count: 1
A2036CHD2Chromodomain-helicase-DNA-binding protein 2XP_902397(K)ALAKGTRGSTSGFLNIVMELK(K)   peptide count: 1
A013ANCSTN, UNQ1874/PRO4317, UNQ1874Nicastrin precursorNP_067620(K)ALANVATVLAR(A)   peptide count: 7
A9579RPLP1, RRP160S acidic ribosomal protein P1NP_061341(K)ALANVNIGSLICNVGAGGPAPAAGAAPAGGAAPSTAAAPAEEK(K)   peptide count: 6
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorNP_035162(K)ALAPEYAK(A)   peptide count: 3
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorNP_032159(K)ALASLMTYK(C)   peptide count: 102
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)ALASQITEIILSEISYFQIPPDLVANLPLR(L)   peptide count: 5
A146D Putative uncharacterized protein C12orf63XP_994223(K)ALATSMEQK(Y)   peptide count: 2
A4759DNAH1, DHC7, DNAHC1Dynein heavy chain 1, axonemalXP_982687(K)ALATSMLDILAK(N)   peptide count: 1
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like proteinNP_083085(K)ALAVGGLGSIIR(V)   peptide count: 4
A3662PCPyruvate carboxylase, mitochondrial precursorNP_032823(K)ALAVSDLNR(A)   peptide count: 82
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinNP_573479(K)ALCADLSPR(E)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainNP_001070022(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993335(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993380(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993410(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993705(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993740(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993811(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993853(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993920(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994000(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994029(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994106(K)ALCAEADR(L)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994149(K)ALCAEADR(L)   peptide count: 1
A7452PNPT1, PNPASE, OLD35Polyribonucleotide nucleotidyltransferase 1, mitochondrial precursorNP_082145(K)ALCPVIPK(D)   peptide count: 11
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)ALCYPR(V)   peptide count: 4
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)ALCYPR(V)   peptide count: 4
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)ALCYPR(V)   peptide count: 4
A3198MYH8Myosin-8NP_796343(K)ALCYPR(V)   peptide count: 4
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)ALDEETR(S)   peptide count: 2
A6586GFPT1, GFAT, GFPTGlucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1NP_038556(K)ALDEEVHK(Q)   peptide count: 1
A466AGTPBP10, OBGH2GTP-binding protein 10NP_694756(K)ALDEQDGKESDAHR(S)   peptide count: 2
A466AGTPBP10, OBGH2GTP-binding protein 10XP_898240(K)ALDEQDGKESDAHR(S)   peptide count: 2
A7889STK10, LOKSerine/threonine protein kinase 10NP_033314(K)ALDESHNQSLK(E)   peptide count: 1
A2341ACTN1Alpha-actinin 1NP_598917(K)ALDFIASK(G)   peptide count: 1
A2343ACTN3Alpha-actinin 3NP_038484(K)ALDFIASK(G)   peptide count: 1
A2344ACTN4Alpha-actinin 4NP_068695(K)ALDFIASK(G)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)ALDGDFTEENR(A)   peptide count: 5
A351CRBP2, CRBP2Retinol-binding protein II, cellularNP_033060(K)ALDIDFATR(K)   peptide count: 4
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)ALDLAR(E)   peptide count: 22
A6573GCDHGlutaryl-CoA dehydrogenase, mitochondrial precursorNP_001038209(K)ALDLAR(E)   peptide count: 22
A6573GCDHGlutaryl-CoA dehydrogenase, mitochondrial precursorNP_032123(K)ALDLAR(E)   peptide count: 22
A7979ACAA2Acetyl-CoA acyltransferase 2NP_803421(K)ALDLDPSK(T)   peptide count: 58
A7979ACAA2Acetyl-CoA acyltransferase 2NP_803421(K)ALDLDPSKTNVSGGAIALGHPLGGSGSR(I)   peptide count: 5
A3634COMTD1, UNQ766/PRO1558, UNQ766Catechol-O-methyltransferase domain-containing protein 1NP_081241(K)ALDLGTFTGYSALALALALPEAGR(V)   peptide count: 6
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorNP_038875(K)ALDLLMESNAIIQSMAAK(T)   peptide count: 8
A5925GUSB, F8Beta-glucuronidase precursorNP_034498(K)ALDLTRPVTFVSNAK(Y)   peptide count: 4
A033CIFT140, WDTC2Intraflagellar transport protein 140 homologNP_598887(K)ALDMFNWR(K)   peptide count: 1
A523DGVINP1, GVIN1Interferon-inducible very large GTPase 1XP_620545(K)ALDPAMR(K)   peptide count: 1
A0742TTNTitinNP_035782(K)ALDPFTTPSPPTSLEITSVTK(D)   peptide count: 1
A0742TTNTitinNP_082280(K)ALDPFTTPSPPTSLEITSVTK(D)   peptide count: 1
A6324DHX29, DDX29ATP-dependent RNA helicase DHX29NP_766182(K)ALDPPQLQVISNAMNLLR(K)   peptide count: 3
A9073STIM1, GOKStromal interaction molecule 1 precursorNP_033313(K)ALDTVLFGPPLLTR(H)   peptide count: 1
A644BTMEM135Transmembrane protein 135NP_082619(K)ALDVFGTGASR(E)   peptide count: 1
A7403PCMT1Protein-L-isoaspartate (D-aspartate) O-methyltransferaseNP_032812(K)ALDVGSGSGILTACFAR(M)   peptide count: 1
A5683APEH, D3F15S2, D3S48EAcylamino-acid-releasing enzymeNP_666338(K)ALDVSASDEEMARPK(K)   peptide count: 1
A6756HAL, HISHistidine ammonia-lyaseNP_034531(K)ALDYLAIGVHELAAISER(R)   peptide count: 1
A5690ACSF2, UNQ493/PRO1009, UNQ493Acyl-CoA synthetase family member 2, mitochondrial precursorNP_722502(K)ALEAISR(E)   peptide count: 35
A7926MARS2, MetRSMethionyl-tRNA synthetase, mitochondrial precursorNP_780648(K)ALEAVSSCVR(Q)   peptide count: 1
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)ALEDLGR(V)   peptide count: 33
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)ALEDLGRVNR(V)   peptide count: 1
A6947MAN1A2, MAN1BMannosyl-oligosaccharide 1,2-alpha-mannosidase IBNP_034893(K)ALEEAKEKLR(K)   peptide count: 1
A5227TPPP3, CGI-38Tubulin polymerization-promoting protein family member 3NP_080757(K)ALEELATK(R)   peptide count: 2
A5227TPPP3, CGI-38Tubulin polymerization-promoting protein family member 3NP_080757(K)ALEELATKR(F)   peptide count: 3
A3651DHRS7B, CGI-93, UNQ212/PRO238Dehydrogenase/reductase (SDR family) member 7BNP_663403(K)ALEELSR(E)   peptide count: 2
A5161STMN1, LAP18, OP18StathminNP_062615(K)ALEENNNFSK(M)   peptide count: 8
A5482STMN2, SCG10, SCGN10Stathmin 2NP_079561(K)ALEENNNFSK(M)   peptide count: 8
A888APUM1, PUMH1Pumilio homolog 1NP_109647(K)ALEFIPSDQQVINEMVRELDGHVLKCVK(D)   peptide count: 2
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ALEHAFK(L)   peptide count: 1
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)ALEHHR(S)   peptide count: 45
A3534HSPA12A, THYRO1001365Heat shock 70 kDa protein 12ANP_780408(K)ALEIFAYALQYFK(E)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ALELDSNLYR(I)   peptide count: 8
A0808MSNMoesinNP_034963(K)ALELEQER(Q)   peptide count: 3
A0819RDXRadixinNP_033067(K)ALELEQER(Q)   peptide count: 3
A159CMBMyoglobinNP_038621(K)ALELFR(N)   peptide count: 1
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ALELYEQLR(Q)   peptide count: 2
A6011CBR3Carbonyl reductase [NADPH] 3NP_766635(K)ALENCREDLQEK(F)   peptide count: 1
A5086LCP1, PLS2Plastin-2NP_032905(K)ALENDPDCR(H)   peptide count: 6
A5087PLS3Plastin 3NP_663604(K)ALENDPDCR(H)   peptide count: 6
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)ALENNMSLDEIVR(L)   peptide count: 50
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorNP_031978(K)ALEQFLQEYFDGNLK(R)   peptide count: 13
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorNP_031978(K)ALEQFLQEYFDGNLKR(Y)   peptide count: 8
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1NP_032854(K)ALESPERPFLAILGGAK(V)   peptide count: 8
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1XP_001001423(K)ALESPERPFLAILGGAK(V)   peptide count: 8
A369ATSFMElongation factor Ts, mitochondrial precursorNP_079813(K)ALETCGGDLK(Q)   peptide count: 18
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]NP_067448(K)ALEVLVAK(G)   peptide count: 3
A3476CACNB3, CACNLB3Voltage-dependent L-type calcium channel beta-3 subunitNP_001038206(K)ALFDFLK(H)   peptide count: 2
A3476CACNB3, CACNLB3Voltage-dependent L-type calcium channel beta-3 subunitNP_031607(K)ALFDFLK(H)   peptide count: 2
A4431CACNB1, CACNLB1Dihydropyridine-sensitive L-type, calcium channel beta-1 subunitNP_112450(K)ALFDFLK(H)   peptide count: 2
A4431CACNB1, CACNLB1Dihydropyridine-sensitive L-type, calcium channel beta-1 subunitNP_660099(K)ALFDFLK(H)   peptide count: 2
A4432CACNB2, CAVB2F, CACNLB2Calcium channel, voltage dependent, beta 2 subunitNP_075605(K)ALFDFLK(H)   peptide count: 2
A4433CACNB4, CACNLB4Calcium channel, voltage dependent, beta 4 subunitNP_001032176(K)ALFDFLK(H)   peptide count: 2
A4433CACNB4, CACNLB4Calcium channel, voltage dependent, beta 4 subunitNP_666235(K)ALFDFLK(H)   peptide count: 2
A6581GDPD1, GDE4, UGPQGlycerophosphodiester phosphodiesterase domain-containing protein 1NP_079914(K)ALFDHLTAR(G)   peptide count: 1
A3744SLC25A31, AAC4, ANT4ADP/ATP translocase 4NP_848473(K)ALFDPVSFSK(D)   peptide count: 8
A952CCCDC105Coiled-coil domain-containing protein 105XP_147407(K)ALFEAK(R)   peptide count: 1
A4760DNAH10Dynein heavy chain 10, axonemalXP_983660(K)ALFEEILEEYNEVNTK(M)   peptide count: 2
A2111MRPL41, BMRP, MRPL2739S ribosomal protein L41, mitochondrial precursorNP_001026978(K)ALFQETVAPAIEK(D)   peptide count: 16
A2111MRPL41, BMRP, MRPL2739S ribosomal protein L41, mitochondrial precursorXP_893023(K)ALFQETVAPAIEK(D)   peptide count: 16
A2111MRPL41, BMRP, MRPL2739S ribosomal protein L41, mitochondrial precursorNP_001026978(K)ALFQETVAPAIEKDFK(E)   peptide count: 1
A2111MRPL41, BMRP, MRPL2739S ribosomal protein L41, mitochondrial precursorXP_893023(K)ALFQETVAPAIEKDFK(E)   peptide count: 1
A5660ACAD11Acyl-CoA dehydrogenase family member 11NP_780533(K)ALFSIGFPVAKPLLYCR(D)   peptide count: 2
A522DGTPBP8, HSPC135GTP-binding protein 8NP_079608(K)ALFSLAPDVEVR(I)   peptide count: 1
A3947ABCB8, MABC1, ACCN3ATP-binding cassette, sub-family B, member 8, mitochondrial precursorNP_083296(K)ALFSSLLR(Q)   peptide count: 18
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1NP_058661(K)ALFVFMALSFAR(D)   peptide count: 2
A0097TLN1, TLNTalin 1NP_035732(K)ALGDLISATK(A)   peptide count: 7
A759CACN9, DC11Protein ACN9 homolog, mitochondrial precursorXP_355744(K)ALGDQYVK(D)   peptide count: 1
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ALGEYLER(E)   peptide count: 1
A612ChTIM44, TIMM44, MIMT44Import inner membrane translocase subunit TIM44, mitochondrial precursorNP_035722(K)ALGFQFHSR(I)   peptide count: 3
A6010Cbr2Carbonyl reductase [NADPH] 2NP_031647(K)ALGGIGPVDLLVNNAALVIMQPFLEVTK(E)   peptide count: 32
A6010Cbr2Carbonyl reductase [NADPH] 2NP_031647(K)ALGGIGPVDLLVNNAALVIMQPFLEVTK(E)   peptide count: 10
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ALGGLLGR(Q)   peptide count: 1
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ALGHQLGR(F)   peptide count: 4
A5772Akr1b7Aldose reductase-related protein 1NP_033861(K)ALGISNFNHFQIER(L)   peptide count: 5
A0739TRIO, tgat, TGATTriple functional domain proteinXP_893434(K)ALGISSDSNK(S)   peptide count: 1
A6639GPD1LGlycerol-3-phosphate dehydrogenase 1-like proteinNP_780589(K)ALGITLIK(G)   peptide count: 2
A231CNPC1Niemann-Pick C1 protein precursorNP_032746(K)ALGLLCGR(D)   peptide count: 2
A3960MYO6Unconventional myosin-VINP_001034635(K)ALGLNEVDYK(F)   peptide count: 2
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]NP_067448(K)ALGLSNFNSR(Q)   peptide count: 2
A784DPALD1, PALDPaladinNP_038781(K)ALGNILAYLSDAK(R)   peptide count: 1
A7163NMNAT3, FKSG76Nicotinamide nucleotide adenylyltransferase 3NP_653116(K)ALGQGQSVK(Y)   peptide count: 4
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)ALGSLEGSPSLPDQDK(A)   peptide count: 1
A974BFABP7, BLBP, FABPBFatty acid-binding protein, brainNP_067247(K)ALGVGFATR(Q)   peptide count: 1
A5752AKR1B15PREDICTED: Similar to Aldo-keto reductase family 1 member B10NP_032038(K)ALGVSNFNHFQIER(L)   peptide count: 6
A5772Akr1b7Aldose reductase-related protein 1NP_765986(K)ALGVSNFNHFQIER(L)   peptide count: 6
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)ALGYFAVVTGK(G)   peptide count: 21
A6010Cbr2Carbonyl reductase [NADPH] 2NP_031647(K)ALHASGAK(V)   peptide count: 8
A335BTIMMDC1, UNQ247/PRO284, UNQ247C3orf1 hypothetical proteinNP_077235(K)ALHEQR(L)   peptide count: 6
A012BSLIRP, DC23, DC50SRA stem-loop-interacting RNA-binding protein, mitochondrialNP_081234(K)ALHGAQTSDEER(F)   peptide count: 28
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)ALHGEQYLELYKPLPR(S)   peptide count: 21
A7481CTSA, PPGBCathepsin ANP_001033581(K)ALHIPESLPR(W)   peptide count: 10
A7481CTSA, PPGBCathepsin ANP_032932(K)ALHIPESLPR(W)   peptide count: 10
A853APIAS1, DDXBP1Protein inhibitor of activated STAT protein 1NP_062637(K)ALHLLK(S)   peptide count: 1
A854APIAS2, PIASX, MIZ1E3 SUMO-protein ligase PIAS2NP_032628(K)ALHLLK(S)   peptide count: 1
A855APIAS3E3 Sumo-protein ligase PIAS3NP_061282(K)ALHLLK(S)   peptide count: 1
A855APIAS3E3 Sumo-protein ligase PIAS3NP_666247(K)ALHLLK(S)   peptide count: 1
A9581MRPL1, BM-022, BM02239S ribosomal protein L1, mitochondrialNP_001034173(K)ALHLLK(S)   peptide count: 1
A9581MRPL1, BM-022, BM02239S ribosomal protein L1, mitochondrialNP_444388(K)ALHLLK(S)   peptide count: 1
A3584FASN, FASFatty acid synthaseNP_032014(K)ALHLVGLK(R)   peptide count: 1
A3584FASN, FASFatty acid synthaseNP_032014(K)ALHLVGLKR(S)   peptide count: 1
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorNP_035636(K)ALIADSGLK(I)   peptide count: 28
A435CSLC38A9Putative sodium-coupled neutral amino acid transporter 9NP_848861(K)ALIAPDHVVPAPEECYVYSPLGSAYK(L)   peptide count: 1
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1NP_032892(K)ALIDQEVK(N)   peptide count: 12
A096BTDRD1Tudor domain containing protein 1NP_001002238(K)ALIDSGFAIK(E)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_001002240(K)ALIDSGFAIK(E)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_001002241(K)ALIDSGFAIK(E)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_113564(K)ALIDSGFAIK(E)   peptide count: 2
A6933LYPLA2, APT2Lysophospholipase IINP_036072(K)ALIEHEMK(N)   peptide count: 1
A7504PITRM1, MP1Presequence protease, mitochondrialNP_660113(K)ALIESGLGTDFSPDVGYNGYTR(E)   peptide count: 15
A2489GNSN-acetylglucosamine-6-sulfatase precursorNP_083640(K)ALIGEK(G)   peptide count: 2
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11NP_077173(K)ALIGMTAGATGAFVGTPAEVALIR(M)   peptide count: 35
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ALILDIIHNIDIVK(Q)   peptide count: 4
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainNP_001070022(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993335(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993380(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993410(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993705(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993740(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993811(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993853(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993920(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994000(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994029(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994106(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994149(K)ALINADELANDVAGAEALLDR(H)   peptide count: 8
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1NP_032892(K)ALINPANVTFK(I)   peptide count: 22
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)ALIQEEESEGLEACQEDFSLLHK(W)   peptide count: 2
A9589MRPL14, MRPL32, RPML32Mitochondrial ribosomal protein L14NP_081008(K)ALIVGHR(M)   peptide count: 20
A375DFAM179BProtein FAM179BXP_902079(K)ALKAMVNNVTPARAVTSLINGGQR(Y)   peptide count: 3
A1312PARP1, ADPRT, PPOLPoly [ADP]-ribose polymerase-1NP_031441(K)ALKAQNELIWNIKDELK(K)   peptide count: 2
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorNP_035761(K)ALKDKIEK(A)   peptide count: 2
A3662PCPyruvate carboxylase, mitochondrial precursorNP_032823(K)ALKDVK(G)   peptide count: 39
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ALKEKEK(A)   peptide count: 4
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ALKEKEK(A)   peptide count: 7
A902BCOX4I2, COX4L2Cytochrome c oxidase subunit IV isoform 2, mitochondrial precursorNP_444321(K)ALKEKEK(A)   peptide count: 7
A9541RPL1260S ribosomal protein L12XP_136732(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12NP_033102(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12XP_621465(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12XP_892120(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12XP_001003212(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12XP_001003945(K)ALKEPPR(D)   peptide count: 3
A9541RPL1260S ribosomal protein L12XP_136732(K)ALKEPPRDR(K)   peptide count: 5
A9541RPL1260S ribosomal protein L12NP_033102(K)ALKEPPRDR(K)   peptide count: 5
A9541RPL1260S ribosomal protein L12XP_621465(K)ALKEPPRDR(K)   peptide count: 5
A9541RPL1260S ribosomal protein L12XP_892120(K)ALKEPPRDR(K)   peptide count: 5
A9541RPL1260S ribosomal protein L12XP_001003212(K)ALKEPPRDR(K)   peptide count: 5
A9541RPL1260S ribosomal protein L12XP_001003945(K)ALKEPPRDR(K)   peptide count: 5
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)ALKEQLLTELGK(L)   peptide count: 2
A733CMP68, PRO15746.8 kDa mitochondrial proteolipidNP_081636(K)ALKGPAPAHGHH(-)   peptide count: 40
A4707COCH, COCH5B2, UNQ257/PRO294Cochlin precursorNP_031754(K)ALKHTAQK(F)   peptide count: 1
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)ALKLAK(E)   peptide count: 2
A422DFAM24AFamily with sequence similarity 24, member ANP_899095(K)ALKLAK(E)   peptide count: 2
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)ALKPPCDLSMQSVEIAGTTDGIR(R)   peptide count: 7
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)ALKPPCDLSMQSVEIAGTTDGIRR(S)   peptide count: 2
A4240TBRG4, CPR2, FASTKD4Cell cycle progression 2 proteinNP_598772(K)ALLAEDAR(F)   peptide count: 11
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialNP_077136(K)ALLAEGIILR(R)   peptide count: 22
A6484FAAH, FAAH1Fatty-acid amide hydrolaseNP_034303(K)ALLCEDLFR(L)   peptide count: 4
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)ALLDMR(T)   peptide count: 12
A4000EMC1Uncharacterized protein KIAA0090NP_001034289(K)ALLDPR(R)   peptide count: 1
A4000EMC1Uncharacterized protein KIAA0090NP_666269(K)ALLDPR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_035247(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)ALLEEIER(H)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)ALLEEIER(H)   peptide count: 1
A4747DCTN3, DCTN22, P22Dynactin subunitNP_058586(K)ALLEGYNK(T)   peptide count: 1
A6604HAGH, GLO2, HAGH1Hydroxyacylglutathione hydrolase, mitochondrialNP_077246(K)ALLEVLGR(L)   peptide count: 12
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorNP_997507(K)ALLEYFQPVSQWLEEQNQR(N)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_001002238(K)ALLFEQFCSVK(V)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_001002240(K)ALLFEQFCSVK(V)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_001002241(K)ALLFEQFCSVK(V)   peptide count: 2
A096BTDRD1Tudor domain containing protein 1NP_113564(K)ALLFEQFCSVK(V)   peptide count: 2
A4240TBRG4, CPR2, FASTKD4Cell cycle progression 2 proteinNP_598772(K)ALLGNTDK(G)   peptide count: 7
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BNP_034078(K)ALLHGNCYNR(W)   peptide count: 17
A640CTPRG1L, FAM79A, MOVERTumor protein P63-regulated gene 1-like proteinNP_080664(K)ALLIQAVK(K)   peptide count: 2
A347BCCDC51Coiled-coil domain-containing protein 51NP_079965(K)ALLLEAQK(G)   peptide count: 1
A9616MRPL46, LIECG239S ribosomal protein L46, mitochondrialNP_075820(K)ALLLTGDFVQAGK(K)   peptide count: 6
A9616MRPL46, LIECG239S ribosomal protein L46, mitochondrialNP_075820(K)ALLLTGDFVQAGKK(S)   peptide count: 1
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)NP_035533(K)ALLNLVPVQK(E)   peptide count: 3
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)ALLNNSHYYHMAHGK(D)   peptide count: 47
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)ALLNNSHYYHMAHGK(D)   peptide count: 34
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)ALLNNSHYYHMAHGKDFASR(G)   peptide count: 3
A8477RGS22, PRTD-NY2Regulator of G-protein signalling 22XP_896293(K)ALLNPVIAR(Q)   peptide count: 1
A7428PLD3, HU-K4Phospholipase D3NP_035246(K)ALLNVVDSAR(S)   peptide count: 13
A3651DHRS7B, CGI-93, UNQ212/PRO238Dehydrogenase/reductase (SDR family) member 7BNP_663403(K)ALLPSMVER(K)   peptide count: 4
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ALLQGK(G)   peptide count: 1
A0095DNM1, DNMDynamin-1NP_034195(K)ALLQMVQQFAVDFEK(R)   peptide count: 26
A1928DNM3Dynamin 3NP_001033708(K)ALLQMVQQFAVDFEK(R)   peptide count: 26
A0095DNM1, DNMDynamin-1NP_034195(K)ALLQMVQQFAVDFEKR(I)   peptide count: 6
A1928DNM3Dynamin 3NP_001033708(K)ALLQMVQQFAVDFEKR(I)   peptide count: 6
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4NP_035249(K)ALLQSSASR(K)   peptide count: 1
A6325DHX30, DDX30, MLAA-43Putative ATP-dependent RNA helicase DHX30NP_579925(K)ALLSHDSGSDHLAFVR(A)   peptide count: 3
A680CSLC32A1, VGAT, VIAATVesicular inhibitory amino acid transporterNP_033534(K)ALLSYPLPFFAAVEVLEK(S)   peptide count: 22
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorNP_034474(K)ALLTPVAIAAGR(K)   peptide count: 3
A0537ANXA2, ANX2, ANX2L4Annexin A2NP_031611(K)ALLYLCGGDD(-)   peptide count: 1
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ALMEDAVK(T)   peptide count: 2
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ALMGLYNGQVLCK(K)   peptide count: 68
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ALMGLYNGQVLCKK(N)   peptide count: 3
A3595ALDH1L2Aldehyde dehydrogenase 1 family, member L2NP_705771(K)ALMVR(N)   peptide count: 2
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)ALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDK(A)   peptide count: 34
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)ALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDK(A)   peptide count: 92
A313BARMCX4Armadillo repeat-containing X-linked protein 4XP_910726(K)ALNALNNISVAAENHR(T)   peptide count: 2
A3993ARMC10, SVHArmadillo repeat-containing protein 10NP_080310(K)ALNALNNLSVNVENQTK(I)   peptide count: 2
A4332HSPA4L, APG1, OSP94Osmotic stress protein 94NP_035150(K)ALNDLGKK(I)   peptide count: 1
A8871LAMTOR1, PDRO, PP7157RHOA activator C11ORF59NP_079881(K)ALNGAEPNYHSLPSAR(T)   peptide count: 4
A8871LAMTOR1, PDRO, PP7157RHOA activator C11ORF59XP_484764(K)ALNGAEPNYHSLPSAR(T)   peptide count: 4
A3874ANK3Ankyrin 3NP_666117(K)ALNGFTPLHIACK(K)   peptide count: 1
A3874ANK3Ankyrin 3NP_733789(K)ALNGFTPLHIACK(K)   peptide count: 1
A3874ANK3Ankyrin 3NP_733790(K)ALNGFTPLHIACK(K)   peptide count: 1
A3874ANK3Ankyrin 3NP_733791(K)ALNGFTPLHIACK(K)   peptide count: 1
A3874ANK3Ankyrin 3NP_733924(K)ALNGFTPLHIACK(K)   peptide count: 1
A3874ANK3Ankyrin 3NP_733925(K)ALNGFTPLHIACK(K)   peptide count: 1
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)ALNGFVK(L)   peptide count: 3
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71NP_064340(K)ALNNKFASFIDK(V)   peptide count: 1
A4878KRT73, K6IRS3, KB36Keratin, type II cytoskeletal 73NP_997650(K)ALNNKFASFIDK(V)   peptide count: 1
A7938VARS, G7A, VARS2Valyl-tRNA synthetase 2NP_035820(K)ALNPLEDWLR(L)   peptide count: 1
A559BNUP210LNuclear pore membrane glycoprotein 210-like precursorXP_915496(K)ALNPVDVALVTWQSVK(E)   peptide count: 1
A5294CLPTM1Cleft lip and palate associated transmembrane protein 1NP_062623(K)ALNTFIDDLFAFVIK(M)   peptide count: 10
A6888LDHDD-lactate dehydrogenase, mitochondrialNP_081846(K)ALNTHLR(D)   peptide count: 23
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialNP_036151(K)ALNVEPDGTGLTCSLAPNILSQL(-)   peptide count: 54
A0568PCLO, ACZProtein piccoloNP_036125(K)ALPADKK(E)   peptide count: 1
A2120STRNStriatinNP_035630(K)ALPDTSEDRDTK(E)   peptide count: 1
A159ATMEM35Transmembrane protein 35NP_080515(K)ALPESAEEQPSLYEK(A)   peptide count: 2
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PNP_861461(K)ALPGHLKPFETLLSQNQGGK(A)   peptide count: 10
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PNP_038569(K)ALPGHLKPFETLLSQNQGGK(A)   peptide count: 10
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)ALPSSEDLASLAPDLDK(I)   peptide count: 7
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)ALPSSEDLASLAPDLDKITESLSLLK(D)   peptide count: 44
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorNP_034814(K)ALQATVGNSYK(C)   peptide count: 59
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)ALQEAHQQTLDDLQAEEDK(V)   peptide count: 2
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)ALQEAHQQTLDDLQAEEDK(V)   peptide count: 2
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)ALQEAHQQTLDDLQAEEDK(V)   peptide count: 2
A3198MYH8Myosin-8NP_796343(K)ALQEAHQQTLDDLQAEEDK(V)   peptide count: 2
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)ALQEAHQQTLDDLQAEEDK(V)   peptide count: 2
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)ALQEAHQQTLDDLQAEEDKVNTLTK(A)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)ALQEAHQQTLDDLQAEEDKVNTLTK(A)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)ALQEAHQQTLDDLQAEEDKVNTLTK(A)   peptide count: 5
A3198MYH8Myosin-8NP_796343(K)ALQEAHQQTLDDLQAEEDKVNTLTK(A)   peptide count: 5
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1NP_033286(K)ALQFLK(E)   peptide count: 1
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1NP_787030(K)ALQFLK(E)   peptide count: 1
A5153SPTBN2, SCA5Spectrin beta chain, brain 2NP_067262(K)ALQFLK(E)   peptide count: 1
A5154SPTBN4, SPTBN3, SPNB4Spectrin beta chain, brain 3NP_115999(K)ALQFLK(E)   peptide count: 1
A9567RPL3660S ribosomal protein L36NP_061200(K)ALQFLK(E)   peptide count: 1
A9567RPL3660S ribosomal protein L36XP_486208(K)ALQFLK(E)   peptide count: 1
A9567RPL3660S ribosomal protein L36XP_488179(K)ALQFLK(E)   peptide count: 1
A9567RPL3660S ribosomal protein L36XP_892061(K)ALQFLK(E)   peptide count: 1
A9567RPL3660S ribosomal protein L36XP_894995(K)ALQFLK(E)   peptide count: 1
A7796SERHL, SERHL2Serine hydrolase-like proteinNP_075964(K)ALQGYYDVR(R)   peptide count: 2
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)ALQHMTDFAIQFNK(N)   peptide count: 6
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)ALQHMTDFAIQFNK(N)   peptide count: 6
A4255TTC19Tetratricopeptide repeat protein 19NP_082636(K)ALQICQEIQGER(H)   peptide count: 1
A0326VIL2, EZREzrinNP_033536(K)ALQLEEER(R)   peptide count: 2
A0326VIL2, EZREzrinNP_033536(K)ALQLEEERR(R)   peptide count: 1
A5599TMEM126ATransmembrane protein 126ANP_079736(K)ALQLPEPDLEIH(-)   peptide count: 10
A3285ZNF574, FP972Zinc finger protein 574NP_780686(K)ALQLTR(H)   peptide count: 1
A0836HGS, HRS, IMOS-1Hepatocyte growth factor-regulated tyrosine kinase substrateNP_032270(K)ALQNAVSTFVNR(M)   peptide count: 1
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)ALQPIVSEEEWAHTK(Q)   peptide count: 20
A156CMVP, LRPMajor vault proteinNP_542369(K)ALQPLEEGEGEER(V)   peptide count: 2
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(K)ALQPPCNLLK(Q)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(K)ALQPPCNLLK(Q)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(K)ALQPPCNLLK(Q)   peptide count: 3
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(K)ALQPPCNLLK(Q)   peptide count: 3
A309DApol11aUncharacterized proteinXP_896316(K)ALQSDLPQ(-)   peptide count: 2
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorNP_079683(K)ALQSDLPQ(-)   peptide count: 2
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1NP_057930(K)ALQSLALGLR(G)   peptide count: 5
A8956PSMC6, SUG226S protease regulatory subunit S10BNP_080235(K)ALQSVGQIVGEVLK(Q)   peptide count: 2
A9785BCL2L13, MIL1, CD003Bcl-2-like protein 13NP_705736(K)ALQTILSQPVTYEAYR(E)   peptide count: 7
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1NP_079613(K)ALQTTYGTNAPR(M)   peptide count: 22
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_001070732(K)ALQVGCLLR(L)   peptide count: 2
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_031484(K)ALQVGCLLR(L)   peptide count: 2
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ALQWVLK(Q)   peptide count: 2
A7889STK10, LOKSerine/threonine protein kinase 10NP_033314(K)ALRELVAEAK(A)   peptide count: 1
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(K)ALRPTIFPVVPR(L)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(K)ALRPTIFPVVPR(L)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(K)ALRPTIFPVVPR(L)   peptide count: 4
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(K)ALRPTIFPVVPR(L)   peptide count: 4
A0492STIP1Stress-induced-phosphoprotein 1NP_058017(K)ALSAGNIDDALQCYSEAIK(L)   peptide count: 2
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorXP_485821(K)ALSCLESSWK(T)   peptide count: 1
A734AMug1Murinoglobulin-1NP_032671(K)ALSCLESSWK(T)   peptide count: 1
A8441Mug2Murinoglobulin-2NP_032672(K)ALSCLESSWK(T)   peptide count: 1
A6829CCBL2, KAT3, RBMXL1Kynurenine--oxoglutarate transaminase 3NP_776124(K)ALSCLYGK(I)   peptide count: 1
A8120USP30Ubiquitin carboxyl-terminal hydrolase 30NP_001028374(K)ALSCQEVTEDEVLDASCLLDVLR(M)   peptide count: 1
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialNP_666220(K)ALSEAK(K)   peptide count: 2
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialNP_666220(K)ALSEAKK(A)   peptide count: 1
A7346PDK4, PDHK4Pyruvate dehydrogenase [lipoamide kinase] isozyme 4, mitochondrial precursorNP_038771(K)ALSEFVDTLVK(V)   peptide count: 2
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorNP_031402(K)ALSFYQPR(A)   peptide count: 1
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorNP_079683(K)ALSKDLPK(V)   peptide count: 2
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)ALSLAR(A)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ALSLAR(A)   peptide count: 1
A3961MYH10, SmembMyosin-10NP_780469(K)ALSLAR(A)   peptide count: 1
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorNP_083058(K)ALSLLK(K)   peptide count: 20
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorNP_083058(K)ALSLLKK(E)   peptide count: 6
A133E1700013G24RikNovel proteinNP_081339(K)ALSLPQLAATYLER(A)   peptide count: 2
A7345PDK3, PDHK3[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial precursorNP_663605(K)ALSSESFER(L)   peptide count: 6
A0097TLN1, TLNTalin 1NP_035732(K)ALSTDPASPNLK(S)   peptide count: 5
A7344PDK2, PDHK2[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursorNP_598428(K)ALSTDSVER(L)   peptide count: 12
A7342PDK1, PDHK1Pyruvate dehydrogenase [lipoamide] kinase isozyme 1, mitochondrial precursorNP_766253(K)ALSTESVER(L)   peptide count: 1
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1NP_080131(K)ALSTPESGVALSMFMQNTLTR(F)   peptide count: 2
A5476SPEF2, KPL2Sperm flagellar protein 2XP_484441(K)ALSVLEDLVTK(V)   peptide count: 1
A4292DNAJB13, TSARG3, TSARG6DNAJ homolog subfamily B member 13NP_705755(K)ALTCCTVEVK(T)   peptide count: 1
A5600TAZ, EFE2, G4.5TafazzinNP_852657(K)ALTDFIQEEFQR(L)   peptide count: 2
A7542PTGR1, LTB4DHProstaglandin reductase 1NP_080244(K)ALTELMNWVSEGK(V)   peptide count: 1
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorNP_031887(K)ALTGGIAHLFK(Q)   peptide count: 90
A0647ANXA1, ANX1, LPC1Annexin A1NP_034860(K)ALTGHLEEVVLAMLK(T)   peptide count: 1
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)ALTLIAGSPLK(I)   peptide count: 4
A3926EPN2Epsin 2NP_034278(K)ALTLLDYLLK(T)   peptide count: 1
A954BEPN3Epsin 3NP_082260(K)ALTLLDYLLK(T)   peptide count: 1
A9616MRPL46, LIECG239S ribosomal protein L46, mitochondrialNP_075820(K)ALTPLQEEMAGLLQQIEVER(S)   peptide count: 34
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)ALTQDDGVAK(L)   peptide count: 9
A0808MSNMoesinNP_034963(K)ALTSELANAR(D)   peptide count: 2
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ALTSFER(D)   peptide count: 40
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ALTSFER(D)   peptide count: 2
A4519SCN10ASodium channel protein type 10 subunit alphaNP_033160(K)ALTSFER(D)   peptide count: 2
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorNP_849209(K)ALTSFERDSIFSNLIGQLDYK(G)   peptide count: 6
A2454SYNE2, NUA, TROPHNesprin 2XP_922176(K)ALTSNLLSTKEDLVKLR(Q)   peptide count: 1
A277ES100A5, S100DS100 calcium-binding protein A5NP_035442(K)ALTTMVTTFHK(Y)   peptide count: 1
A6960ME2NAD-dependent malic enzyme, mitochondrial precursorNP_663469(K)ALTTQLTDAELAQGR(L)   peptide count: 23
A063D Uncharacterized protein C7ORF31NP_081840(K)ALTWPGQGVYYDFPK(F)   peptide count: 1
A6227COX6A1, COX6AL, RP3-405J24.3Cytochrome c oxidase subunit 6A1, mitochondrial precursorNP_031774(K)ALTYFVALPGVGVSMLNVFLK(S)   peptide count: 244
A4010WDR7, TRAGWD-repeat protein 7XP_140391(K)ALTYLLLQPPSPK(L)   peptide count: 1
A4010WDR7, TRAGWD-repeat protein 7XP_907005(K)ALTYLLLQPPSPK(L)   peptide count: 1
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ALVAVLR(E)   peptide count: 1
A9634RPS1640S ribosomal protein S16NP_038675(K)ALVAYYQK(Y)   peptide count: 2
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ALVDELNR(K)   peptide count: 1
A6613Gm4952Glycine N-acyltransferase-like proteinNP_001013784(K)ALVDKWPDFNTVVVRPR(E)   peptide count: 2
A6675GUF1GTP-binding protein GUF1 homologNP_766299(K)ALVFDSTFDQYR(G)   peptide count: 1
A1575DST, BPAG1, DMHDystoninNP_598594(K)ALVFEK(T)   peptide count: 1
A1575DST, BPAG1, DMHDystoninNP_604443(K)ALVFEK(T)   peptide count: 1
A685CVPS13A, CHACChoreinNP_766616(K)ALVGGAVGGLAGAASK(I)   peptide count: 4
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)ALVILK(D)   peptide count: 3
A9558RPL2960S ribosomal protein L29NP_033108(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_357236(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_484210(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_485381(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_895410(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_900023(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_979163(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_986754(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_990228(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_001000972(K)ALVKPQAIKPK(M)   peptide count: 2
A9558RPL2960S ribosomal protein L29XP_995784(K)ALVKPQAIKPK(M)   peptide count: 2
A0742TTNTitinNP_035782(K)ALVPGNIFK(S)   peptide count: 1
A0742TTNTitinNP_082280(K)ALVPGNIFK(S)   peptide count: 1
A7924LARS2Leucyl-tRNA synthetase, mitochondrial precursorNP_694808(K)ALVPGR(D)   peptide count: 3
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorNP_084302(K)ALVSQLHER(A)   peptide count: 45
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)ALVSSVR(Q)   peptide count: 11
A3993ARMC10, SVHArmadillo repeat-containing protein 10NP_080310(K)ALVTLGNNAAFSTNQAIIR(E)   peptide count: 4
A0684SNAP91Clathrin coat assembly protein AP180NP_038697(K)ALVTTHHLMVHGNER(F)   peptide count: 7
A097BTDRD6, TDR2, NY-CO-45TUDOR domain-containing protein 6NP_940810(K)ALVVAK(D)   peptide count: 1
A962BETFB, FP585Electron transfer flavoprotein beta-subunitNP_080971(K)ALVVAK(D)   peptide count: 1
A6688HAO2, HAOX2, GIG16Hydroxyacid oxidase 2NP_062418(K)ALVVTVDAPVLGNR(R)   peptide count: 2
A339ESPERT, CBY2, NURITSpermatid-associated proteinNP_080733(K)ALWENNK(L)   peptide count: 1
A6522FDPS, FPSFarnesyl diphosphate synthaseNP_608219(K)ALYEALDLQSAFFK(Y)   peptide count: 1
A3959MYO1DMyosin IdNP_796364(K)ALYER(K)   peptide count: 1
A7688RIOK2Serine/threonine-protein kinase RIO2NP_080210(K)ALYER(K)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)ALYEYLTAK(N)   peptide count: 21
A6042CPCeruloplasmin precursorNP_001036076(K)ALYFEYTDGTFSK(T)   peptide count: 1
A6042CPCeruloplasmin precursorNP_031778(K)ALYFEYTDGTFSK(T)   peptide count: 1
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorNP_084302(K)ALYGDTLVTGFAR(I)   peptide count: 10
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-likeNP_758512(K)ALYNR(L)   peptide count: 4
A3738SLC25A30, KMCP1Kidney mitochondrial carrier protein 1NP_080508(K)ALYSGIAPAMLR(Q)   peptide count: 1
A3776SLC25A3, PHCSolute carrier family 25 member 3NP_598429(K)ALYSNILGEENTYLWR(T)   peptide count: 179
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorNP_083299(K)ALYTDPK(S)   peptide count: 6
A9674MRPS2728S ribosomal protein S27, mitochondrialNP_776118(K)ALYTLVNK(V)   peptide count: 2
A0242CAV1, CAV, MSTP085Caveolin-1NP_031642(K)AMADEVTEK(Q)   peptide count: 2
A6010Cbr2Carbonyl reductase [NADPH] 2NP_031647(K)AMAMELGPHK(I)   peptide count: 11
A6960ME2NAD-dependent malic enzyme, mitochondrial precursorNP_663469(K)AMASINERPIIFALSNPTAQAECTAEDAYTLTEGR(C)   peptide count: 8
A1508LAMB1Laminin subunit beta-1NP_032508(K)AMDFDRDVLSALAEVEQLSK(M)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AMDFVSQEQGEMTMLYDLFFAFLQTGNYK(E)   peptide count: 4
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorNP_032022(K)AMDNMTVR(V)   peptide count: 19
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorNP_032022(K)AMDNMTVRVPEAVADVR(Q)   peptide count: 1
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AMDSDWFAQNYMGR(K)   peptide count: 16
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AMDSDWFAQNYMGR(K)   peptide count: 16
A369CRRBP1Ribosome-binding protein 1XP_622097(K)AMEALALAER(A)   peptide count: 1
A7363PGAM1, PGAMAPhosphoglycerate mutase 1NP_075907(K)AMEAVAAQGK(V)   peptide count: 4
A7364PGAM2, PGAMMPhosphoglycerate mutase 2NP_061358(K)AMEAVAAQGK(V)   peptide count: 3
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorNP_075830(K)AMEDAHLDAILILGEAFASEEPFDFGTQSTTEK(I)   peptide count: 2
A1007RYR3, HBRRRyanodine receptor 3XP_619795(K)AMEGLK(Q)   peptide count: 1
A8145UGT1A1, UGT1, GNT1UDP-glucuronosyltransferase 1-1 precursor, microsomalNP_964007(K)AMEIAEALGR(I)   peptide count: 3
A8146Ugt1UDP-glucuronosyltransferase 1-2NP_038729(K)AMEIAEALGR(I)   peptide count: 3
A8147UGT1A5, GNT1, UGT1UDP-glucuronosyltransferase 1-5 precursor, microsomalNP_964005(K)AMEIAEALGR(I)   peptide count: 3
A8148UGT1A6, GNT1, UGT1UDP-glucuronosyltransferase 1-6 precursor, microsomalNP_659545(K)AMEIAEALGR(I)   peptide count: 3
A8148UGT1A6, GNT1, UGT1UDP-glucuronosyltransferase 1-6 precursor, microsomalNP_958812(K)AMEIAEALGR(I)   peptide count: 3
A8150Ugt1a7cUDP-glucuronosyltransferase 1-7CNP_964004(K)AMEIAEALGR(I)   peptide count: 3
A8151UGT1A9, GNT1, UGT1UDP-glucuronosyltransferase 1-9 precursor, microsomalNP_964003(K)AMEIAEALGR(I)   peptide count: 3
A8151UGT1A9, GNT1, UGT1UDP-glucuronosyltransferase 1-9 precursor, microsomalNP_964006(K)AMEIAEALGR(I)   peptide count: 3
A8722CLPSColipase precursorNP_079745(K)AMENSECSPK(T)   peptide count: 2
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorNP_075830(K)AMFEEAYSNYCR(M)   peptide count: 3
A498AHIST1H2BB, H2BFFHistone H2B.fNP_783595(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kNP_075911(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kNP_835501(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kNP_835503(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A501AHist1h2bfHistone H2B type 1-F/J/LNP_835502(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A501AHist1h2bfHistone H2B type 1-F/J/LNP_835505(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A501AHist1h2bfHistone H2B type 1-F/J/LNP_835506(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A501AHist1h2bfHistone H2B type 1-F/J/LNP_835508(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A502AHIST1H2BH, H2BFJHistone H2B type 1-HNP_835504(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A504AHIST1H2BC, HIST1H2BK, H2BFTHistone H2B KNP_783596(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A506AHIST1H2BM, H2BFEHistone H2B.eNP_835507(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A509AHist1h2bpHistone H2B type 1-PNP_835509(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A510AHist2h2bbHistone H2B type 2-BNP_783597(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-ENP_835586(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EXP_983129(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A515AHist3h2baHistone H2B type 3-ANP_084358(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A516AHIST3H2BBHistone H2B type 3-BNP_996765(K)AMGIMNSFVNDIFER(I)   peptide count: 28
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AMIAWEWTVEK(A)   peptide count: 1
A728BTSPAN8, TM4SF3Tetraspanin-8NP_666122(K)AMIVFQSEFK(C)   peptide count: 3
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AMKEENVK(T)   peptide count: 58
A4575ANXA4, PIG28, ANX4Annexin A4NP_038499(K)AMKGLGTDEDAIIGILAYR(N)   peptide count: 1
A7199ND5, MTND5, NADH5NADH-ubiquinone oxidoreductase chain 5NP_904338(K)AMLFMCSGSIIHSLADEQDIR(K)   peptide count: 4
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AMLSTGFK(I)   peptide count: 29
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_906671(K)AMLSTGFK(I)   peptide count: 29
A7566CADCarbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotaseNP_076014(K)AMLSTGFK(I)   peptide count: 29
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)AMLSTGFKIPQK(G)   peptide count: 6
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_906671(K)AMLSTGFKIPQK(G)   peptide count: 6
A969CCCDC148Coiled-coil domain-containing protein 148XP_911673(K)AMLTLLEACAAHEMGSLLAKDR(R)   peptide count: 1
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorNP_082519(K)AMLVFAEHR(Y)   peptide count: 3
A768CAK9, AKD1, AKD2Adenylate kinase domain containing 1XP_899424(K)AMNAAGNLKPK(L)   peptide count: 2
A6484FAAH, FAAH1Fatty-acid amide hydrolaseNP_034303(K)AMNLDVVLTPMLGPALDLNAPGR(A)   peptide count: 1
A3938VAPB, UNQ484/PRO983Vesicle-associated membrane protein-associated protein B/CNP_062780(K)AMPSNSPVAALAATGK(E)   peptide count: 1
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)AMQDAEVSK(S)   peptide count: 64
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorXP_896808(K)AMQDAEVSK(S)   peptide count: 64
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorXP_896808(K)AMQDAEVSKSDIEVILVGGMTRTPK(V)   peptide count: 146
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)AMQDAEVSKSDIGEVILVGGMTR(M)   peptide count: 8
A7924LARS2Leucyl-tRNA synthetase, mitochondrial precursorNP_694808(K)AMQDALADLPEWYGIK(G)   peptide count: 10
A9657MRPS528S ribosomal protein S5, mitochondrialNP_084239(K)AMQGLKR(S)   peptide count: 1
A9658MRPS6, RPMS6Mitochondrial 28S ribosomal protein S6NP_536704(K)AMRRPETAAALK(R)   peptide count: 1
A497AHIST1H2BA, TSH2B, STBPHistone H2B, testisNP_783594(K)AMSIMNSFVTDIFER(I)   peptide count: 1
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorNP_080448(K)AMTTFLSTLGAQCVIASR(N)   peptide count: 23
A814DPNMAL1PNMA-like protein 1NP_001007570(K)AMTWASNKIPVPTR(K)   peptide count: 3
A6886LDHAL6B, LDHAL6, LDHLL-lactate dehydrogenase A-like 6BNP_780558(K)AMVAEIIK(H)   peptide count: 6
A1342S100BProtein S100-BNP_033141(K)AMVALIDVFHQYSGR(E)   peptide count: 5
A6577GLDC, GCSPGlycine dehydrogenase [decarboxylating], mitochondrial precursorNP_613061(K)AMVDQHK(E)   peptide count: 2
A3595ALDH1L2Aldehyde dehydrogenase 1 family, member L2NP_705771(K)AMVEAVQLIADGK(A)   peptide count: 2
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorNP_059062(K)AMVENGGLVTGNPLGI(-)   peptide count: 31
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1NP_598768(K)AMVNLQIQK(D)   peptide count: 56
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1NP_598768(K)AMVNLQIQKDNPK(V)   peptide count: 17
A526DHDHD2Haloacid dehalogenase-like hydrolase domain-containing protein 2NP_001034290(K)AMVVGKPEK(T)   peptide count: 2
A526DHDHD2Haloacid dehalogenase-like hydrolase domain-containing protein 2NP_084102(K)AMVVGKPEK(T)   peptide count: 2
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9NP_075661(K)AMYPDYFSK(R)   peptide count: 26
A0381ATP5EATP synthase epsilon chain, mitochondrialNP_080259(K)ANAEKTSGSSIK(I)   peptide count: 3
A3582ACACA, ACAC, ACC1Acetyl-CoA carboxylase 1NP_579938(K)ANAEYIK(M)   peptide count: 1
A3583ACACB, ACC2, ACCBAcetyl-CoA carboxylase 2NP_598665(K)ANAEYIK(M)   peptide count: 1
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorNP_075770(K)ANAGEESVMNLDK(L)   peptide count: 137
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorNP_075770(K)ANAGEESVMNLDKLR(F)   peptide count: 19
A0044GNA11, GA11Guanine nucleotide-binding protein G(Y), alpha subunit 11NP_034431(K)ANALLIR(E)   peptide count: 1
A8213YME1L1, FTSH1, YME1LATP-dependent metalloprotease YME1L1NP_038799(K)ANAPCVIFIDELDSVGGK(R)   peptide count: 2
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)ANAVFEWHITK(G)   peptide count: 1
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorNP_035309(K)ANEDVCQDCMK(L)   peptide count: 4
A0943PHIP, WDR11IRS-1 PH domain binding protein PHIPXP_358384(K)ANEEKDGPTSPKK(K)   peptide count: 1
A0943PHIP, WDR11IRS-1 PH domain binding protein PHIPXP_900529(K)ANEEKDGPTSPKK(K)   peptide count: 1
A0943PHIP, WDR11IRS-1 PH domain binding protein PHIPXP_900589(K)ANEEKDGPTSPKK(K)   peptide count: 1
A0943PHIP, WDR11IRS-1 PH domain binding protein PHIPXP_900632(K)ANEEKDGPTSPKK(K)   peptide count: 1
A0943PHIP, WDR11IRS-1 PH domain binding protein PHIPXP_999437(K)ANEEKDGPTSPKK(K)   peptide count: 1
A5821ARG1Arginase 1NP_031508(K)ANEELAGVVAEVQK(N)   peptide count: 2
A5821ARG1Arginase 1NP_031508(K)ANEELAGVVAEVQKNGR(V)   peptide count: 2
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorNP_031478(K)ANEFHDVNCEVVAVSVDSHFSHLAWINTPR(K)   peptide count: 39
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorNP_031478(K)ANEFHDVNCEVVAVSVDSHFSHLAWINTPR(K)   peptide count: 2
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ANEVEQMIR(D)   peptide count: 1
A6050CHIAAcidic mammalian chitinase precursorNP_075675(K)ANEWLGYDNIK(S)   peptide count: 2
A738DNBEAL1, ALS2CR16, ALS2CR17Neurobeachin-like 1XP_996048(K)ANFENVNSLNKHGK(T)   peptide count: 1
A0635GAD1, GAD, GAD67Glutamate decarboxylase 1, brain, 67kDaNP_032103(K)ANFFR(M)   peptide count: 2
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)ANFKDH(-)   peptide count: 34
A4527TOMM40, PEREC1, TOM40Mitochondrial import receptor subunit TOM40 homologNP_058567(K)ANFLFK(G)   peptide count: 4
A6847Keg1Glycine N-acyltransferase-like protein Keg1NP_083826(K)ANFTVQR(M)   peptide count: 18
A739DNBEAL2, UNQ253/PRO290, SQFE253Neurobeachin-like protein 2XP_982666(K)ANGQMAVSAGSVQGLLGVVR(G)   peptide count: 1
A9553RPL2660S ribosomal protein L26NP_033106(K)ANGTTVHVGIHPSK(V)   peptide count: 2
A7342PDK1, PDHK1Pyruvate dehydrogenase [lipoamide] kinase isozyme 1, mitochondrial precursorNP_766253(K)ANHEADDWCVPSR(E)   peptide count: 1
A0742TTNTitinNP_035782(K)ANIAGATDVK(W)   peptide count: 1
A0742TTNTitinNP_082280(K)ANIAGATDVK(W)   peptide count: 1
A4768DNAH6, DNAHC6, DNHL1Dynein heavy chain 6, axonemalXP_999339(K)ANIASLVDGPFDLPTYGESEK(M)   peptide count: 1
A6109CYP17A1, CYP17, S17AHCytochrome P450 17A1NP_031835(K)ANIDSSIGEFAIPK(D)   peptide count: 1
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorNP_067482(K)ANIIFNTALGTIFGVK(K)   peptide count: 127
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorNP_067482(K)ANIIFNTALGTIFGVKK(Y)   peptide count: 8
A6878LACTB2, CGI-83Lactamase, beta 2NP_663356(K)ANIIYPGHGPVIHNAEAK(I)   peptide count: 8
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorNP_083849(K)ANIMR(M)   peptide count: 6
A0621RAB10Ras-related protein Rab-10NP_057885(K)ANINIEK(A)   peptide count: 11
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8ANP_075615(K)ANINVENAFFTLAR(D)   peptide count: 4
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1NP_058616(K)ANIPIMDTGENPEVPFPR(D)   peptide count: 6
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)ANKFTDTNPQVYHQSSLTPFGVTVYHALR(Q)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904939(K)ANKFTDTNPQVYHQSSLTPFGVTVYHALR(Q)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904947(K)ANKFTDTNPQVYHQSSLTPFGVTVYHALR(Q)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)ANKFTDTNPQVYHQSSLTPFGVTVYHALR(Q)   peptide count: 1
A3954SFXN5Sideroflexin 5NP_848754(K)ANKFTPATR(L)   peptide count: 4
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseNP_077754(K)ANKPGDVVR(A)   peptide count: 39
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorNP_780303(K)ANLENPMR(L)   peptide count: 8
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ANLIILFDK(Y)   peptide count: 2
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ANLQIDQINTDLNLER(S)   peptide count: 2
A9608MRPL37, MRPL2, RPML239S ribosomal protein L37, mitochondrialNP_079776(K)ANLRPQR(F)   peptide count: 6
A4759DNAH1, DHC7, DNAHC1Dynein heavy chain 1, axonemalXP_982687(K)ANLTFAR(C)   peptide count: 1
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNP_035457(K)ANLVFK(E)   peptide count: 12
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNP_035457(K)ANLVFKEIEK(K)   peptide count: 9
A7176NRD1Nardilysin precursorNP_666262(K)ANLVLLSGANEGR(C)   peptide count: 1
A468CSEC22B, SEC22L1Vesicle trafficking protein SEC22BNP_035472(K)ANNLSSLSK(K)   peptide count: 2
A0454DSPDesmoplakinXP_621314(K)ANNSATEAMSKLK(V)   peptide count: 1
A8017TPP2Tripeptidyl-peptidase IINP_033444(K)ANNVDYTVHSVR(R)   peptide count: 1
A9640RPS2340S ribosomal protein S23NP_077137(K)ANPFGGASHAK(G)   peptide count: 10
A9640RPS2340S ribosomal protein S23XP_995532(K)ANPFGGASHAK(G)   peptide count: 10
A8166UGGT1, GT, UGCGL1UDP-glucose:glycoprotein glucosyltransferase 1 precursorNP_942602(K)ANPGAWILR(L)   peptide count: 2
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorNP_034071(K)ANPIQGFSAK(W)   peptide count: 128
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1NP_079613(K)ANPWEGK(S)   peptide count: 1
A7196ND3, NADH3, AD 1NADH-ubiquinone oxidoreductase chain 3NP_904335(K)ANPYECGFDPTSSAR(L)   peptide count: 44
A7199ND5, MTND5, NADH5NADH-ubiquinone oxidoreductase chain 5NP_904338(K)ANPYSSFSTLLGFFPSIIHR(I)   peptide count: 264
A9688LDLRAP1, ARHLDL receptor adaptor protein-1NP_663529(K)ANQEGGDVPGTR(R)   peptide count: 1
A6336DICER1, DICER, HERNAEndoribonuclease DicerNP_683750(K)ANQPQVPNS(-)   peptide count: 1
A7986THUMPD3THUMP domain-containing protein 3NP_032214(K)ANQSAGKEKADCGQGDK(A)   peptide count: 1
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorNP_543120(K)ANRPFLVLIR(E)   peptide count: 2
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)ANSEVAQWR(T)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)ANSEVAQWR(T)   peptide count: 5
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)ANSEVAQWR(T)   peptide count: 5
A3198MYH8Myosin-8NP_796343(K)ANSEVAQWR(T)   peptide count: 5
A3199MYH3Myosin heavy chain, fast skeletal muscle, embryonicXP_354614(K)ANSEVAQWR(T)   peptide count: 5
A3200MYH13Myosin-13XP_618893(K)ANSEVAQWR(T)   peptide count: 5
A3201MYH6, MYHCA, alpha-MHCMyosin-6NP_034986(K)ANSEVAQWR(T)   peptide count: 5
A3202MYH7, MYHCBMyosin-7NP_542766(K)ANSEVAQWR(T)   peptide count: 5
A0429ACO2Aconitate hydratase, mitochondrial precursorNP_542364(K)ANSVRNAVTQEFGPVPDTAR(Y)   peptide count: 1
A0429ACO2Aconitate hydratase, mitochondrial precursorNP_542364(K)ANSVRNAVTQEFGPVPDTAR(Y)   peptide count: 6
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorNP_034552(K)ANSVWGALR(G)   peptide count: 2
A6640GPD1, GPD-C, GPDH-CGlycerol-3-phosphate dehydrogenase [NAD+], cytoplasmicNP_034401(K)ANTIGISLIK(G)   peptide count: 4
A313BARMCX4Armadillo repeat-containing X-linked protein 4XP_910726(K)ANTKTSSQTDALPDAGDKNR(S)   peptide count: 1
A5207TEKT5Tektin-5XP_358761(K)ANTLCIDK(D)   peptide count: 1
A5207TEKT5Tektin-5XP_358761(K)ANTLCIDKDK(C)   peptide count: 3
A5205TEKT3Tektin 3NP_081936(K)ANTLYIDQEK(C)   peptide count: 1
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorNP_080237(K)ANTYEK(Y)   peptide count: 1
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)ANVAKPGLVDDFEK(K)   peptide count: 104
A0387ATP5H, My032ATP synthase D chain, mitochondrialXP_891471(K)ANVAKPGLVDDFEK(K)   peptide count: 104
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)ANVAKPGLVDDFEKK(Y)   peptide count: 72
A0387ATP5H, My032ATP synthase D chain, mitochondrialXP_891471(K)ANVAKPGLVDDFEKK(Y)   peptide count: 72
A0387ATP5H, My032ATP synthase D chain, mitochondrialNP_082138(K)ANVAKPGLVDDFEKKYNALKIPVPEDK(Y)   peptide count: 4
A0387ATP5H, My032ATP synthase D chain, mitochondrialXP_891471(K)ANVAKPGLVDDFEKKYNALKIPVPEDK(Y)   peptide count: 4
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitNP_062798(K)ANVFFK(N)   peptide count: 1
A9641RPS2440S ribosomal protein S24NP_035427(K)ANVGAGK(K)   peptide count: 2
A9641RPS2440S ribosomal protein S24NP_997517(K)ANVGAGK(K)   peptide count: 2
A9641RPS2440S ribosomal protein S24NP_997518(K)ANVGAGK(K)   peptide count: 2
A9641RPS2440S ribosomal protein S24XP_357274(K)ANVGAGK(K)   peptide count: 2
A9641RPS2440S ribosomal protein S24XP_622670(K)ANVGAGK(K)   peptide count: 2
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)ANVQLQQYLADLHEAEAWIK(E)   peptide count: 1
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)ANVQYSHVLER(I)   peptide count: 1
A002AMYOF, FER1L3MyoferlinXP_283556(K)ANVTVLDTQIR(K)   peptide count: 1
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorNP_031408(K)ANWYFLLAR(S)   peptide count: 38
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorNP_033786(K)ANYLSQALQAGTVWINCYDVFGAQSPFGGYK(M)   peptide count: 40
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21ANP_057914(K)ANYQADLANITCEIAIKQKLIDELENSQK(R)   peptide count: 1
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21ANP_057914(K)ANYQADLANITCEIAIKQKLIDELENSQK(R)   peptide count: 2
A5708ADA, ADA1Adenosine deaminaseNP_031424(K)ANYSLNTDDPLIFK(S)   peptide count: 1
A8170UK114, HRSP12, PSPRibonuclease UK114NP_032313(K)APAAIGPYSQAVQVDR(T)   peptide count: 23
A0742TTNTitinNP_035782(K)APADDGGSPITGYLVEK(R)   peptide count: 1
A0742TTNTitinNP_082280(K)APADDGGSPITGYLVEK(R)   peptide count: 1
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorNP_062708(K)APALRILVNSITSLVNTFVPSGK(L)   peptide count: 1
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ANP_058655(K)APAMFNIR(N)   peptide count: 1
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3AXP_999639(K)APAMFNIR(N)   peptide count: 1
A3574BASP1, NAP22Brain acid soluble protein 1NP_081671(K)APAPAAPAAAEPQAEAPAAAASSEQSVAVKE(-)   peptide count: 1
A6989Mcpt2Mast cell protease 2NP_032597(K)APAVFTR(I)   peptide count: 2
A715C Glutaredoxin-like protein YDR286C homologXP_899587(K)APCPLCDEAK(E)   peptide count: 1
A7121CYB5R3, DIA1, B5RDiaphoraseNP_084063(K)APDAWDYSQGFVNEEMIR(D)   peptide count: 6
A7545PTRH2, BIT1, PTH2Peptidyl-tRNA hydrolase 2, mitochondrial precursorNP_778169(K)APDEDTLIQLLTHAK(T)   peptide count: 20
A0326VIL2, EZREzrinNP_033536(K)APDFVFYAPR(L)   peptide count: 3
A0808MSNMoesinNP_034963(K)APDFVFYAPR(L)   peptide count: 3
A0819RDXRadixinNP_033067(K)APDFVFYAPR(L)   peptide count: 3
A775BABCB6, MTABC3, PRPATP-binding cassette half-transporterNP_076221(K)APDIILLDEATSALDTSNER(A)   peptide count: 6
A013ANCSTN, UNQ1874/PRO4317, UNQ1874Nicastrin precursorNP_067620(K)APDVTTLSR(N)   peptide count: 5
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorNP_065640(K)APEDKK(K)   peptide count: 4
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorNP_065640(K)APEDKKK(H)   peptide count: 2
A9678MRPS31, IMOGN3828S ribosomal protein S31, mitochondrial precursorNP_065585(K)APEDPPK(K)   peptide count: 2
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1NP_067431(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1NP_031980(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1NP_001013786(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1XP_356117(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1XP_899511(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1XP_906617(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1XP_906619(K)APEEILAEK(S)   peptide count: 18
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1XP_906623(K)APEEILAEK(S)   peptide count: 18
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3NP_444430(K)APEEILAEK(S)   peptide count: 18
A5360IFT172, SLBIntraflagellar transport protein 172 homologNP_080574(K)APEIHLK(Y)   peptide count: 1
A2454SYNE2, NUA, TROPHNesprin 2XP_922176(K)APEVLSEDILLMKEK(A)   peptide count: 3
A0742TTNTitinNP_035782(K)APEVTAVTK(D)   peptide count: 1
A0742TTNTitinNP_082280(K)APEVTAVTK(D)   peptide count: 1
A7528PSMB2Proteasome subunit beta type 2NP_036100(K)APFAAHGYGAFLTLSILDR(Y)   peptide count: 2
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorNP_031402(K)APFALQVNTLPLNFDK(A)   peptide count: 2
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialNP_694704(K)APGFAHLAGLDK(M)   peptide count: 40
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorNP_034607(K)APGFGDNR(K)   peptide count: 101
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)APGFGDNR(K)   peptide count: 101
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorNP_034607(K)APGFGDNRK(N)   peptide count: 122
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)APGFGDNRK(N)   peptide count: 122
A8196WNK1, PRKWNK1, HSN2Serine/threonine-protein kinase WNK1NP_941992(K)APGIDDIKTLEEK(L)   peptide count: 1
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorNP_031531(K)APGIIPR(I)   peptide count: 244
A0097TLN1, TLNTalin 1NP_035732(K)APGQLECETAIAALNSCLR(D)   peptide count: 1
A9544RPL1860S ribosomal protein L18NP_033103(K)APGTPHSHTKPYVR(S)   peptide count: 2
A8205XPNPEP3Probable XAA-Pro aminopeptidase 3NP_796284(K)APIDEAFLYAK(F)   peptide count: 2
A8762EFHC1EF-hand domain-containing protein 1XP_129694(K)APILTYGPLK(Q)   peptide count: 1
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorNP_083849(K)APIQWEER(N)   peptide count: 65
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKNP_033773(K)APKISMPDLNLNLKGPNVK(G)   peptide count: 2
A3673MAOBAmine oxidase [flavin-containing] BNP_766366(K)APLAEEWDYMTMK(E)   peptide count: 5
A5334FSCBFibrous sheath CABYR-binding proteinXP_892576(K)APLESLPLEEVEK(I)   peptide count: 1
A508CSLC3A1, RBATNeutral and basic amino acid transport protein rBATNP_033231(K)APLHQQAAFR(D)   peptide count: 1
A7190NT5DC3, GNN, TU12B1-TY5'-nucleotidase domain-containing protein 3NP_780540(K)APLLQEAQAK(-)   peptide count: 10
A4814FLNB, FLN3, TAPFilamin-BXP_995248(K)APLNVQFSSPLPGEAVK(D)   peptide count: 2
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)APLTKPVK(K)   peptide count: 35
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)APLTKPVKK(D)   peptide count: 19
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)APLVLEQGLR(G)   peptide count: 70
A7300PARK7, DJ-1RNA-binding protein regulatory subunitNP_065594(K)APLVLKD(-)   peptide count: 20
A6796ISYNA1, INO1Inositol-3-phosphate synthase 1NP_076116(K)APLVPPGSPVVNALFR(Q)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)APMFSWPR(L)   peptide count: 25
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_906671(K)APMFSWPR(L)   peptide count: 25
A7796SERHL, SERHL2Serine hydrolase-like proteinNP_075964(K)APMHFMVDTLR(S)   peptide count: 1
A3589PYGMGlycogen phosphorylase, muscle formNP_035354(K)APNDFNLK(D)   peptide count: 1
A7345PDK3, PDHK3[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial precursorNP_663605(K)APNKPIQVVYVPSHLFHMLFELFK(N)   peptide count: 17
A5842ASS1, ASSArgininosuccinate synthaseNP_031520(K)APNSPDVLEIEFK(K)   peptide count: 2
A5842ASS1, ASSArgininosuccinate synthaseNP_031520(K)APNSPDVLEIEFKK(G)   peptide count: 8
A868CMPC1, BRP44L, CGI-129Brain protein 44-like proteinXP_141624(K)APPDIISGR(M)   peptide count: 2
A868CMPC1, BRP44L, CGI-129Brain protein 44-like proteinXP_993428(K)APPDIISGR(M)   peptide count: 2
A359AE2F3Transcription factor E2F3NP_034223(K)APPETR(L)   peptide count: 2
A7984TSTThiosulfate sulfurtransferaseNP_033463(K)APPETR(L)   peptide count: 2
A794DPOLDIP2, PDIP38, POLD4Polymerase delta-interacting protein 2NP_080665(K)APPFVAR(E)   peptide count: 2
A0742TTNTitinNP_035782(K)APPIEPAPTPIAAPVTAPVVGK(K)   peptide count: 1
A0742TTNTitinNP_082280(K)APPIEPAPTPIAAPVTAPVVGK(K)   peptide count: 1
A0742TTNTitinNP_035782(K)APPVFTQKPPPVGALK(G)   peptide count: 1
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1NP_080218(K)APQAAGK(I)   peptide count: 1
A7919GARSGlycyl-tRNA synthetaseNP_851009(K)APQVDVDR(A)   peptide count: 3
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)APQVSTPTLVEAAR(N)   peptide count: 16
A628AKHDRBS3, SALP, SLM2KH domain-containing, RNA-binding, signal transduction associated protein 3NP_034288(K)APSARTAK(G)   peptide count: 1
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitNP_031626(K)APSDLYQIILKALERGSLLGCSINISDIR(D)   peptide count: 1
A0390ATP5LATP synthase G chain, mitochondrialNP_038823(K)APSMVAAAVTYSKPR(L)   peptide count: 115
A7664RDH13, UNQ736/PRO1430, UNQ736Retinol dehydrogenase 13NP_780581(K)APSPEAEDEEVAR(R)   peptide count: 6
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)APSSLFSAAFLEDVIVDLAHK(F)   peptide count: 5
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorNP_663590(K)APSSSSVGISEWLDQK(L)   peptide count: 33
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorNP_663590(K)APSSSSVGISEWLDQKLTK(S)   peptide count: 2
A3619DDOST, OST48Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit precursorNP_031864(K)APTIVGK(S)   peptide count: 2
A723DMPTX1, MPTXPutative mucosal pentraxin homologNP_079746(K)APTNLPDPAR(I)   peptide count: 1
A581DVWA8Uncharacterized protein KIAA0564XP_001002205(K)APTNVTCILK(T)   peptide count: 2
A0742TTNTitinNP_035782(K)APTVKPGETRVRAEPTPSPQFPFADMPPPDTYK(S)   peptide count: 1
A0742TTNTitinNP_082280(K)APTVKPGETRVRAEPTPSPQFPFADMPPPDTYK(S)   peptide count: 1
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_620758(K)APVITIPQSSVSPNVVIADLGLIR(V)   peptide count: 2
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_904942(K)APVITIPQSSVSPNVVIADLGLIR(V)   peptide count: 2
A687CVPS13CVacuolar protein sorting-associated protein 13CXP_904953(K)APVITIPQSSVSPNVVIADLGLIR(V)   peptide count: 2
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)APVLFSK(E)   peptide count: 4
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2NP_075720(K)APVPGAQNSSQSR(R)   peptide count: 41
A0452CANXCalnexin precursorNP_031623(K)APVPTGEVYFADSFDR(G)   peptide count: 14
A0452CANXCalnexin precursorNP_031623(K)APVPTGEVYFADSFDRGSLSGWILSKAK(K)   peptide count: 1
A361DFAM154APutative uncharacterized protein FAM154AXP_131470(K)APVVYVPPEEK(M)   peptide count: 1
A361DFAM154APutative uncharacterized protein FAM154AXP_904217(K)APVVYVPPEEK(M)   peptide count: 1
A4996MYOM2Myomesin 2NP_032690(K)APVYSGSSPVSGYFVDFK(E)   peptide count: 1
A5242VIL1, VILVillin 1NP_033535(K)APYANTK(R)   peptide count: 1
A6635GPAM, GPAT1Glycerol-3-phosphate acyltransferase 1, mitochondrial precursorNP_032175(K)APYIASGNNLNIPVFSTLIHK(L)   peptide count: 2
A4675CEP95, CCDC45, CEP45Centrosomal protein of 95 kDaNP_796062(K)APYRSHSLSPSSVNK(N)   peptide count: 1
A1941PLEC1, PLECPlectinNP_035247(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AQAELEAQELQR(R)   peptide count: 1
A1941PLEC1, PLECPlectinNP_035247(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958787(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958788(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958789(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958790(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958791(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958792(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958793(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958794(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958795(K)AQAEVEGLGK(G)   peptide count: 2
A1941PLEC1, PLECPlectinNP_958796(K)AQAEVEGLGK(G)   peptide count: 2
A4759DNAH1, DHC7, DNAHC1Dynein heavy chain 1, axonemalXP_982687(K)AQAIADDAQKDLDEALPALDAALASLR(N)   peptide count: 1
A4767DNAH5, DNAHC5, HL1Ciliary dynein heavy chain 5NP_579943(K)AQAIVDSISKDK(A)   peptide count: 1
A787CANKEF1, ANKRD5Ankyrin repeat domain protein 5NP_783598(K)AQALEATLKN(-)   peptide count: 1
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AQALLDEK(Q)   peptide count: 2
A6433ENTPD5, CD39L4, PCPHEctonucleoside triphosphate diphosphohydrolase 5 precursorNP_001021385(K)AQALLLEVEEIFK(N)   peptide count: 1
A6433ENTPD5, CD39L4, PCPHEctonucleoside triphosphate diphosphohydrolase 5 precursorNP_031673(K)AQALLLEVEEIFK(N)   peptide count: 1
A8213YME1L1, FTSH1, YME1LATP-dependent metalloprotease YME1L1NP_038799(K)AQALTQK(T)   peptide count: 3
A8872LAMTOR2, MAPBPIP, ROBLD3Late endosomal/lysosomal Mp1 interacting proteinNP_112538(K)AQALVQYLEEPLTQVAAS(-)   peptide count: 8
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)AQAQPIM(-)   peptide count: 46
A4393TBCB, CG22, CKAP1Tubulin-specific chaperone BNP_079824(K)AQASAISVGSR(C)   peptide count: 1
A9558RPL2960S ribosomal protein L29NP_033108(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_356848(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_484210(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_485381(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_622633(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_900023(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_979163(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_986754(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_990228(K)AQASAPAQAPK(G)   peptide count: 6
A9558RPL2960S ribosomal protein L29XP_995784(K)AQASAPAQAPK(G)   peptide count: 6
A3502AAK1AP2 associated kinase 1NP_001035195(K)AQATPSQPLQSSQPK(Q)   peptide count: 4
A3502AAK1AP2 associated kinase 1NP_808430(K)AQATPSQPLQSSQPK(Q)   peptide count: 4
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorNP_035761(K)AQAYQTGK(D)   peptide count: 4
A5840ASPHJunctinNP_075553(K)AQCEDDLAEK(Q)   peptide count: 1
A9651RPS540S ribosomal protein S5NP_033121(K)AQCPIVER(L)   peptide count: 2
A6957MANBA, MANB1Beta-mannosidase precursorNP_081564(K)AQCSFSWDWGPSFPSQGIWK(D)   peptide count: 1
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AQDEGHLSDIVPFK(V)   peptide count: 7
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AQDEGHLSDIVPFK(V)   peptide count: 7
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AQDEGHLSDIVPFKVPGK(D)   peptide count: 6
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AQDEGHLSDIVPFKVPGK(D)   peptide count: 6
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AQDEGHLSDIVPFKVPGKDTVTK(D)   peptide count: 3
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AQDEGHLSDIVPFKVPGKDTVTK(D)   peptide count: 3
A8845Itln1bIntelectin-1bNP_001007553(K)AQDGLYFLR(T)   peptide count: 3
A9965ITLN1, INTL, ITLNIntelectin 1NP_034714(K)AQDGLYFLR(T)   peptide count: 3
A2454SYNE2, NUA, TROPHNesprin 2XP_922176(K)AQDLTSLLEELK(S)   peptide count: 1
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorNP_031407(K)AQDTAELFFEDVR(L)   peptide count: 58
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorNP_031407(K)AQDTAELFFEDVRLPANALLGEENK(G)   peptide count: 2
A983CCCDC19, NESG1Coiled-coil domain-containing protein 19, mitochondrialXP_355284(K)AQDYQAEQDALR(A)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AQEACGPLEMDSALSVVQNLEKDLQEIK(A)   peptide count: 1
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)AQEANMNLLDEVLK(Q)   peptide count: 4
A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrialNP_038958(K)AQEANMNLLDEVLKQEIR(L)   peptide count: 3
A9711ENKUREnkurinXP_283704(K)AQEEYDNYIQENLK(K)   peptide count: 1
A6813IVDIsovaleryl-CoA dehydrogenase, mitochondrial precursorNP_062800(K)AQEIDQTNDFK(N)   peptide count: 54
A024APrl8a2Decidual/trophoblast prolactin-related proteinNP_034218(K)AQEIELK(F)   peptide count: 7
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)AQEILAR(D)   peptide count: 39
A7109NAALADL1, NAALADASEL, NAALADLN-acetylated-alpha-linked acidic dipeptidase like protein 1NP_001009546(K)AQEINSGSEAWAEVQR(Q)   peptide count: 1
A062BSURF6, SURF-6Surfeit locus protein 6NP_033324(K)AQELEAKMK(W)   peptide count: 1
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)AQELLK(F)   peptide count: 2
A040DCECR5Cat eye syndrome critical region protein 5 precursorNP_659064(K)AQELSDLLR(C)   peptide count: 1
A9865DIABLO, SMACDiablo homolog, mitochondrialNP_075721(K)AQEVSDEGADQEEEAYLR(E)   peptide count: 4
A9865DIABLO, SMACDiablo homolog, mitochondrialNP_075721(K)AQEVSDEGADQEEEAYLRED(-)   peptide count: 29
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)AQFER(D)   peptide count: 1
A3961MYH10, SmembMyosin-10NP_780469(K)AQFER(D)   peptide count: 1
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorNP_444349(K)AQFGQPEILLGTIPGAGGTQR(L)   peptide count: 83
A4021TIMM8B, DDP2, DDPLTranslocase of inner mitochondrial membrane 8 homolog BNP_038925(K)AQFTAQVHHFMELCWDK(C)   peptide count: 1
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorNP_084363(K)AQGHVQK(V)   peptide count: 4
A5531NDUFAF6NADH dehydrogenase (ubiquinone) complex I, assembly factor 6XP_131300(K)AQGIVTCLR(A)   peptide count: 1
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialNP_076135(K)AQGLYETINVTIPAGIQTDQK(I)   peptide count: 2
A613CTIMM50, TIM50, PRO1512Import inner membrane translocase subunit TIM50L mitochondrial precursorNP_079892(K)AQGPQHQPGSEGPSYAK(K)   peptide count: 28
A6477FBP1, FBPFructose-1,6-bisphosphatase 1NP_062268(K)AQGTGELTQLLNSLCTAIK(A)   peptide count: 1
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursorNP_033386(K)AQHPDAK(L)   peptide count: 1
A8201XDH, XDHAXanthine dehydrogenase/oxidaseNP_035853(K)AQHPDAK(L)   peptide count: 1
A171CMYO1A, MYHLMyosin IaXP_483962(K)AQHPLLK(S)   peptide count: 2
A0742TTNTitinNP_035782(K)AQIDVTPVGSK(L)   peptide count: 1
A0742TTNTitinNP_082280(K)AQIDVTPVGSK(L)   peptide count: 1
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorNP_035637(K)AQILAGGR(G)   peptide count: 23
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2NP_034152(K)AQIMNVSWSADHR(V)   peptide count: 10
A4814FLNB, FLN3, TAPFilamin-BXP_995248(K)AQITNPSGASTECFVK(D)   peptide count: 1
A4814FLNB, FLN3, TAPFilamin-BXP_995308(K)AQITNPSGASTECFVK(D)   peptide count: 1
A4295DNAJC13, RME8DnaJ homolog subfamily C member 13XP_135146(K)AQIVKALKAMTR(S)   peptide count: 1
A0619RAB11A, RAB11, 24KGRas-related protein Rab-11ANP_059078(K)AQIWDTAGQER(Y)   peptide count: 5
A084ARAB11B, YPT3Ras-related protein Rab-11BNP_033023(K)AQIWDTAGQER(Y)   peptide count: 5
A3867EPB41L1Band 4.1-like protein 1NP_001003815(K)AQKSPQKIAK(K)   peptide count: 5
A3867EPB41L1Band 4.1-like protein 1NP_001006665(K)AQKSPQKIAK(K)   peptide count: 5
A3867EPB41L1Band 4.1-like protein 1NP_038538(K)AQKSPQKIAK(K)   peptide count: 5
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35NP_075373(K)AQLAAITLIIGTFER(M)   peptide count: 5
A1941PLEC1, PLECPlectinNP_035247(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AQLEPVASPAK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AQLEPVASPAK(K)   peptide count: 1
A0273PPP1R9B, PPP1R6Neurabin-2NP_758465(K)AQLEQSVEENKER(M)   peptide count: 1
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_001004829(K)AQLEVGFPPVLER(Y)   peptide count: 9
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_109592(K)AQLEVGFPPVLER(Y)   peptide count: 9
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_897453(K)AQLEVGFPPVLER(Y)   peptide count: 9
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_905172(K)AQLEVGFPPVLER(Y)   peptide count: 9
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_905174(K)AQLEVGFPPVLER(Y)   peptide count: 9
A4287COQ10A, UNQ6192/PRO20219, RFLT6192Coenzyme Q-binding protein COQ10 homolog A mitochondrial precursorXP_905183(K)AQLEVGFPPVLER(Y)   peptide count: 9
A074ARAB24, PP4748Ras-related protein Rab-24NP_033026(K)AQLFETSSK(T)   peptide count: 9
A7113ART3, TMARTEcto-ADP-ribosyltransferase 3 precursorNP_859417(K)AQLFLPR(N)   peptide count: 1
A015ANLRX1, NOD26, NOD5NLR family member X1NP_848507(K)AQLLR(V)   peptide count: 1
A3812RPL860S ribosomal protein L8NP_036183(K)AQLNIGNVLPVGTMPEGTIVCCLEEKPGDR(G)   peptide count: 1
A6125CYP27A1, CYP27Cytochrome P450 27, mitochondrial precursorNP_077226(K)AQLQETGPDGVR(V)   peptide count: 11
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorNP_083058(K)AQLSAAVLTLLIK(Q)   peptide count: 102
A5366ISCA1, HBLD2, GK004Iron-sulfur cluster assembly 1 homolog, mitochondrialNP_081197(K)AQLTLLGTEMDYVEDK(L)   peptide count: 1
A5366ISCA1, HBLD2, GK004Iron-sulfur cluster assembly 1 homolog, mitochondrialXP_484225(K)AQLTLLGTEMDYVEDK(L)   peptide count: 1
A5366ISCA1, HBLD2, GK004Iron-sulfur cluster assembly 1 homolog, mitochondrialNP_081197(K)AQLTLLGTEMDYVEDKLSSEFVFNNPNIK(G)   peptide count: 2
A5366ISCA1, HBLD2, GK004Iron-sulfur cluster assembly 1 homolog, mitochondrialXP_484225(K)AQLTLLGTEMDYVEDKLSSEFVFNNPNIK(G)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aNP_038749(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_620604(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_193790(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_903693(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_486245(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_892272(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_911331(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aXP_990387(K)AQLVVIAHDVDPIELVVFLPALCR(K)   peptide count: 2
A0238STXBP1, UNC18A, stxbp1Syntaxin binding protein 1NP_033321(K)AQMKNPILER(L)   peptide count: 3
A7924LARS2Leucyl-tRNA synthetase, mitochondrial precursorNP_694808(K)AQNLWEYK(N)   peptide count: 3
A5690ACSF2, UNQ493/PRO1009, UNQ493Acyl-CoA synthetase family member 2, mitochondrial precursorNP_722502(K)AQPGALK(S)   peptide count: 5
A5690ACSF2, UNQ493/PRO1009, UNQ493Acyl-CoA synthetase family member 2, mitochondrial precursorNP_722502(K)AQPGALKSER(L)   peptide count: 1
A3990CASKIN1Cask-interacting protein 1NP_082213(K)AQPGSPQALGGPHGPATAK(V)   peptide count: 1
A842BATP4BPotassium-transporting ATPase beta chainNP_033854(K)AQPHYSNPLVAAK(L)   peptide count: 3
A2468ENPP3, PDNP3Ectonucleotide pyrophosphatase/phosphodiesterase 3NP_598766(K)AQPVSQILQLK(T)   peptide count: 2
A9673MRPS26, RPMS1328S ribosomal protein S26, mitochondrial precursorNP_997090(K)AQQAITEHR(E)   peptide count: 6
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)AQQALVQK(R)   peptide count: 147
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)AQQALVQKR(H)   peptide count: 20
A1144SCAMP1, SCAMPSecretory carrier-associated membrane protein 1NP_083429(K)AQQEFATGVMSNK(T)   peptide count: 3
A1144SCAMP1, SCAMPSecretory carrier-associated membrane protein 1NP_083429(K)AQQEFATGVMSNKTVQTAAANAASTAATSAAQNAFK(G)   peptide count: 1
A345BCCDC90B, CUA003, MDS011Coiled-coil domain-containing protein 90B, mitochondrialNP_079791(K)AQQEITVQQLMAHLDSIR(K)   peptide count: 5
A345BCCDC90B, CUA003, MDS011Coiled-coil domain-containing protein 90B, mitochondrialNP_079791(K)AQQEITVQQLMAHLDSIRK(D)   peptide count: 1
A9105THEM4, CTMPThioesterase superfamily member 4NP_083707(K)AQQFTR(S)   peptide count: 8
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_001037854(K)AQQGIVFLDEVDK(I)   peptide count: 2
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_035932(K)AQQGIVFLDEVDK(I)   peptide count: 2
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_001037854(K)AQQGIVFLDEVDKIGSVPGIHQLR(D)   peptide count: 3
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_035932(K)AQQGIVFLDEVDKIGSVPGIHQLR(D)   peptide count: 3
A1467FGAFibrinogen alpha/alpha-E chain precursorNP_034326(K)AQQIQALQSNVR(A)   peptide count: 5
A9653RPS740S ribosomal protein S7NP_035430(K)AQQNNVEHK(V)   peptide count: 1
A9653RPS740S ribosomal protein S7XP_894928(K)AQQNNVEHK(V)   peptide count: 1
A9653RPS740S ribosomal protein S7NP_035430(K)AQQNNVEHKVETFSGVYK(K)   peptide count: 1
A9653RPS740S ribosomal protein S7XP_894928(K)AQQNNVEHKVETFSGVYK(K)   peptide count: 1
A1941PLEC1, PLECPlectinNP_035247(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958787(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958788(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958789(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958790(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958791(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958792(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958793(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958794(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958795(K)AQQVEAAER(S)   peptide count: 3
A1941PLEC1, PLECPlectinNP_958796(K)AQQVEAAER(S)   peptide count: 3
A0098VCLVinculinNP_033528(K)AQQVSQGLDVLTAK(V)   peptide count: 2
A9676DAP3, MRPS2928S ribosomal protein S29, mitochondrialNP_075370(K)AQSALGLFHLLVAVDGVNALWGR(T)   peptide count: 4
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_663335(K)AQSDGIWGEHEVDYILFLR(K)   peptide count: 6
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1NP_808875(K)AQSDGIWGEHEVDYILFLR(K)   peptide count: 6
A0380ATP5DATP synthase delta chain, mitochondrial precursorNP_079589(K)AQSELSGAADEAAR(A)   peptide count: 165
A5700ACSS3Acyl-CoA synthetase short-chain family member 3 mitochondrialNP_941038(K)AQSHDCVPVLSEHPLYILYTSGTTGLPK(G)   peptide count: 1
A1701PRG2, MBPEosinophil granule major basic protein precursorNP_032946(K)AQSVCR(R)   peptide count: 1
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)AQTEEDDLQEPK(G)   peptide count: 2
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)AQTEEDDLQEPKGDLTES(-)   peptide count: 1
A3962MYH14, FP17425Myosin-14NP_082297(K)AQTSAAGQGKEEAVK(Q)   peptide count: 2
A1481HINT1, HINT, PKCI1Histidine triad nucleotide-binding protein 1NP_032274(K)AQVAQPGGDTIFGK(I)   peptide count: 15
A3584FASN, FASFatty acid synthaseNP_032014(K)AQVEDAFR(Y)   peptide count: 4
A1941PLEC1, PLECPlectinNP_035247(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958787(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958788(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958789(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958790(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958791(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958792(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958793(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958794(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958795(K)AQVEQELTTLR(L)   peptide count: 1
A1941PLEC1, PLECPlectinNP_958796(K)AQVEQELTTLR(L)   peptide count: 1
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorNP_035636(K)AQVLAGGR(G)   peptide count: 105
A7904SUOXSulfite oxidase, mitochondrial precursorNP_776094(K)AQVPAEQK(E)   peptide count: 14
A7919GARSGlycyl-tRNA synthetaseNP_851009(K)AQVTGQSAR(K)   peptide count: 3
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AQVTTIENAEER(L)   peptide count: 3
A2481ARSAArylsulfatase A precursorNP_033843(K)AQYDAAMTFGPSQIAK(G)   peptide count: 1
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6NP_034797(K)AQYDDIASR(S)   peptide count: 1
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3NP_001003668(K)AQYDDIASR(S)   peptide count: 1
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2NP_444479(K)AQYDDIASR(S)   peptide count: 1
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralNP_001028349(K)AQYEDIAQK(S)   peptide count: 146
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralNP_001028349(K)AQYEDIAQKSK(A)   peptide count: 1
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BNP_034799(K)AQYEDIAQR(S)   peptide count: 6
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6ANP_032502(K)AQYEDIAQR(S)   peptide count: 6
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)AQYPIADLVK(M)   peptide count: 7
A7386GPLD1, PIGPLD1, GPIPLDMPhosphatidylinositol-glycan-specific phospholipase D 1 precursorNP_032182(K)AQYVLTSPEASSR(F)   peptide count: 2
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorNP_084302(K)AQYVR(L)   peptide count: 3
A4776EDIL3, DEL1Integrin-binding protein DEL1 precursorNP_001033076(K)AQYVR(L)   peptide count: 3
A4776EDIL3, DEL1Integrin-binding protein DEL1 precursorNP_034233(K)AQYVR(L)   peptide count: 3
A4796FAM110CProtein FAM110CNP_082104(K)AQYVR(L)   peptide count: 3
A647BTMEM145Transmembrane protein 145NP_899134(K)AQYVR(L)   peptide count: 3
A8043TRPM7, CHAK1, LTRPC7Channel-kinase 1NP_067425(K)AQYVR(L)   peptide count: 3
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4NP_001033027(K)AREDFIK(E)   peptide count: 16
A6516FMO5Flavin-containing monooxygenase 5NP_034362(K)AREEMAK(R)   peptide count: 1
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)ARESYVETELIFALAK(T)   peptide count: 2
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorNP_031756(K)AREVTLPLPRPQDVK(L)   peptide count: 1
A135CABCC3, MRP3, CMOAT2ATP-binding cassette, sub-family C, member 3NP_083876(K)AREYSK(E)   peptide count: 3
A209EQIL1QIL1 proteinNP_694792(K)AREYSK(E)   peptide count: 3
A2276KCTD7BTB/POZ domain-containing protein KCTD7NP_766097(K)ARFAKLK(V)   peptide count: 1
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorNP_666253(K)ARNDEYENLFNMVVEIPR(W)   peptide count: 2
A022EApol7cApolipoprotein L 7cNP_780600(K)ARNLVPTNK(D)   peptide count: 1
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorNP_035086(K)ARNMEEEVAITR(I)   peptide count: 7
A0028ARHGAP5, RHOGAP5Rho-GTPase-activating protein 5NP_033836(K)ARNTFSK(H)   peptide count: 6
A1552APOA1, A175PApolipoprotein A-I precursorNP_033822(K)ARPALEDLR(H)   peptide count: 2
A3589PYGMGlycogen phosphorylase, muscle formNP_035354(K)ARPEFTLPVHFYGR(V)   peptide count: 2
A556BOTOP3Otopetrin 3NP_081247(K)ARPELEELLAK(L)   peptide count: 26
A9618MRPL48, CGI-118, HSPC29039S ribosomal protein L48, mitochondrialNP_942128(K)ARPELEELLAK(L)   peptide count: 26
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorNP_075830(K)ARPESKPHK(Q)   peptide count: 2
A1119RELNReelin precursorNP_035391(K)ARSGSTRLR(W)   peptide count: 1
A8205XPNPEP3Probable XAA-Pro aminopeptidase 3NP_796284(K)ARSKNKVR(S)   peptide count: 1
A2032MORF4L2, MRGXTranscription factor-like protein MRGXXP_205276(K)ARSVSSPR(K)   peptide count: 1
A2032MORF4L2, MRGXTranscription factor-like protein MRGXXP_285437(K)ARSVSSPR(K)   peptide count: 1
A2032MORF4L2, MRGXTranscription factor-like protein MRGXXP_488332(K)ARSVSSPR(K)   peptide count: 1
A4833GABARAPL1, GEC1GABA-A receptor-associated protein like 1NP_065615(K)ARVPDLDK(R)   peptide count: 1
A3617ENO3Beta enolaseNP_031959(K)ARYLGKGVLK(A)   peptide count: 1
A783ANOM1Nucleolar MIF4G domain-containing protein 1NP_001028629(K)ASAAQPKAK(A)   peptide count: 3
A1547SERPINE2, PI7, PN1Glia derived Nexin precursorNP_033281(K)ASAATTAILIAR(S)   peptide count: 1
A0067GNG12Guanine nucleotide-binding protein G(i)/G(s)/G(o) gamma-12 subunitNP_079554(K)ASADLMSYCEEHAR(S)   peptide count: 2
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)ASAELALGENNEVLK(S)   peptide count: 85
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)ASAELALGENNEVLK(S)   peptide count: 22
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)ASAELALGENNEVLKSGR(F)   peptide count: 1
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorNP_084501(K)ASAFALQEQPVVNAVIDDATK(E)   peptide count: 95
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorNP_084501(K)ASAFALQEQPVVNAVIDDATKEVVYR(D)   peptide count: 3
A0097TLN1, TLNTalin 1NP_035732(K)ASAGPQPLLVQSCK(A)   peptide count: 5
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialNP_663589(K)ASALACLK(V)   peptide count: 33
A489EWDR52WD repeat-containing protein 52XP_996305(K)ASALLELPKPVEFEK(A)   peptide count: 1
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseNP_077754(K)ASANMDLMR(A)   peptide count: 8
A9677MRPS30, PDCD9, BM-04728S ribosomal protein S30, mitochondrialNP_067531(K)ASATAPEVR(D)   peptide count: 7
A4729CRYBB1Beta crystallin B1NP_076184(K)ASATTAVNPGPDGK(G)   peptide count: 1
A835DPROSCProline synthetase co-transcribed bacterial homolog proteinNP_473398(K)ASCPSLEFVGLMTIGSFGHDLSQGPNPDFQR(L)   peptide count: 2
A0098VCLVinculinNP_033528(K)ASDEVTR(L)   peptide count: 1
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)ASDLENWIK(T)   peptide count: 1
A258D Uncharacterized protein CXorf22XP_916479(K)ASDLYCEYLSQQK(V)   peptide count: 1
A4527TOMM40, PEREC1, TOM40Mitochondrial import receptor subunit TOM40 homologNP_058567(K)ASDQLQVGVEFEASTR(M)   peptide count: 10
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)ASDTSITWNNLK(G)   peptide count: 5
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseNP_795937(K)ASDVVLGFAELEGYLQK(Q)   peptide count: 1
A069CKIF3CKinesin-like protein KIF3CNP_032471(K)ASEALK(V)   peptide count: 1
A792AURB1, NPA1, NOP254Nucleolar preribosomal-associated protein 1XP_489612(K)ASEGPSSAASPAGTVKR(T)   peptide count: 1
A0742TTNTitinNP_035782(K)ASETPGPVVDLK(A)   peptide count: 1
A0742TTNTitinNP_082280(K)ASETPGPVVDLK(A)   peptide count: 1
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2NP_056644(K)ASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIK(T)   peptide count: 28
A5016ODF2Outer dense fiber of sperm tails 2NP_038643(K)ASFAPMEDKLNQAHLEVQQLK(A)   peptide count: 1
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)ASFASDPANQIVK(E)   peptide count: 1
A723AMRPP3Mitochondrial ribonuclease P protein 3XP_891041(K)ASFEDFIISQMAR(N)   peptide count: 1
A3512MRAS, RRAS3Ras-related protein M-RasNP_032650(K)ASFEHVDR(F)   peptide count: 1
A9710ECSIT, SITPECECSITNP_036159(K)ASFLNAVR(S)   peptide count: 1
A3749SLC25A18, GC2Mitochondrial glutamate carrier 2XP_110620(K)ASFTHSFVAGCTAGSVAAVAVTPLDVLK(T)   peptide count: 4
A8048TXNRD2, TRXR2Thioredoxin reductase 2, mitochondrial precursorNP_038739(K)ASFVDEHTVR(G)   peptide count: 25
A6760HK2Hexokinase, type IINP_038848(K)ASGCEGEDVVTLLK(E)   peptide count: 2
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2NP_056644(K)ASGDAARPFLLQLAESAYR(F)   peptide count: 24
A7505PRODH, PIG6, POX2Proline oxidase, mitochondrial precursorNP_035302(K)ASGGASDGGFSAIK(L)   peptide count: 13
A0097TLN1, TLNTalin 1NP_035732(K)ASGHPGDPESQQR(L)   peptide count: 2
A3479VDAC3Voltage-dependent anion-selective channel protein 3NP_035826(K)ASGNLETK(Y)   peptide count: 28
A4127GPSM2, LGNMosaic protein LGNNP_083798(K)ASGNLGNTLK(V)   peptide count: 1
A4127GPSM2, LGNMosaic protein LGNNP_083798(K)ASGNLGNTLK(V)   peptide count: 1
A5349GPSM1, AGS3G-protein signaling modulator 1 (AGS3-like, C. elegans)NP_700459(K)ASGNLGNTLK(V)   peptide count: 1
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)NP_035533(K)ASGPGAAAQIQEVK(E)   peptide count: 4
A2345CLIP-170, CLIP1, CYLN1CAP-GLY domain-containing linker protein 1NP_062739(K)ASGPPSSETQEEFVDDFR(V)   peptide count: 1
A721CZG16, ZG16PZymogen granule membrane protein 16NP_081194(K)ASGTSFNAVPLHPNTVLR(F)   peptide count: 13
A721CZG16, ZG16PZymogen granule membrane protein 16NP_081194(K)ASGTSFNAVPLHPNTVLR(F)   peptide count: 3
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1NP_034568(K)ASGVEGADVVK(L)   peptide count: 48
A7489PPM1K, PP2CM, UG0882E07Protein phosphatase 1K, mitochondrial precursorNP_780732(K)ASGVIAEPETTR(I)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_486454(K)ASGYTFTDYYINWVK(Q)   peptide count: 2
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_138377(K)ASGYTFTDYYINWVK(Q)   peptide count: 2
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_892273(K)ASGYTFTDYYINWVK(Q)   peptide count: 2
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_138341(K)ASGYTFTDYYMNWVK(Q)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899918(K)ASGYTFTDYYMNWVK(Q)   peptide count: 3
A3910NAPB, SNAPBBeta-soluble NSF attachment proteinNP_062606(K)ASHSFLR(G)   peptide count: 1
A205DCRYBG3Beta/gamma crystallin domain-containing protein 3NP_777273(K)ASHTCLDVIGGR(D)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ASIAALEAK(I)   peptide count: 7
A3987SGIP1SH3-containing GRB2-like protein 3-interacting protein 1NP_659155(K)ASIGNIALSPSPVR(K)   peptide count: 1
A2341ACTN1Alpha-actinin 1NP_598917(K)ASIHEAWTDGK(E)   peptide count: 1
A2344ACTN4Alpha-actinin 4NP_068695(K)ASIHEAWTDGK(E)   peptide count: 1
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7NP_035421(K)ASINMLR(I)   peptide count: 1
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7XP_195832(K)ASINMLR(I)   peptide count: 1
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7XP_902311(K)ASINMLR(I)   peptide count: 1
A0742TTNTitinNP_035782(K)ASINVLDLIIPPSFTK(K)   peptide count: 1
A3515SEPT2, DIFF6, NEDD5Septin-2NP_035021(K)ASIPFSVVGSNQLIEAK(G)   peptide count: 1
A299DDNHD1, CCDC35, DHCD1Dynein heavy chain domain-containing protein 1XP_913886(K)ASKNISTINPTKPLLLGGGFFEKHQVSMR(L)   peptide count: 1
A7616Prss51MCG15876XP_001003262(K)ASKSLLAGSPR(Y)   peptide count: 1
A7616Prss51MCG15876XP_001003265(K)ASKSLLAGSPR(Y)   peptide count: 1
A3469ATP4APotassium-transporting ATPase alpha chain 1NP_061201(K)ASLAAELLLR(D)   peptide count: 4
A6409EHHADH, ECHDPeroxisomal bifunctional enzymeNP_076226(K)ASLDHTVR(A)   peptide count: 14
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)ASLDMFNQK(T)   peptide count: 34
A3611RPN2Ribophorin IINP_062616(K)ASLDRPFTDLESAFYSIVGLSSLGVQVPDVK(K)   peptide count: 22
A3611RPN2Ribophorin IINP_062616(K)ASLDRPFTDLESAFYSIVGLSSLGVQVPDVKK(A)   peptide count: 7
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16NP_032496(K)ASLENSLEETK(G)   peptide count: 2
A2343ACTN3Alpha-actinin 3NP_038484(K)ASLHEAWTR(G)   peptide count: 1
A448AFYCO1, ZFYVE7FYVE and coiled-coil domain containing 1NP_683727(K)ASLLGSKKDYWDYFCACLAK(V)   peptide count: 1
A4771DNAH9, DNAH17L, DNAL1Dynein heavy chain 9, axonemalXP_110968(K)ASLLNTIK(K)   peptide count: 2
A5674Acot3Acyl-coenzyme A thioesterase 3NP_599007(K)ASLNSLVGGPVIWGGEPR(A)   peptide count: 1
A438AFOXO1, FKHR, FOXO1AForkhead box protein O1NP_062713(K)ASLQSGQEGPGDSPGSQFSK(W)   peptide count: 1
A5643ABHD10Abhydrolase domain-containing protein 10, mitochondrial precursorNP_766099(K)ASLSFLNR(S)   peptide count: 4
A5643ABHD10Abhydrolase domain-containing protein 10, mitochondrial precursorNP_766099(K)ASLSFLNRSELPNLAYK(R)   peptide count: 1
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1NP_058661(K)ASLSLADHR(E)   peptide count: 3
A3994CHCHD6, CHCM1Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialNP_079627(K)ASLTHEQQQSAR(L)   peptide count: 27
A0625MAP1BMicrotubule-associated protein 1BNP_032660(K)ASLTLFCPEEGDWK(N)   peptide count: 1
A891DGm561Gene model 561, (NCBI)NP_001028469(K)ASLWYR(R)   peptide count: 4
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)ASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSR(I)   peptide count: 2
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)ASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSR(I)   peptide count: 10
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)ASMVLFLDR(V)   peptide count: 2
A369CRRBP1Ribosome-binding protein 1XP_622097(K)ASMVQSQEAPK(Q)   peptide count: 1
A124CSLC16A7, MCT2Monocarboxylate transporter 2NP_035521(K)ASNAHNPPSDRDKESNI(-)   peptide count: 5
A9977LRBA, BGL, CDC4LLipopolysaccharide-responsive and beige-like anchor proteinNP_109620(K)ASNMTQR(W)   peptide count: 1
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorNP_059062(K)ASNTSEVYFDGVK(V)   peptide count: 40
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorNP_059062(K)ASNTSEVYFDGVKVPSENVLGEVGDGFK(V)   peptide count: 2
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_001070732(K)ASPDLVPMGEWTAR(V)   peptide count: 1
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_031484(K)ASPDLVPMGEWTAR(V)   peptide count: 1
A5763ALDH3A2, ALDH10, FALDHFatty aldehyde dehydrogenaseNP_031463(K)ASPDYER(I)   peptide count: 1
A7452PNPT1, PNPASE, OLD35Polyribonucleotide nucleotidyltransferase 1, mitochondrial precursorNP_082145(K)ASPSQFMPLVVDYR(Q)   peptide count: 13
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalXP_981247(K)ASPYSGAFPSTPVK(E)   peptide count: 1
A0163MAPK8, JNK1, PRKM8Mitogen-activated protein kinase 8NP_057909(K)ASQARDLLSK(M)   peptide count: 1
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_916389(K)ASQDINSYLSWFQQKPGK(S)   peptide count: 4
A9611MRPL40, NLVCF, URIM39S ribosomal protein L40, mitochondrial precursorNP_035052(K)ASQELIPIEDFITPVR(F)   peptide count: 20
A9610MRPL39, MRPL5, RPML539S ribosomal protein L39, mitochondrialNP_059100(K)ASQNPERIVKLHR(I)   peptide count: 1
A5306DAAM2Disheveled associated activator of morphogenesis 2NP_001008232(K)ASRSMVSATGAKK(E)   peptide count: 1
A3491EDG1, S1PR1, CHEDG1Sphingosine 1-phosphate receptor 1NP_031927(K)ASRSSEK(S)   peptide count: 7
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorNP_035086(K)ASRSSEK(S)   peptide count: 7
A3665OGDHL2-oxoglutarate dehydrogenase E1 component-like, mitochondrial precursorXP_138959(K)ASRSSEK(S)   peptide count: 7
A0229ARPC1B, ARC41ARP2/3 complex 41 kDa subunitNP_075631(K)ASSEGGAATGAGLDSLHK(N)   peptide count: 1
A0229ARPC1B, ARC41ARP2/3 complex 41 kDa subunitXP_486686(K)ASSEGGAATGAGLDSLHK(N)   peptide count: 1
A6981MCEEMethylmalonyl-CoA epimerase, mitochondrial precursorNP_082902(K)ASSFYR(D)   peptide count: 7
A4108DLGAP5, DLG7Disks large-associated protein 5NP_653136(K)ASSKTR(S)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)ASSLIEEAKK(A)   peptide count: 2
A1162RGS10Regulator of G-protein signaling 10NP_080694(K)ASSQVNVEGQSR(L)   peptide count: 10
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alphaNP_001001983(K)ASSSAGNLGVLIPVIAVLTR(R)   peptide count: 6
A7111NAPSA, NAP1, NAPANapsin 1 precursorNP_032463(K)ASSSFRPNGTK(F)   peptide count: 1
A602CTHOC2THO complex subunit 2XP_891456(K)ASSTTPKGNSSNGNSGSNSNK(A)   peptide count: 3
A9676DAP3, MRPS2928S ribosomal protein S29, mitochondrialNP_075370(K)ASTEEGRK(E)   peptide count: 1
A2071IFT122, WDR10, SPGWD-repeat domain-containing protein 10NP_112454(K)ASTFPVHQQK(L)   peptide count: 1
A1899CLDN18, UNQ778/PRO1572, UNQ778Claudin-18NP_062789(K)ASTGFGSNTR(N)   peptide count: 3
A0117NSFVesicle-fusing ATPaseNP_032766(K)ASTKVEVDMEK(A)   peptide count: 1
A4765DNAH2, DNAHC2, DNHD3Dynein heavy chain 2, axonemalXP_899789(K)ASTLTIGWK(A)   peptide count: 1
A9977LRBA, BGL, CDC4LLipopolysaccharide-responsive and beige-like anchor proteinNP_109620(K)ASTSTEAPQPQR(H)   peptide count: 1
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalXP_981247(K)ASTYSNAFPSTPVNK(L)   peptide count: 1
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalXP_981215(K)ASTYSNAFPSTPVNK(L)   peptide count: 1
A080ARAP2BRas-related protein Rap-2bNP_082988(K)ASVDELFAEIVR(Q)   peptide count: 5
A0154ITPR1, INSP3R1Inositol 1,4,5-trisphosphate receptor type 1NP_034715(K)ASVESCIR(A)   peptide count: 1
A4470ITPR2Inositol 1,4,5-trisphosphate receptor type 2NP_034716(K)ASVESCIR(A)   peptide count: 1
A4470ITPR2Inositol 1,4,5-trisphosphate receptor type 2NP_064307(K)ASVESCIR(A)   peptide count: 1
A5967CA5A, CA5Carbonic anhydrase 5ANP_031634(K)ASVGENGLAVIGVFLK(L)   peptide count: 2
A681CHDLBP, HBP, VGLVigilinNP_598569(K)ASVITQVFHVPLEER(K)   peptide count: 1
A5016ODF2Outer dense fiber of sperm tails 2NP_038643(K)ASVKNYEGMIDNYKSQVMK(T)   peptide count: 4
A0173VAV1, VAVVav proto-oncogeneNP_035821(K)ASVNLHSFQVR(D)   peptide count: 1
A8909OMPOlfactory marker proteinNP_035140(K)ASVVFNQL(-)   peptide count: 6
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)ASVVTLPVYLNFTR(A)   peptide count: 1
A6934LYPLAL1Lysophospholipase-like 1NP_666218(K)ASVVYQDLQQGGR(M)   peptide count: 8
A617D WD repeat-containing protein KIAA1875XP_895966(K)ASWADR(V)   peptide count: 1
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)ASWILTEDHSFEDR(M)   peptide count: 2
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10NP_034253(K)ASWRAEK(D)   peptide count: 1
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinNP_573479(K)ASYAVSEAIPK(D)   peptide count: 1
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2NP_075720(K)ASYGVEDPEYAVTQLAQTTMR(S)   peptide count: 7
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteNP_035595(K)ASYGYHR(F)   peptide count: 1
A3479VDAC3Voltage-dependent anion-selective channel protein 3NP_035826(K)ASYRR(D)   peptide count: 1
A685CVPS13A, CHACChoreinNP_766616(K)ASYVIVPQYGNFSPTSNLLLLDLGHLK(V)   peptide count: 1
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1NP_032892(K)ATAAVIFLHGLGDTGHGWAEAFAGIK(S)   peptide count: 7
A6410DCI, ECI13,2-trans-enoyl-CoA isomerase, mitochondrial precursorNP_034153(K)ATADNLIK(Q)   peptide count: 18
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorNP_080448(K)ATAEEISSK(T)   peptide count: 78
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorNP_080448(K)ATAEEISSKTGNK(V)   peptide count: 1
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)ATAEQLK(T)   peptide count: 2
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)ATAEQLK(T)   peptide count: 2
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)ATAEQLK(T)   peptide count: 2
A4771DNAH9, DNAH17L, DNAL1Dynein heavy chain 9, axonemalXP_110968(K)ATAEQLK(T)   peptide count: 2
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1NP_034608(K)ATAGDTHLGGEDFDNR(L)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1XP_001002795(K)ATAGDTHLGGEDFDNR(L)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1XP_001002803(K)ATAGDTHLGGEDFDNR(L)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1NP_034609(K)ATAGDTHLGGEDFDNR(L)   peptide count: 1
A2008HSPA1LHeat shock 70 kDa protein 1-HOMNP_038586(K)ATAGDTHLGGEDFDNR(L)   peptide count: 1
A5742AFG3L2AFG3-like protein 2NP_081406(K)ATAGEANVPFITVSGSEFLEMFVGVGPAR(V)   peptide count: 4
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)ATALPQFTNDSLEENQVTVEK(E)   peptide count: 1
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorNP_036149(K)ATAQDNPK(S)   peptide count: 4
A3534HSPA12A, THYRO1001365Heat shock 70 kDa protein 12ANP_780408(K)ATAVDITTSK(S)   peptide count: 1
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1NP_035164(K)ATAVMPDGQFK(D)   peptide count: 11
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1NP_035164(K)ATAVMPDGQFKDISLSEYKGK(Y)   peptide count: 2
A5265ADAM5P, ADAM5, TMDC2Putative Disintegrin and metalloproteinase domain containing protein 5NP_031427(K)ATCGSGECCSQDCTVK(M)   peptide count: 1
A3965TPM1, TMSATropomyosin 1 alpha chainNP_077745(K)ATDAEADVASLNR(R)   peptide count: 1
A5222TPM2, TMSB, TPM2bTropomyosin beta chainNP_033442(K)ATDAEADVASLNR(R)   peptide count: 1
A6730HKDC1Putative Hexokinase HKDC1NP_663394(K)ATDCEGEDVVDMLR(E)   peptide count: 1
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1NP_034568(K)ATDCVGHDVATLLR(D)   peptide count: 46
A9693CCDC40Coiled-coil domain-containing protein 40NP_780639(K)ATDDCTNTISELEETQK(F)   peptide count: 1
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorNP_766599(K)ATDFVVDR(A)   peptide count: 58
A0797AKAP3, AKAP110, SOB1A-kinase anchor protein 3NP_033780(K)ATDIMDAMLGK(L)   peptide count: 3
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformNP_038635(K)ATDKSFVEK(V)   peptide count: 1
A3166MYH9Myosin heavy chain 9, non-muscleNP_071855(K)ATDKSFVEK(V)   peptide count: 1
A3962MYH14, FP17425Myosin-14NP_082297(K)ATDKSFVEK(V)   peptide count: 1
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialNP_036151(K)ATDLLLDDSLVSLFGNR(R)   peptide count: 236
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialNP_036151(K)ATDLLLDDSLVSLFGNRR(L)   peptide count: 196
A9681MRPS35, MRPS28, HDCMD11PMitochondrial 28S ribosomal protein S28NP_663548(K)ATDVLTITTDR(C)   peptide count: 10
A6498Fahd2Fumarylacetoacetate hydrolase domain-containing protein 2ANP_083905(K)ATDVMAHVAGFTVAHDVSAR(D)   peptide count: 12
A7905SUPV3L1, SUV3Suppressor of VAR1, 3-like 1NP_852088(K)ATEPLSPSDK(E)   peptide count: 2
A7905SUPV3L1, SUV3Suppressor of VAR1, 3-like 1NP_852088(K)ATEPLSPSDKELPLASR(L)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2NP_032529(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_907394(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_620258(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_901219(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_980136(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_904556(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_993544(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_001002026(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_997963(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_001004352(K)ATFDAISK(T)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_001004356(K)ATFDAISK(T)   peptide count: 1
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseNP_032968(K)ATFDISLVVPK(D)   peptide count: 5
A6882LNPEP, OTASELeucyl-cystinyl aminopeptidaseNP_766415(K)ATFIIK(I)   peptide count: 1
A1560LAMA5Laminin subunit alpha-5XP_203796(K)ATGDPWLTDGSYLDGSGFAR(I)   peptide count: 1
A1560LAMA5Laminin subunit alpha-5XP_907468(K)ATGDPWLTDGSYLDGSGFAR(I)   peptide count: 1
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1NP_057930(K)ATGLHFR(H)   peptide count: 1
A0742TTNTitinNP_035782(K)ATGLQEGTEYEFR(V)   peptide count: 1
A0742TTNTitinNP_082280(K)ATGLQEGTEYEFR(V)   peptide count: 1
A3670GLS2, GAGlutaminase, liver isoform, mitochondrial precursorNP_001028436(K)ATGLQTSDPR(L)   peptide count: 5
A5979CASP7, MCH3Caspase-7 precursorNP_031637(K)ATGMDVRNGTDK(D)   peptide count: 1
A0685DNAJC6Putative tyrosine-protein phosphatase auxilinNP_940804(K)ATGQPYEQYAK(M)   peptide count: 1
A6554GAKCyclin G-associated kinaseNP_705797(K)ATGQPYEQYAK(M)   peptide count: 1
A1466FN1, FNFibronectinNP_034363(K)ATGVFTTLQPLR(S)   peptide count: 2
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1XP_001003382(K)ATGVMPDGQFKDTSLSEYK(G)   peptide count: 1
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1XP_001003388(K)ATGVMPDGQFKDTSLSEYK(G)   peptide count: 1
A4177OXR1Oxidation resistance protein 1NP_570955(K)ATGVSAEDADPR(A)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)ATGYPLAFIAAK(I)   peptide count: 13
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)ATGYPLAFIAAKIALGIPLPEIK(N)   peptide count: 2
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)ATGYPLAFIAAKIALGIPLPEIKNVVSGK(T)   peptide count: 4
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_001017959(K)ATHDGSSCGDDR(N)   peptide count: 3
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_034815(K)ATHDGSSCGDDR(N)   peptide count: 3
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_001017959(K)ATHDGSSCGDDRNSAK(I)   peptide count: 5
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_034815(K)ATHDGSSCGDDRNSAK(I)   peptide count: 5
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorNP_080237(K)ATHPLPK(D)   peptide count: 41
A3630AGPAT5, LPAAT-e1-acyl-sn-glycerol-3-phosphate acyltransferase epsilonNP_081068(K)ATHVAFDSMK(S)   peptide count: 5
A557BOXA1LInner membrane protein OXA1L, mitochondrial precursorNP_081212(K)ATIEMTR(Y)   peptide count: 2
A332CRAB7A, RAB7Ras-related protein Rab-7ANP_033031(K)ATIGADFLTK(E)   peptide count: 14
A5795AMPD3Adenosine monophosphate deaminase 3NP_033797(K)ATINPQDHR(E)   peptide count: 1
A0252AP2A2, ADTAB, CLAPA2Adapter-related protein complex 2 alpha 2 subunitNP_031485(K)ATIQDVLR(S)   peptide count: 6
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_001070732(K)ATIQGVLR(A)   peptide count: 3
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitNP_031484(K)ATIQGVLR(A)   peptide count: 3
A4815FLNC, ABPL, FLN2Filamin CXP_284175(K)ATIQPVFDPSK(V)   peptide count: 1
A5700ACSS3Acyl-CoA synthetase short-chain family member 3 mitochondrialNP_941038(K)ATISYK(E)   peptide count: 3
A7292PAPPA2, PLAC3, PAPPEPappalysin-2 precursorXP_355248(K)ATIVTGHSR(Y)   peptide count: 1
A0096CGNCingulinXP_001001375(K)ATIYGILR(E)   peptide count: 1
A9541RPL1260S ribosomal protein L12XP_001001613(K)ATKELPR(D)   peptide count: 2
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseNP_032968(K)ATLEEAR(R)   peptide count: 2
A5205TEKT3Tektin 3NP_081936(K)ATLEHDLAVK(A)   peptide count: 1
A6600GBA, GC, GLUCGlucosylceramidase precursorNP_001070879(K)ATLGETHR(L)   peptide count: 8
A6600GBA, GC, GLUCGlucosylceramidase precursorNP_032120(K)ATLGETHR(L)   peptide count: 8
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028769(K)ATLLLEHVER(K)   peptide count: 14
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028770(K)ATLLLEHVER(K)   peptide count: 14
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_001028771(K)ATLLLEHVER(K)   peptide count: 14
A3659ACSL6, ACS2, FACL6Long-chain-fatty-acid--CoA ligase 6NP_659072(K)ATLLLEHVER(K)   peptide count: 14
A8048TXNRD2, TRXR2Thioredoxin reductase 2, mitochondrial precursorNP_038739(K)ATLLSAEHIVIATGGRPR(Y)   peptide count: 1
A7984TSTThiosulfate sulfurtransferaseNP_033463(K)ATLNLSLLK(T)   peptide count: 23
A2341ACTN1Alpha-actinin 1NP_598917(K)ATLPDADKER(L)   peptide count: 6
A0007ACTN2Alpha-actinin 2NP_150371(K)ATLPEADGER(Q)   peptide count: 1
A2343ACTN3Alpha-actinin 3NP_038484(K)ATLPEADR(E)   peptide count: 1
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1NP_033483(K)ATLPSPDKLPGFK(M)   peptide count: 1
A1560LAMA5Laminin subunit alpha-5XP_203796(K)ATLQAASLILGHVSELLQGIDQAK(E)   peptide count: 1
A5814NUDT2, APAH1Bis(5')-nucleosyl-tetraphosphatase, asymmetricalNP_079815(K)ATLQEGHQFLCSTPA(-)   peptide count: 8
A858BCADPS, CAPS, CAPS1Calcium-dependent secretion activator 1NP_001036082(K)ATLSLLER(V)   peptide count: 2
A858BCADPS, CAPS, CAPS1Calcium-dependent secretion activator 1NP_036191(K)ATLSLLER(V)   peptide count: 2
A859BCADPS2, CAPS2Calcium-dependent secretion activator 2NP_694803(K)ATLSLLER(V)   peptide count: 2
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionNP_941042(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_203589(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_138341(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_138364(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_892273(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_907296(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899893(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899905(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899918(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899929(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_127178(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_899939(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_001001811(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_001001940(K)ATLTVDK(S)   peptide count: 3
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionXP_619047(K)ATLTVDK(S)   peptide count: 4
A0742TTNTitinNP_035782(K)ATLTWTPPLEDGGSPIK(A)   peptide count: 1
A0742TTNTitinNP_082280(K)ATLTWTPPLEDGGSPIK(A)   peptide count: 1
A5530CDAN1, UNQ664, PRO1295Codanin-1XP_485054(K)ATLVADLVHQAESLLQEQLVAR(G)   peptide count: 1
A5530CDAN1, UNQ664, PRO1295Codanin-1XP_898437(K)ATLVADLVHQAESLLQEQLVAR(G)   peptide count: 1
A3582ACACA, ACAC, ACC1Acetyl-CoA carboxylase 1NP_579938(K)ATLVEHGIR(R)   peptide count: 1
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseNP_579926(K)ATLWYVPLSLK(N)   peptide count: 4
A6823AK2, ADK2Adenylate kinase 2, mitochondrialNP_001029138(K)ATMDAGK(L)   peptide count: 1
A6823AK2, ADK2Adenylate kinase 2, mitochondrialNP_058591(K)ATMDAGK(L)   peptide count: 1
A682AMED1, ARC205, CRSP1Mediator of RNA polymerase II transcription subunit 1NP_598788(K)ATNATPLDKILHGSVGYLTPR(S)   peptide count: 1
A0659PCM1, PCM-1, HDCMB07PPericentriolar material 1 proteinNP_076151(K)ATNSNR(K)   peptide count: 2
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)ATPAADGK(A)   peptide count: 5
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)ATPAADGKAPLTKPVK(K)   peptide count: 22
A4086CEND1, BM88Cell cycle exit and neuronal differentiation protein 1NP_067291(K)ATPAADGKAPLTKPVKK(D)   peptide count: 23
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseNP_032088(K)ATPEERPK(L)   peptide count: 2
A6549G6pd2Glucose-6-phosphate 1-dehydrogenase 2NP_062341(K)ATPEERPK(L)   peptide count: 2
A6573GCDHGlutaryl-CoA dehydrogenase, mitochondrial precursorNP_001038209(K)ATPEMVSMLK(R)   peptide count: 12
A6573GCDHGlutaryl-CoA dehydrogenase, mitochondrial precursorNP_032123(K)ATPEMVSMLK(R)   peptide count: 12
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3NP_542126(K)ATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLK(L)   peptide count: 4
A195CNDUFA3NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3NP_079624(K)ATPYNYPVPVR(D)   peptide count: 45
A195CNDUFA3NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3NP_079624(K)ATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLK(N)   peptide count: 20
A777BABCB10ATP-binding cassette, sub-family B, member 10, mitochondrial precursorNP_062425(K)ATQDSLAEATQLAEER(I)   peptide count: 7
A1924ALDOB, ALDBFructose-bisphosphate aldolase BNP_659152(K)ATQEAFMK(R)   peptide count: 1
A1924ALDOB, ALDBFructose-bisphosphate aldolase BNP_659152(K)ATQEAFMKR(A)   peptide count: 2
A369CRRBP1Ribosome-binding protein 1XP_622097(K)ATQKGDPVAILKR(Q)   peptide count: 1
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_126589(K)ATQRPPYCDGTHK(S)   peptide count: 14
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_900236(K)ATQRPPYCDGTHK(S)   peptide count: 14
A8713CISD3CDGSH iron sulfur domain-containing protein 3, mitochondrialXP_999390(K)ATQRPPYCDGTHK(S)   peptide count: 14
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorNP_077798(K)ATQSVPK(E)   peptide count: 3
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorNP_077798(K)ATQSVPKEEISNNNPHLK(S)   peptide count: 23
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)ATSFCFR(I)   peptide count: 1
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorNP_062708(K)ATSFVGYVGMLTGFKPGLFSLSLNER(F)   peptide count: 11
A2345CLIP-170, CLIP1, CYLN1CAP-GLY domain-containing linker protein 1NP_062739(K)ATSHVGEIEQELALAR(D)   peptide count: 3
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GINP_001005331(K)ATSLLLEILGLLCK(S)   peptide count: 3
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GINP_666053(K)ATSLLLEILGLLCK(S)   peptide count: 3
A6577GLDC, GCSPGlycine dehydrogenase [decarboxylating], mitochondrial precursorNP_613061(K)ATSNICTAQALLANMAAMFAIYHGSQGLK(H)   peptide count: 3
A0778MAP4Microtubule-associated protein 4NP_032659(K)ATSPSTLVSTGPSSR(S)   peptide count: 2
A1539KNG1, BDK, KNGKininogen-1NP_075614(K)ATSQVVAGTK(Y)   peptide count: 2
A9599MRPL2439S ribosomal protein L24, mitochondrialNP_080867(K)ATSSPFYR(Y)   peptide count: 3
A1815MTP, MTTPMicrosomal triglyceride transfer protein, large subunit precursorNP_032668(K)ATSVTTYK(I)   peptide count: 1
A3815RPS2, rps2, RPS440S ribosomal protein S2XP_618996(K)ATSYAISK(T)   peptide count: 1
A0742TTNTitinNP_035782(K)ATSYTITSLIENQEYK(I)   peptide count: 1
A0742TTNTitinNP_082280(K)ATSYTITSLIENQEYK(I)   peptide count: 1
A7782Oxct2bSuccinyl-CoA:3-ketoacid-coenzyme A transferase 2B, mitochondrialNP_862907(K)ATTACSFAVSPNLKPMQQIK(L)   peptide count: 7
A7784OXCT2, FKSG25, H-SCOT-T3-oxoacid CoA transferase 2NP_071316(K)ATTACSFAVSPNLKPMQQIK(L)   peptide count: 7
A0684SNAP91Clathrin coat assembly protein AP180NP_038697(K)ATTHEVMGPK(K)   peptide count: 2
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)ATVDAEGNFDPRPVETLNVIIPEK(L)   peptide count: 1
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinNP_112442(K)ATVEDEKLQGKINDEDK(Q)   peptide count: 2
A4206RPA3, REPA3, RPA14Replication protein A 14 kDa subunitNP_080908(K)ATVLCASYTLFK(E)   peptide count: 1
A8380A2mpAlpha-2-macroglobulin-PNP_783327(K)ATVLNYLQTCIR(V)   peptide count: 7
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorNP_038503(K)ATVLYQGMR(V)   peptide count: 1
A9002REEP5, DP1, TB2Receptor expression-enhancing protein 5NP_031900(K)ATVNLLGDEK(K)   peptide count: 3
A9002REEP5, DP1, TB2Receptor expression-enhancing protein 5NP_031900(K)ATVNLLGDEKK(S)   peptide count: 4
A684CSLC18A2, VMAT2, SVMTSynaptic vesicular amine transporterNP_766111(K)ATVQLLTNPFIGLLTNR(I)   peptide count: 1
A9642RPS2540S ribosomal protein S25NP_077228(K)ATYDKLCK(E)   peptide count: 1
A9642RPS2540S ribosomal protein S25XP_144599(K)ATYDKLCK(E)   peptide count: 1
A9642RPS2540S ribosomal protein S25XP_622656(K)ATYDKLCK(E)   peptide count: 1
A9642RPS2540S ribosomal protein S25XP_899588(K)ATYDKLCK(E)   peptide count: 1
A583BPXMP4, PMP24Peroxisomal membrane protein 4NP_067509(K)ATYIHSR(N)   peptide count: 5
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorNP_080102(K)ATYLPK(L)   peptide count: 5
A9662MRPS11, RPMS11, HCC228S ribosomal protein S11, mitochondrial precursorNP_080774(K)ATYNNTQIQVVSATNASLAR(A)   peptide count: 7
A1560LAMA5Laminin subunit alpha-5XP_203796(K)AVAAEALSTATHVQSQLQGMQK(N)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_486227(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_896942(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_904888(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_904894(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_904897(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_904903(K)AVAAGNSCR(Q)   peptide count: 1
A5213TLN2Talin 2XP_993780(K)AVAAGNSCR(Q)   peptide count: 1
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitNP_033967(K)AVADAIR(T)   peptide count: 1
A7091MUTMethylmalonyl-CoA mutase, mitochondrialNP_032676(K)AVAEGIPK(L)   peptide count: 19
A0097TLN1, TLNTalin 1NP_035732(K)AVAEQIPLLVQGVR(G)   peptide count: 5
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorNP_080237(K)AVAEVEEMCNILSMEGVTVR(R)   peptide count: 52
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialNP_080175(K)AVAFQNSQTR(I)   peptide count: 188
A5986CTSH, CPSBCathepsin H precursorNP_031827(K)AVAFVK(N)   peptide count: 2
A0098VCLVinculinNP_033528(K)AVAGNISDPGLQK(S)   peptide count: 3
A3584FASN, FASFatty acid synthaseNP_032014(K)AVAHGDGDTQR(D)   peptide count: 1
A3584FASN, FASFatty acid synthaseNP_032014(K)AVAHILGIR(D)   peptide count: 3
A5117RSPH9, MRPS18AL1Radial speke head protein 9 homologNP_083614(K)AVAIIPR(G)   peptide count: 1
A775DODF2LOuter dense fiber of sperm tails 2-likeNP_079990(K)AVALKKASKVYR(Q)   peptide count: 2
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)AVANYDSVEAGEK(L)   peptide count: 20
A0768SLC4A2, AE2, EPB3L1Anion exchange protein 2NP_033233(K)AVAPGDKPK(I)   peptide count: 2
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialNP_080175(K)AVAQGNLSSADVQAAK(N)   peptide count: 205
A0374NEFH, NFHNeurofilament heavy polypeptideNP_035034(K)AVASEEETPAK(L)   peptide count: 1
A8761EFCAB6, DJBP, HSCBCIP1EF-hand calcium-binding domain-containing protein 6NP_084222(K)AVASHYHTIVQEFENFDTLK(S)   peptide count: 1
A7854SPG7, CAR, CMARParapleginNP_694816(K)AVATEAQVPFLAMAGPEFVEVIGGLGAAR(V)   peptide count: 8
A5643ABHD10Abhydrolase domain-containing protein 10, mitochondrial precursorNP_766099(K)AVAVEEFCK(S)   peptide count: 6
A9929GRNGranulins precursorNP_032201(K)AVCCEDHIHCCPAGFQCHTEK(G)   peptide count: 4
A6076CLYBL, CLBCitrate lyase beta like protein, mitochondrialNP_083832(K)AVCEETLK(T)   peptide count: 10
A6776 Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrialNP_766489(K)AVCTPDIGGQGNTASTVEYILHHMK(E)   peptide count: 2
A7842SOD1Superoxide dismutase [Cu-Zn]NP_035564(K)AVCVLK(G)   peptide count: 12
A535BMFSD11, ETUNC93-like protein MFSD11NP_848735(K)AVDAFKK(S)   peptide count: 3
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)AVDALK(S)   peptide count: 6
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)AVDALKSDK(K)   peptide count: 2
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)AVDALKSDKK(V)   peptide count: 1
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicNP_084514(K)AVDDLNLHSYSNLPIWVNK(L)   peptide count: 3
A7904SUOXSulfite oxidase, mitochondrial precursorNP_776094(K)AVDDSYNVQPDTVAPIWNLR(G)   peptide count: 12
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinNP_083949(K)AVDEAADALLK(A)   peptide count: 79
A6325DHX30, DDX30, MLAA-43Putative ATP-dependent RNA helicase DHX30NP_579925(K)AVDEAVILLQEIGVLDQR(E)   peptide count: 22
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorNP_059062(K)AVDHATNR(T)   peptide count: 54
A3616ENO2Gamma enolaseNP_038537(K)AVDHINSR(I)   peptide count: 2
A0757CNTN1Contactin-1 precursorNP_031753(K)AVDLIPWMEYEFR(V)   peptide count: 1
A0742TTNTitinNP_035782(K)AVDPIDAPK(V)   peptide count: 1
A0742TTNTitinNP_082280(K)AVDPIDAPK(V)   peptide count: 1
A9475SCARB2, CD36L2, LIMPIILysosome membrane protein 2NP_031670(K)AVDQTIEK(N)   peptide count: 12
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorNP_035280(K)AVDQWSTETIASHEDIER(L)   peptide count: 5
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorNP_031531(K)AVDSLVPIGR(G)   peptide count: 271
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)AVDVFFPPEAQNDFPVAMQISEK(H)   peptide count: 4
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-likeNP_758512(K)AVDVLAK(E)   peptide count: 7
A7504PITRM1, MP1Presequence protease, mitochondrialNP_660113(K)AVDWAK(S)   peptide count: 2
A5771GPT2, AAT2, ALT2Alanine aminotransferase 2NP_776291(K)AVEAAQSHK(M)   peptide count: 14
A6321SORD, SORDLSorbitol dehydrogenaseNP_666238(K)AVEAFETAK(K)   peptide count: 2
A541DHEATR5BHEAT repeat-containing protein 5BXP_283480(K)AVEAVVNDTSSENK(S)   peptide count: 1
A541DHEATR5BHEAT repeat-containing protein 5BXP_903404(K)AVEAVVNDTSSENK(S)   peptide count: 1
A541DHEATR5BHEAT repeat-containing protein 5BXP_903423(K)AVEAVVNDTSSENK(S)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AVEDEATKGTR(A)   peptide count: 1
A6185Cyp4a14Cytochrome P450 4A14NP_031848(K)AVEDLNNLTFFR(L)   peptide count: 1
A3617ENO3Beta enolaseNP_031959(K)AVEHINK(T)   peptide count: 1
A5644ABHD11, WBSCR21, PP1226Abhydrolase domain-containing protein 11NP_660250(K)AVEIPEK(V)   peptide count: 1
A5644ABHD11, WBSCR21, PP1226Abhydrolase domain-containing protein 11NP_660250(K)AVEIPEKVPHSQAR(K)   peptide count: 5
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorNP_034813(K)AVEIYASVAQLTPVDSEALENEANK(I)   peptide count: 1
A7869ALDH5A1, SSADHSuccinate semialdehyde dehydrogenase, mitochondrial precursorNP_766120(K)AVEKVEK(Q)   peptide count: 1
A7989TKT, TKT1TransketolaseNP_033414(K)AVELAANTK(G)   peptide count: 11
A003CGLRX2, GRX2, CGI-133Glutaredoxin 2, mitochondrialNP_001033681(K)AVELDMLEYGNQFQDALHK(M)   peptide count: 5
A003CGLRX2, GRX2, CGI-133Glutaredoxin 2, mitochondrialNP_001033682(K)AVELDMLEYGNQFQDALHK(M)   peptide count: 5
A003CGLRX2, GRX2, CGI-133Glutaredoxin 2, mitochondrialNP_001033683(K)AVELDMLEYGNQFQDALHK(M)   peptide count: 5
A003CGLRX2, GRX2, CGI-133Glutaredoxin 2, mitochondrialNP_075994(K)AVELDMLEYGNQFQDALHK(M)   peptide count: 5
A033CIFT140, WDTC2Intraflagellar transport protein 140 homologNP_598887(K)AVELLLAAK(K)   peptide count: 1
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)AVELNPK(Y)   peptide count: 7
A3474CACNA2D1, CACNL2A, CCHL2AVoltage-dependent calcium channel subunit alpha-2/delta-1NP_033914(K)AVELYIQGK(L)   peptide count: 1
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3NP_035314(K)AVENSSTAIGIR(C)   peptide count: 3
A6579AGL, GDEGlycogen debranching enzymeXP_131166(K)AVEQFR(R)   peptide count: 1
A6579AGL, GDEGlycogen debranching enzymeXP_899265(K)AVEQFR(R)   peptide count: 1
A6579AGL, GDEGlycogen debranching enzymeXP_906443(K)AVEQFR(R)   peptide count: 1
A6579AGL, GDEGlycogen debranching enzymeXP_906447(K)AVEQFR(R)   peptide count: 1
A6579AGL, GDEGlycogen debranching enzymeXP_906452(K)AVEQFR(R)   peptide count: 1
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorNP_780386(K)AVETIR(S)   peptide count: 18
A033CIFT140, WDTC2Intraflagellar transport protein 140 homologNP_598887(K)AVEVAELHDR(V)   peptide count: 2
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)AVEVAWETLQEEFSR(F)   peptide count: 33
A5771GPT2, AAT2, ALT2Alanine aminotransferase 2NP_776291(K)AVEYAVR(G)   peptide count: 7
A7782Oxct2bSuccinyl-CoA:3-ketoacid-coenzyme A transferase 2B, mitochondrialNP_862907(K)AVFEVNHSK(G)   peptide count: 12
A7784OXCT2, FKSG25, H-SCOT-T3-oxoacid CoA transferase 2NP_071316(K)AVFEVNHSK(G)   peptide count: 12
A4526TOMM40L, TOMM40BMitochondrial import receptor subunit TOM40BNP_001032247(K)AVFQTQQAK(F)   peptide count: 11
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseNP_075638(K)AVFQYIDENQDR(Y)   peptide count: 3
A7937TARSL1, TARS2Threonyl-tRNA synthetase 2, mitochondrial precursorNP_082207(K)AVFWHSSAHVLGAAAEQQLGAVLCR(G)   peptide count: 1
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorNP_079634(K)AVGEKEVR(S)   peptide count: 6
A8201XDH, XDHAXanthine dehydrogenase/oxidaseNP_035853(K)AVGEPPLFLASSIFFAIK(D)   peptide count: 3
A7279PLA2G16, HRASLS3, HREV107Group XVI phospholipase A2NP_644675(K)AVGIAGVGLAALGLVGVMLSR(N)   peptide count: 1
A7370FAM213BUncharacterized protein C1ORF93NP_079858(K)AVGIQGNLSGDLLQSGGLLVVSK(G)   peptide count: 5
A3468ATP2A1Sarcoplasmic/endoplasmic reticulum calcium ATPase 1NP_031530(K)AVGIVATTGVSTEIGK(I)   peptide count: 163
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2NP_034085(K)AVGKDNFTLIPEGTNGTEER(M)   peptide count: 1
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorNP_067370(K)AVGKEELGK(N)   peptide count: 8
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)AVGLISHVLEQNQEGDAAYR(K)   peptide count: 39
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorNP_057918(K)AVGLISHVLEQNQEGDAAYRK(A)   peptide count: 18
A0295PPP2R1ASerine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alpha isoformNP_058587(K)AVGPEITK(T)   peptide count: 1
A7676REXO1, ELOABP1, TCEB3BP1Transcription elongation factor B polypeptide B binding protein 1NP_080128(K)AVGQPR(R)   peptide count: 1
A7676REXO1, ELOABP1, TCEB3BP1Transcription elongation factor B polypeptide B binding protein 1NP_848470(K)AVGQPR(R)   peptide count: 1
A1174ldlr, LDLRLow-density lipoprotein receptor precursorNP_034830(K)AVGSIGYLLFTNR(H)   peptide count: 1
A713BTMEM65Transmembrane protein 65NP_780421(K)AVGVTIGCILGMFPLIFFGGSEEDEKLETTN(-)   peptide count: 2
A5651ABP1, AOC1, DAO1Amiloride-sensitive amine oxidase [copper-containing] precursorNP_083914(K)AVHSFLMSR(K)   peptide count: 1
A4750DSTN, ACTDP, DSNDestrinNP_062745(K)AVIFCLSADKK(C)   peptide count: 2
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3NP_444430(K)AVIGDHGDEIFSVFGSPFLK(D)   peptide count: 8
A2149ASCC3, HELIC1, RNAHActivating signal cointegrator 1 complex subunit 3XP_125617(K)AVILVHDIKK(D)   peptide count: 1
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AVINVLNVAHSK(L)   peptide count: 4
A5688ACSS1, ACAS2LAcetyl-coenzyme A synthetase 2-like, mitochondrial precursorNP_542142(K)AVITFNQGLR(G)   peptide count: 18
A095BDNTTIP2, ERBP, TDIF2Deoxynucleotidyltransferase terminal-interacting protein 2NP_722501(K)AVITPDFEKK(H)   peptide count: 9
A140CMRS2, HPT, MRS2LMagnesium transporter MRS2L, mitochondrial precursorNP_001013407(K)AVITPECLLILDYR(N)   peptide count: 4
A6003CPDCarboxypeptidase D precursorNP_031780(K)AVIVLNEGIK(V)   peptide count: 1
A9919GHITM, DERP2, MICS1Growth hormone inducible transmembrane proteinNP_510963(K)AVIWPQYVK(D)   peptide count: 7
A8937PLET1Placenta expressed transcript 1NP_083915(K)AVKEDDSPVGTWSGTYEK(C)   peptide count: 1
A4760DNAH10Dynein heavy chain 10, axonemalXP_983660(K)AVKEILDTWENMK(F)   peptide count: 1
A473AHIST1H1B, H1F5Histone H1.5NP_064418(K)AVKSKASKPKVTKPK(T)   peptide count: 1
A3504CDC42BPBCDC42-binding protein kinase betaNP_898837(K)AVLAAAIVDGDR(I)   peptide count: 1
A5608HSD3B1, 3BH, HSDB3A3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type IXP_001002116(K)AVLAANGSILK(N)   peptide count: 3
A5608HSD3B1, 3BH, HSDB3A3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type IXP_001002124(K)AVLAANGSILK(N)   peptide count: 3
A5611Hsd3b43 beta-hydroxysteroid dehydrogenase type 4NP_032320(K)AVLAANGSILK(N)   peptide count: 3
A5608HSD3B1, 3BH, HSDB3A3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type INP_032319(K)AVLAANGSMLK(N)   peptide count: 1
A5609HSD3B2, HSDB3B3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type IINP_694873(K)AVLAANGSMLK(N)   peptide count: 1
A5610Hsd3b33 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type 3NP_001012306(K)AVLAANGSMLK(N)   peptide count: 1
A5613Hsd3b63 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type 6NP_038849(K)AVLAANGSMLK(N)   peptide count: 1
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1NP_031412(K)AVLAESYER(I)   peptide count: 1
A6369PDSS1, DPS1, TPRTDecaprenyl-diphosphate synthase subunit 1NP_062374(K)AVLAGDLILSAASVALAR(I)   peptide count: 1
A6699HDAC6, JM21Histone deacetylase 6NP_034543(K)AVLAQGQSSEQAAK(G)   peptide count: 2
A3669IDH3GIsocitrate dehydrogenase 3 [NAD] subunit gamma, mitochondrial precursorNP_032349(K)AVLASMDNENMHTPDIGGQGTTSQAIQDIIR(H)   peptide count: 6
A5612Hsd3b53 beta-hydroxysteroid dehydrogenase type 5NP_032321(K)AVLATNGR(L)   peptide count: 3
A5612Hsd3b53 beta-hydroxysteroid dehydrogenase type 5NP_032321(K)AVLATNGRLLK(N)   peptide count: 16
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AVLDDILEK(I)   peptide count: 1
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AVLDDILEKIPETFNMAEIMAK(A)   peptide count: 2
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorNP_075830(K)AVLDSSPFLSEANAER(I)   peptide count: 3
A8492Serpina3kSerine protease inhibitor A3KNP_035588(K)AVLDVAETGTEAAAATGVIGGIR(K)   peptide count: 4
A8492Serpina3kSerine protease inhibitor A3KNP_035588(K)AVLDVAETGTEAAAATGVIGGIRK(A)   peptide count: 1
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorNP_033278(K)AVLDVAETGTEAAAATGVK(L)   peptide count: 2
A8490Serpina3fSerine protease inhibitor A3FNP_001030042(K)AVLDVAETGTEAAAATGVK(L)   peptide count: 2
A2151POLQ, POLH, PRO0327DNA polymerase thetaNP_084253(K)AVLEKYHSFGVR(K)   peptide count: 1
A5925GUSB, F8Beta-glucuronidase precursorNP_034498(K)AVLENYHSVLDQK(R)   peptide count: 2
A4710CFL2Cofilin 2NP_031714(K)AVLFCLSDDKR(Q)   peptide count: 2
A0999CFL1, CFLCofilin, non-muscle isoformNP_031713(K)AVLFCLSEDKK(N)   peptide count: 12
A0999CFL1, CFLCofilin, non-muscle isoformXP_890553(K)AVLFCLSEDKK(N)   peptide count: 12
A4558ADIPOQ, ACDC, ACRP30Adiponectin precursorNP_033735(K)AVLFTYDQYQEK(N)   peptide count: 1
A6602GLYCTK, HBEBP4, LP5910Glycerate kinaseNP_001034675(K)AVLGMAAAAEELLAQHLVQGVISVPK(G)   peptide count: 9
A6602GLYCTK, HBEBP4, LP5910Glycerate kinaseNP_777271(K)AVLGMAAAAEELLAQHLVQGVISVPK(G)   peptide count: 9
A6605GKGlycerol kinaseNP_032220(K)AVLGPLVGAVDQGTSSTR(F)   peptide count: 4
A6605GKGlycerol kinaseNP_997609(K)AVLGPLVGAVDQGTSSTR(F)   peptide count: 4
A7601Gykl1Glycerol kinase-like 1NP_034423(K)AVLGPLVGAVDQGTSSTR(F)   peptide count: 4
A5719ADCK1aarF domain containing kinase 1NP_082381(K)AVLHDGR(T)   peptide count: 3
A388ETEX15Testis-expressed sequence 15 proteinNP_113551(K)AVLHLKK(A)   peptide count: 1
A7031RHOT2, ARHT2, MIRO-2Mitochondrial Rho GTPase 2NP_666111(K)AVLHPTAPLYDPEAK(Q)   peptide count: 1
A3974RHOT1, ARHT1, MIRO-1Mitochondrial RHO GTPase 1NP_067511(K)AVLHPTGPLYCPEEK(E)   peptide count: 4
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorNP_941055(K)AVLKEGTDVVIK(M)   peptide count: 1
A0742TTNTitinNP_035782(K)AVLKGTPPFKIK(W)   peptide count: 3
A6083CMPK2UMP-CMP kinase 2, mitochondrialNP_065582(K)AVLLQSPPPCISQWR(K)   peptide count: 1
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AVLLTGEQGTAK(T)   peptide count: 2
A0154ITPR1, INSP3R1Inositol 1,4,5-trisphosphate receptor type 1NP_034715(K)AVLNPTNADILIETK(L)   peptide count: 1
A3706DHRS7, DHRS7A, RETSDR4Retinal short-chain dehydrogenase/reductase 4 precursorNP_079798(K)AVLQEFGK(I)   peptide count: 1
A7932RARS2, RARSLArginyl-tRNA synthetase 2, mitochondrialNP_852071(K)AVLQQVTEDGCK(Y)   peptide count: 4
A8372Serpina1dAlpha-1-antitrypsin 1-4NP_033272(K)AVLTIDETGTEAAAATVLQVATYSMPPIVR(F)   peptide count: 2
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)AVLTSQETLFGGSDCTGNFCLFK(S)   peptide count: 8
A4769DNAH7Dynein heavy chain 7, axonemalXP_981204(K)AVLVAAGNLK(L)   peptide count: 1
A526DHDHD2Haloacid dehalogenase-like hydrolase domain-containing protein 2NP_001034290(K)AVLVDLNGTLHIEDAAVPGAQEALKR(L)   peptide count: 1
A526DHDHD2Haloacid dehalogenase-like hydrolase domain-containing protein 2NP_001034291(K)AVLVDLNGTLHIEDAAVPGAQEALKR(L)   peptide count: 1
A526DHDHD2Haloacid dehalogenase-like hydrolase domain-containing protein 2NP_084102(K)AVLVDLNGTLHIEDAAVPGAQEALKR(L)   peptide count: 1
A1914CTNNA2, CAPRCatenin alpha-2NP_033949(K)AVMDHISDSFLETNVPLLVLIEAAK(S)   peptide count: 2
A1914CTNNA2, CAPRCatenin alpha-2NP_663785(K)AVMDHISDSFLETNVPLLVLIEAAK(S)   peptide count: 2
A0089CTNNA1Alpha-1 cateninNP_033948(K)AVMDHVSDSFLETNVPLLVLIEAAK(N)   peptide count: 3
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)AVMEALR(E)   peptide count: 32
A1929DNM1L, DLP1, DRP1Dynamin-like proteinNP_001021118(K)AVMHFLVNHVK(D)   peptide count: 1
A1929DNM1L, DLP1, DRP1Dynamin-like proteinNP_690029(K)AVMHFLVNHVK(D)   peptide count: 1
A1929DNM1L, DLP1, DRP1Dynamin-like proteinNP_001021118(K)AVMHFLVNHVKDTLQSELVGQLYK(S)   peptide count: 1
A1929DNM1L, DLP1, DRP1Dynamin-like proteinNP_690029(K)AVMHFLVNHVKDTLQSELVGQLYK(S)   peptide count: 1
A5137SPAG17, PF6Sperm-associated antigen 17NP_083168(K)AVMPPLEQEASR(V)   peptide count: 1
A0742TTNTitinNP_035782(K)AVNEAGVSKPSATVGPVIVK(D)   peptide count: 1
A0742TTNTitinNP_082280(K)AVNEAGVSKPSATVGPVIVK(D)   peptide count: 1
A4060ASPM, MCPH5Abnormal spindlesNP_033921(K)AVNIIEGYLSAQLARRRFLK(M)   peptide count: 1
A9086CCDC44, TACO1, PRO0477Translational activator of Cytochrome C oxidase 1NP_081622(K)AVNLER(A)   peptide count: 6
A5800CD13, ANPEP, APNAminopeptidase NNP_032512(K)AVNQQTAVQPPATVR(T)   peptide count: 4
A0262NOS1, nNOSmu, NNOSMUNitric-oxide synthase, brainNP_032738(K)AVNRGGPAKAEMKDTGIQVDR(D)   peptide count: 4
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorNP_061216(K)AVNYASR(I)   peptide count: 1
A4430CACNA1S, CACH1, CACN1Voltage-dependent L-type calcium channel alpha-1S subunitXP_001002706(K)AVPIPEASSFFIFSPTNK(I)   peptide count: 4
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6NP_035420(K)AVPQLQGYLR(S)   peptide count: 2
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_357078(K)AVPQLQGYLR(S)   peptide count: 2
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_483949(K)AVPQLQGYLR(S)   peptide count: 2
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_890389(K)AVPQLQGYLR(S)   peptide count: 2
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6XP_899749(K)AVPQLQGYLR(S)   peptide count: 2
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]NP_067448(K)AVPREELFVTSK(L)   peptide count: 1
A6923LRRK2, AURA17, PARK8Leucine-rich repeat serine/threonine-protein kinase 2NP_080006(K)AVPYNRMK(L)   peptide count: 1
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinNP_035182(K)AVQADGQVK(E)   peptide count: 2
A3286LRRC59, PRO1855Leucine-rich repeat-containing protein 59NP_598568(K)AVQADQER(E)   peptide count: 3
A3286LRRC59, PRO1855Leucine-rich repeat-containing protein 59NP_598568(K)AVQADQERER(Q)   peptide count: 2
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)AVQAHR(A)   peptide count: 3
A1410COL6A1Collagen alpha 1(VI) chain precursorNP_034063(K)AVQEAQR(A)   peptide count: 1
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorNP_079634(K)AVQHSNVVINLIGR(E)   peptide count: 38
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorNP_079634(K)AVQHSNVVINLIGREWETR(N)   peptide count: 1
A3465ATP2B1, PMCA1Plasma membrane calcium-transporting ATPase 1NP_080758(K)AVQMLWVNLIMDTLASLALATEPPTESLLLR(K)   peptide count: 2
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorNP_083299(K)AVQQGTIK(C)   peptide count: 11
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitNP_080645(K)AVQSLDKNGVDLLMK(C)   peptide count: 1
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitXP_356911(K)AVQSLDKNGVDLLMK(C)   peptide count: 1
A0381ATP5EATP synthase epsilon chain, mitochondrialNP_080259(K)AVRDALK(T)   peptide count: 2
A0381ATP5EATP synthase epsilon chain, mitochondrialNP_080259(K)AVRDALKTEFK(A)   peptide count: 7
A0381ATP5EATP synthase epsilon chain, mitochondrialNP_080259(K)AVRDALKTEFKANAEK(T)   peptide count: 1
A6653GzmdGranzyme DNP_034502(K)AVRPLKLPR(S)   peptide count: 1
A6654GzmeGranzyme ENP_034503(K)AVRPLKLPRPNAR(V)   peptide count: 2
A6655GzmfGranzyme FNP_034504(K)AVRPLKLPRPNAR(V)   peptide count: 2
A6656GzmgGranzyme GNP_034505(K)AVRPLKLPRPNAR(V)   peptide count: 2
A432ETTC18Tetratricopeptide repeat-containing protein 18XP_127606(K)AVSDYHTQIK(S)   peptide count: 1
A0097TLN1, TLNTalin 1NP_035732(K)AVSSAIAK(L)   peptide count: 1
A677AMCM8DNA replication licensing factor MCM8NP_079952(K)AVSSATVTR(V)   peptide count: 4
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)AVSSFFSGSCVPCADPVAFPK(L)   peptide count: 4
A582BPXMP2, PMP22Peroxisomal membrane protein 2NP_033019(K)AVSSGILSALGNLLAQTIEK(R)   peptide count: 30
A582BPXMP2, PMP22Peroxisomal membrane protein 2NP_033019(K)AVSSGILSALGNLLAQTIEKR(K)   peptide count: 13
A5225FREP1, TPPP, TPPP1Tubulin polymerization-promoting proteinNP_878259(K)AVSSPTVSR(L)   peptide count: 2
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorNP_035636(K)AVSSQMIGQK(L)   peptide count: 144
A4760DNAH10Dynein heavy chain 10, axonemalXP_983660(K)AVSVIELYGILDPTTR(D)   peptide count: 2
A4271ATOX1, HAH1Copper transport protein ATOX1NP_033850(K)AVSYLGPK(-)   peptide count: 2
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AVTCDELFGIINPATR(E)   peptide count: 3
A1175LRP, LRP1, A2MRProlow-density lipoprotein receptor-related protein 1NP_032538(K)AVTDEEPFLIFANR(Y)   peptide count: 4
A7942WARS2Tryptophanyl-tRNA synthetase, mitochondrial precursorNP_081738(K)AVTDFTSEVTYEPDSR(A)   peptide count: 1
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorNP_663493(K)AVTEGAQAVEEPSIC(-)   peptide count: 18
A0633YWHAH, YWHA114-3-3 protein etaNP_035868(K)AVTELNEPLSNEDR(N)   peptide count: 6
A0907YWHAQ14-3-3 protein tauNP_035869(K)AVTEQGAELSNEER(N)   peptide count: 10
A0467YWHAB14-3-3 protein beta/alphaNP_061223(K)AVTEQGHELSNEER(N)   peptide count: 24
A5227TPPP3, CGI-38Tubulin polymerization-promoting protein family member 3NP_080757(K)AVTGTDVDIVFSK(V)   peptide count: 2
A7232OGT, HRNT1UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunitNP_631883(K)AVTLDPNFLDAYINLGNVLK(E)   peptide count: 4
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1NP_033483(K)AVTLHDQGTTQWADLSSQFYLR(E)   peptide count: 1
A5995CPA3Mast cell carboxypeptidase ANP_031779(K)AVTNFIR(S)   peptide count: 6
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialNP_694704(K)AVTNMTLNFGPQHPAAHGVLR(L)   peptide count: 14
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialNP_694704(K)AVTNMTLNFGPQHPAAHGVLR(L)   peptide count: 6
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7NP_075691(K)AVTPAPPMK(R)   peptide count: 10
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7NP_075691(K)AVTPAPPMKR(W)   peptide count: 35
A0097TLN1, TLNTalin 1NP_035732(K)AVTQALNR(C)   peptide count: 2
A3639RPN1Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit precursorNP_598694(K)AVTSEIAVLQSR(L)   peptide count: 3
A6888LDHDD-lactate dehydrogenase, mitochondrialNP_081846(K)AVVGSPHVSTASAVR(E)   peptide count: 26
A767BABCR, ABCA4Retinal-specific ATP-binding cassette transporterNP_031404(K)AVVIEK(A)   peptide count: 1
A905D4930404A10RikNovel proteinXP_484022(K)AVVIEK(A)   peptide count: 1
A9640RPS2340S ribosomal protein S23NP_077137(K)AVVIEK(A)   peptide count: 1
A9640RPS2340S ribosomal protein S23XP_995532(K)AVVIEK(A)   peptide count: 1
A9640RPS2340S ribosomal protein S23XP_001003736(K)AVVIEK(A)   peptide count: 1
A979BFABP1, FABPLFatty acid-binding protein, liverNP_059095(K)AVVKLEGDNK(M)   peptide count: 5
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)AVVLAANHFGR(F)   peptide count: 22
A3807RPLP060S acidic ribosomal protein P0NP_031501(K)AVVLMGK(N)   peptide count: 3
A3807RPLP060S acidic ribosomal protein P0XP_996602(K)AVVLMGK(N)   peptide count: 3
A3807RPLP060S acidic ribosomal protein P0XP_001000750(K)AVVLMGK(N)   peptide count: 3
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4NP_001033027(K)AVVPEMEK(R)   peptide count: 5
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4NP_109611(K)AVVPEMEK(R)   peptide count: 5
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4NP_001033027(K)AVVPEMEKR(G)   peptide count: 11
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4NP_109611(K)AVVPEMEKR(G)   peptide count: 11
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformNP_031535(K)AVVQVFEGTSGIDAK(K)   peptide count: 7
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorNP_035761(K)AVVSQR(L)   peptide count: 1
A6960ME2NAD-dependent malic enzyme, mitochondrial precursorNP_663469(K)AVVVTDGER(I)   peptide count: 49
A6961ME3NADP-dependent malic enzyme, mitochondrial precursorNP_852072(K)AVVVTDGER(I)   peptide count: 49
A4033DMXL2, RC3DmX-like protein 2XP_358382(K)AVVWGLFR(S)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_001003815(K)AVVYR(E)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_001006665(K)AVVYR(E)   peptide count: 1
A3867EPB41L1Band 4.1-like protein 1NP_038538(K)AVVYR(E)   peptide count: 1
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1NP_031480(K)AVWLPAMK(A)   peptide count: 1
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)AVWLPAVK(A)   peptide count: 5
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)AVWLPAVK(A)   peptide count: 5
A0572ACOT9, CGI-16, ACATE2Acyl-coenzyme A thioesterase 9, mitochondrialNP_062710(K)AVWMEDTK(L)   peptide count: 3
A5666Acot10Acyl-coenzyme A thioesterase 10, mitochondrialNP_073727(K)AVWMEDTK(L)   peptide count: 3
A0742TTNTitinNP_035782(K)AVYAQDPLYPPGPPAFPK(V)   peptide count: 1
A0742TTNTitinNP_082280(K)AVYAQDPLYPPGPPAFPK(V)   peptide count: 1
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorNP_038751(K)AVYELLK(D)   peptide count: 1
A6092COMTCatechol O-methyltransferase, membrane-bound formNP_031770(K)AVYQGPGSSPVK(S)   peptide count: 1
A9865DIABLO, SMACDiablo homolog, mitochondrialNP_075721(K)AVYTLVSLYR(Q)   peptide count: 16
A685CVPS13A, CHACChoreinNP_766616(K)AVYYTWADPVGSR(K)   peptide count: 2
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AWAVAR(L)   peptide count: 2
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)AWAVAR(L)   peptide count: 13
A619AIRF7Interferon regulatory factor 7NP_058546(K)AWAVAR(L)   peptide count: 13
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)AWEIQDAIIDK(N)   peptide count: 2
A8481RTN4IP1, NIMPReticulon-4-interacting protein 1, mitochondrialNP_570962(K)AWGAHVTAVCSK(D)   peptide count: 2
A428DFAM49B, BM009, BM-009Protein FAM49BNP_659095(K)AWGAVVPLVGK(L)   peptide count: 1
A0333SNAP25, SNAPSynaptosomal-associated protein 25NP_035558(K)AWGNNQDGVVASQPAR(V)   peptide count: 4
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorNP_031409(K)AWITNSWEASATVVFASTDR(S)   peptide count: 4
A9619MRPL49, NOF1Mitochondrial 60s ribosomal protein L49NP_080522(K)AWLLEK(G)   peptide count: 4
A6627GNMTGlycine N-methyltransferaseNP_034451(K)AWLLGLLR(Q)   peptide count: 2
A5767ALDH7A1, ATQ1Aldehyde dehydrogenase family 7 member A1NP_613066(K)AWNIWADIPAPK(R)   peptide count: 4
A6091COASY, NBPBifunctional coenzyme A synthaseNP_082172(K)AWNLLQK(R)   peptide count: 1
A391ETHNSL1Threonine synthase-like 1NP_808256(K)AWNMSASEK(L)   peptide count: 1
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)AWPVMLVGNAGTGK(S)   peptide count: 1
A0665USP9X, DFFRX, FAMUbiquitin carboxyl-terminal hydrolase FAF-XNP_033507(K)AWQTFIIDLLLHCHSK(T)   peptide count: 2
A029DNADK2, NADKD1, MNADKUPF0465 protein C5ORF33NP_001035485(K)AWSFNINR(V)   peptide count: 2
A7939VARS2, VARSL, VARS2LValyl-tRNA synthetase 2, mitochondrialNP_780346(K)AWSHK(E)   peptide count: 1
A347BCCDC51Coiled-coil domain-containing protein 51NP_079965(K)AWWDRYEEFVGLNEVR(E)   peptide count: 2
A3633HSD17B12Hydroxysteroid (17-beta) dehydrogenase 12NP_062631(K)AYAEELAK(R)   peptide count: 4
A6749HSDL1Steroid dehydrogenase-like proteinNP_780394(K)AYAEELASHGLNVILISQEEEK(L)   peptide count: 6
A6749HSDL1Steroid dehydrogenase-like proteinNP_780394(K)AYAEELASHGLNVILISQEEEKLQAAAK(H)   peptide count: 1
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)AYAEFYR(N)   peptide count: 70
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)AYAEFYR(N)   peptide count: 70
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)AYAEFYRNYDSMK(D)   peptide count: 3
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)AYAEFYRNYDSMK(D)   peptide count: 3
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)AYAEFYRNYDSMKDFEEMRK(A)   peptide count: 5
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)AYAEFYRNYDSMKDFEEMRK(A)   peptide count: 5
A0742TTNTitinNP_035782(K)AYANVSSK(C)   peptide count: 1
A0742TTNTitinNP_082280(K)AYANVSSK(C)   peptide count: 1
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_035991(K)AYAQQLTDWAK(R)   peptide count: 1
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_848142(K)AYAQQLTDWAK(R)   peptide count: 1
A8204XPNPEP2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-boundNP_573476(K)AYASGDVK(I)   peptide count: 1
A8204XPNPEP2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-boundNP_835175(K)AYASGDVK(I)   peptide count: 1
A6003CPDCarboxypeptidase D precursorNP_031780(K)AYASNHPIMK(T)   peptide count: 5
A6848GUK1, GMKGuanylate kinase 1NP_032219(K)AYATLK(Q)   peptide count: 5
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLNP_080841(K)AYATSQQIFQAIK(S)   peptide count: 13
A6464ESDS-formylglutathione hydrolaseNP_058599(K)AYDATCLVK(S)   peptide count: 2
A6464ESDS-formylglutathione hydrolaseXP_894321(K)AYDATCLVK(S)   peptide count: 2
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitNP_080960(K)AYDLVVDWPVTLVR(E)   peptide count: 79
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialNP_067274(K)AYEAQTEPVLQYYQK(K)   peptide count: 15
A9810CASQ1, CASQCalsequestrin, skeletal muscle isoform precursorNP_033943(K)AYEDAAEEFHPYIPFFATFDSK(V)   peptide count: 1
A4996MYOM2Myomesin 2NP_032690(K)AYEEIADEER(F)   peptide count: 1
A3911NAPG, SNAPGGamma-soluble NSF attachment proteinNP_082293(K)AYEQAGMMLK(E)   peptide count: 2
A5085PLS1Plastin 1, I isoformNP_001028382(K)AYFHLLNQIAPK(G)   peptide count: 1
A5087PLS3Plastin 3NP_663604(K)AYFHLLNQIAPK(G)   peptide count: 1
A1539KNG1, BDK, KNGKininogen-1NP_075614(K)AYFPCIGCVHAISTDSPDLEPVLK(H)   peptide count: 1
A569AEif1aEukaryotic translation initiation factor 1AXP_999676(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalNP_079713(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalXP_111312(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalXP_194845(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalNP_001013846(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalXP_619013(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalXP_898787(K)AYGELPEHAK(I)   peptide count: 3
A570AEIF1AX, EIF1A, EIF4CEukaryotic translation initiation factor 1A, X-chromosomalXP_999684(K)AYGELPEHAK(I)   peptide count: 3
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainNP_033851(K)AYGENIGYSEK(D)   peptide count: 11
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainNP_033851(K)AYGENIGYSEKDR(F)   peptide count: 1
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorNP_080111(K)AYGGAYDVMSSK(H)   peptide count: 13
A7776SARDH, DMGDHL1Sarcosine dehydrogenaseNP_619606(K)AYGIESHVLSPAETK(S)   peptide count: 29
A7989TKT, TKT1TransketolaseNP_033414(K)AYGLALAK(L)   peptide count: 1
A6654GzmeGranzyme ENP_034503(K)AYGLLAYAK(N)   peptide count: 1
A6655GzmfGranzyme FNP_034504(K)AYGVLTYGLNR(T)   peptide count: 3
A9666MRPS16, RPMS16, CGI-13228S ribosomal protein S16, mitochondrial precursorNP_079716(K)AYHGGHLTIR(L)   peptide count: 8
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_035991(K)AYHLACK(E)   peptide count: 1
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_848142(K)AYHLACK(E)   peptide count: 1
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_035991(K)AYHLACKEER(L)   peptide count: 2
A0501PACSIN1Protein kinase C and casein kinase substrate in neurons protein 1NP_848142(K)AYHLACKEER(L)   peptide count: 2
A9570RPL3760S ribosomal protein L37NP_080345(K)AYHLQK(S)   peptide count: 5
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitNP_083987(K)AYIHTR(M)   peptide count: 8
A543BNCKAP1L, HEM1Membrane-associated protein HEM-1NP_705725(K)AYISFIQSLAQFLGADASR(I)   peptide count: 4
A4770DNAH8Dynein, axonemal, heavy polypeptide 8NP_038839(K)AYITDGGTNHVWDQETPAVLK(K)   peptide count: 2
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursorNP_033386(K)AYKEAVSK(Y)   peptide count: 2
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)AYKEVK(I)   peptide count: 18
A0383ATP5F1ATP synthase B chain, mitochondrial precursorXP_997887(K)AYKEVK(I)   peptide count: 18
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5NP_084090(K)AYKEVK(I)   peptide count: 18
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)AYKEVK(N)   peptide count: 1
A0383ATP5F1ATP synthase B chain, mitochondrial precursorXP_997887(K)AYKEVK(N)   peptide count: 1
A5920BCAT2, BCATM, BCT2Branched-chain amino acid aminotransferase, mitochondrial precursorNP_033867(K)AYKGGDQQVR(L)   peptide count: 4
A6749HSDL1Steroid dehydrogenase-like proteinNP_780394(K)AYLDHFSR(A)   peptide count: 10
A0403ATP6V0D1, ATP6D, VPATPDVacuolar ATP synthase subunit D 1NP_038505(K)AYLESFYK(F)   peptide count: 2
A5926BHMTBetaine-homocysteine S-methyltransferase 1NP_057877(K)AYLMSQPLAYHTPDCGK(Q)   peptide count: 2
A3804EEF2, EF2Elongation factor 2NP_031933(K)AYLPVNESFGFTADLR(S)   peptide count: 2
A5123SFI1Spindle assembly associated SFI1 homologXP_911516(K)AYLPVNESFGFTADLR(S)   peptide count: 2
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorNP_663533(K)AYLRDFIYVSQDPKDQLLLGPTYATPK(V)   peptide count: 3
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorXP_930842(K)AYLRDFIYVSQDPKDQLLLGPTYATPK(V)   peptide count: 3
A1530MRC1L1, CLEC13DL, MRC1Macrophage mannose receptor 1-like protein 1NP_032651(K)AYLTTVEDRYEQAFLTSLVGLRPEK(Y)   peptide count: 2
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)AYMQNPNAIILCIQDGSVDAER(S)   peptide count: 9
A242DCtla2aProtein CTLA-2-alphaNP_031822(K)AYNLNEER(H)   peptide count: 2
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_001004863(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 6
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_001004865(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 5
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_907580(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 6
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_907583(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 6
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_907584(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 6
A3875KIDINS220, ARMSKinase D-interacting substance of 220 kDaXP_907585(K)AYNLNRTPSTVTLNNNTAPTNR(A)   peptide count: 6
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorNP_080111(K)AYNMLDIIHAVIDER(E)   peptide count: 53
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorNP_080111(K)AYNMLDIIHAVIDEREFFEIMPSYAK(N)   peptide count: 1
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)AYNNLIK(D)   peptide count: 7
A5957CRAT, CAT1Carnitine O-acetyltransferaseNP_031786(K)AYNNLIKDK(V)   peptide count: 1
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1NP_057930(K)AYQDR(Y)   peptide count: 1
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitNP_080960(K)AYQDR(Y)   peptide count: 1
A3994CHCHD6, CHCM1Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialNP_079627(K)AYQHCVSTAR(K)   peptide count: 19
A6760HK2Hexokinase, type IINP_038848(K)AYQILVR(L)   peptide count: 3
A4497P2RX3P2X purinoceptor 3NP_663501(K)AYQVR(D)   peptide count: 1
A0362YWHAG14-3-3 protein gammaNP_061359(K)AYSEAHEISK(E)   peptide count: 17
A489EWDR52WD repeat-containing protein 52XP_996284(K)AYSIENAR(K)   peptide count: 1
A6888LDHDD-lactate dehydrogenase, mitochondrialNP_081846(K)AYSTDVCVPISR(L)   peptide count: 4
A4147LRRCC1, CLERCLeucine-rich repeat and coiled-coil domain-containing protein 1NP_083191(K)AYSTLNK(K)   peptide count: 4
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorNP_031407(K)AYVDAR(V)   peptide count: 51
A3662PCPyruvate carboxylase, mitochondrial precursorNP_032823(K)AYVEANQMLGDLIK(V)   peptide count: 41
A9475SCARB2, CD36L2, LIMPIILysosome membrane protein 2NP_031670(K)AYVFER(N)   peptide count: 9
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorNP_001033320(K)AYVVLGQFLVLK(K)   peptide count: 3
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorNP_035923(K)AYVVLGQFLVLK(K)   peptide count: 3
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorXP_892826(K)AYVVLGQFLVLK(K)   peptide count: 3
A3582ACACA, ACAC, ACC1Acetyl-CoA carboxylase 1NP_579938(K)AYVWDNNKDLVEWLEK(Q)   peptide count: 2
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialNP_076135(K)AYYQLAK(K)   peptide count: 4
A5290SMRP1, CBE1Testes development-related NYD-SP22NP_001041470(K)CAAQDYTYK(S)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)CADGSSCINSR(Y)   peptide count: 4
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904939(K)CADGSSCINSR(Y)   peptide count: 4
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904947(K)CADGSSCINSR(Y)   peptide count: 4
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)CADGSSCINSR(Y)   peptide count: 4
A3965TPM1, TMSATropomyosin 1 alpha chainNP_077745(K)CAELEEELK(T)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)CAPGYIREPDGK(S)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)CAPGYIREPDGK(S)   peptide count: 1
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)CAPLATEVFDEK(T)   peptide count: 1
A4509RYR1, RYDRRyanodine receptor 1NP_033135(K)CAPLFAGTEHR(A)   peptide count: 1
A2454SYNE2, NUA, TROPHNesprin 2XP_922176(K)CASEIHTTLQSSQGGALEERSALITTENGRR(D)   peptide count: 1
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorNP_766599(K)CATITPDEAR(V)   peptide count: 22
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorNP_032159(K)CAVVDVPFGGAK(A)   peptide count: 37
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CCAEANPPACYGTVLAEFQPLVEEPK(N)   peptide count: 6
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeNP_035229(K)CCSGAIIVLTK(S)   peptide count: 1
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CCSGSLVER(R)   peptide count: 7
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CCTLPEDQR(L)   peptide count: 7
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CCTLPEDQRLPCVEDYLSAILNR(V)   peptide count: 8
A096BTDRD1Tudor domain containing protein 1NP_001002238(K)CCVSGVIPTAGEWSEGCVAAVK(A)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_001002240(K)CCVSGVIPTAGEWSEGCVAAVK(A)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_001002241(K)CCVSGVIPTAGEWSEGCVAAVK(A)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_113564(K)CCVSGVIPTAGEWSEGCVAAVK(A)   peptide count: 1
A343BCCDC136, NAG6Coiled-coil domain-containing protein 136XP_485735(K)CDALLAR(L)   peptide count: 1
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeNP_035229(K)CDENILWLDYK(N)   peptide count: 8
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)CDEWSIISEGK(I)   peptide count: 1
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorNP_663590(K)CDKVVQDLCK(V)   peptide count: 12
A0323RAP1A, KREV1Ras-related protein Rap-1ANP_663516(K)CDLEDER(V)   peptide count: 6
A0323RAP1A, KREV1Ras-related protein Rap-1AXP_001004974(K)CDLEDER(V)   peptide count: 6
A079ARAP1B, PNAS-140Ras-related protein Rap-1bNP_077777(K)CDLEDER(V)   peptide count: 6
A327CRAB3D, GOV, RAB16Ras-related protein Rab-3DNP_114080(K)CDLEDER(V)   peptide count: 6
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorNP_032836(K)CDLHR(L)   peptide count: 14
A314CRAB1A, RAB1Ras-related protein Rab-1ANP_033022(K)CDLTTK(K)   peptide count: 1
A0037RAB3ARas-related protein Rab-3ANP_033027(K)CDMEDERVVSSER(G)   peptide count: 1
A9929GRNGranulins precursorNP_032201(K)CDMEVSCPEGYTCCR(L)   peptide count: 3
A1466FN1, FNFibronectinNP_034363(K)CDPIDQCQDSETR(T)   peptide count: 1
A7932RARS2, RARSLArginyl-tRNA synthetase 2, mitochondrialNP_852071(K)CDTVVTAISAGPRTLNFKINR(E)   peptide count: 2
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1NP_031419(K)CDVDIR(K)   peptide count: 5
A4549ACTBL2Beta-actin-like protein 2NP_780706(K)CDVDIR(K)   peptide count: 5
A4552ACTG1, ACTGActin, cytoplasmic 2NP_033739(K)CDVDIR(K)   peptide count: 5
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1NP_031419(K)CDVDIRK(D)   peptide count: 13
A4549ACTBL2Beta-actin-like protein 2NP_780706(K)CDVDIRK(D)   peptide count: 13
A4552ACTG1, ACTGActin, cytoplasmic 2NP_033739(K)CDVDIRK(D)   peptide count: 13
A0121AMPH, AMPH1Amphiphysin INP_778172(K)CDVLWEDFHQK(L)   peptide count: 1
A6760HK2Hexokinase, type IINP_038848(K)CDVSFLESEDGSGK(G)   peptide count: 1
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2NP_032318(K)CEAVIADILDK(G)   peptide count: 3
A9105THEM4, CTMPThioesterase superfamily member 4NP_083707(K)CEDGSWKR(M)   peptide count: 1
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorNP_034607(K)CEFQDAYVLLSEK(K)   peptide count: 56
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)CEFQDAYVLLSEK(K)   peptide count: 56
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorNP_034607(K)CEFQDAYVLLSEKK(I)   peptide count: 1
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)CEFQDAYVLLSEKK(I)   peptide count: 1
A1468PLGPlasminogen precursorNP_032903(K)CEGETDFVCR(S)   peptide count: 1
A2142CORO1C, CRNN4, CRN2Coronin 1CNP_035909(K)CEIAR(F)   peptide count: 1
A2143CORO1A, CORO1Coronin-like protein p57NP_034028(K)CEIAR(F)   peptide count: 1
A6935LYZ, LZMLysozyme C precursorNP_038618(K)CEIAR(F)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)CEIQAALEEAEASLEHEEGK(I)   peptide count: 1
A3198MYH8Myosin-8NP_796343(K)CEIQAALEEAEASLEHEEGK(I)   peptide count: 1
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_001037854(K)CELNVTEDALK(A)   peptide count: 2
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorNP_035932(K)CELNVTEDALK(A)   peptide count: 2
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)CELSSSVQTDINLPYLTMDASGPK(H)   peptide count: 1
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_058566(K)CENLHSK(L)   peptide count: 1
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_997606(K)CENLHSK(L)   peptide count: 1
A5698ACSM3, SAH, SAAcyl-coenzyme A synthetase ACSM3, mitochondrial precursorNP_997607(K)CENLHSK(L)   peptide count: 1
A9552RPL2460S ribosomal protein L24NP_077180(K)CESAFLSK(R)   peptide count: 1
A9552RPL2460S ribosomal protein L24XP_978249(K)CESAFLSK(R)   peptide count: 1
A9552RPL2460S ribosomal protein L24XP_998829(K)CESAFLSK(R)   peptide count: 1
A9552RPL2460S ribosomal protein L24XP_001005405(K)CESAFLSK(R)   peptide count: 1
A6642GPX1Glutathione peroxidase 1NP_032186(K)CEVNGEK(A)   peptide count: 2
A581DVWA8Uncharacterized protein KIAA0564XP_001002205(K)CEVVAGSLK(I)   peptide count: 6
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetaseNP_062672(K)CEYPAACNALETLLIHR(D)   peptide count: 2
A7262ALDH18A1, GSAS, P5CSDelta 1-pyrroline-5-carboxylate synthetaseNP_705782(K)CEYPAACNALETLLIHR(D)   peptide count: 2
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)CFALYR(Q)   peptide count: 8
A4766DNAH3, DNAHC3BDynein heavy chain 3, axonemalXP_355934(K)CFEGIAK(L)   peptide count: 1
A4769DNAH7Dynein heavy chain 7, axonemalXP_981204(K)CFEGIAK(L)   peptide count: 1
A4769DNAH7Dynein heavy chain 7, axonemalXP_910605(K)CFEGIAK(L)   peptide count: 1
A4769DNAH7Dynein heavy chain 7, axonemalXP_897673(K)CFEGIAK(L)   peptide count: 1
A158ATMED4, ERS25, HNLFTransmembrane EMP24 domain-containing protein 4 precursorNP_598781(K)CFIEEIPDETMVIGNYR(T)   peptide count: 2
A702BTMED9, GP25L2, HSGP25L2GTransmembrane EMP24 domain-containing protein 9NP_080487(K)CFIEEIPDETMVIGNYR(T)   peptide count: 2
A6714FECHFerrochelatase, mitochondrial precursorNP_032024(K)CGAENIR(R)   peptide count: 2
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)CGCAFGTLEDDGKNCATSR(E)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)CGCAFGTLEDDGKNCATSR(E)   peptide count: 1
A1101IkbkapElongator complex protein 1NP_080355(K)CGDKPNMDSTVKLGAVGGNGFKVPLTTPHLEKR(Y)   peptide count: 1
A8416CASTCalpain inhibitorNP_033947(K)CGEDEDTVPAEYR(L)   peptide count: 1
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorNP_941055(K)CGFSELYSWQR(E)   peptide count: 5
A815CARMC4Armadillo repeat-containing protein 4XP_980630(K)CGGIQPLVNLLVGINQALLVNVTK(A)   peptide count: 1
A815CARMC4Armadillo repeat-containing protein 4XP_980682(K)CGGIQPLVNLLVGINQALLVNVTK(A)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorNP_063936(K)CGHTNNLRPK(K)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_356994(K)CGHTNNLRPK(K)   peptide count: 1
A1255UBA52, UBCEP2, CEP52Ubiquitin and ribosomal protein L40 precursorXP_989861(K)CGHTNNLRPK(K)   peptide count: 1
A1256UBBPolyubiquitin-BXP_984804(K)CGHTNNLRPK(K)   peptide count: 1
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorNP_075863(K)CGPMVLDALIK(I)   peptide count: 18
A8000TMEM55BType 1 phosphatidylinositol 4,5-bisphosphate 4-phosphataseNP_001028443(K)CGVCNEATPIK(N)   peptide count: 1
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1NP_032007(K)CGVEIISLK(A)   peptide count: 2
A9633RPS15A40S ribosomal protein S15aNP_733769(K)CGVISPR(F)   peptide count: 7
A9633RPS15A40S ribosomal protein S15aXP_978445(K)CGVISPR(F)   peptide count: 7
A4332HSPA4L, APG1, OSP94Osmotic stress protein 94NP_035150(K)CHAEHTPEEEIDHTGAK(A)   peptide count: 1
A6605GKGlycerol kinaseNP_032220(K)CHIAFAALEAVCFQTR(E)   peptide count: 8
A6605GKGlycerol kinaseNP_997609(K)CHIAFAALEAVCFQTR(E)   peptide count: 8
A6606GK2, GKP2, GKTAGlycerol kinase, testis specific 2NP_034424(K)CHIAFAALEAVCFQTR(E)   peptide count: 8
A9086CCDC44, TACO1, PRO0477Translational activator of Cytochrome C oxidase 1NP_081622(K)CHLDIK(Y)   peptide count: 3
A044DARMC12Uncharacterized protein C6ORF81NP_080566(K)CHPPLCSNSPICIAR(L)   peptide count: 4
A8216ZADH2Zinc-binding alcohol dehydrogenase domain-containing protein 2NP_666202(K)CHVIGTCSSDEK(A)   peptide count: 2
A0393ATP5S, ATPWATP synthase subunit s, mitochondrialNP_080812(K)CHYIEDNCLQR(L)   peptide count: 2
A4399TIMM13, TIM13B, TIMM13AMitochondrial import inner membrane translocase subunit TIM13 A/BNP_038923(K)CIAMCMDR(Y)   peptide count: 5
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70NP_613065(K)CIDLEPDNATTYVHK(G)   peptide count: 10
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)CIEDLK(L)   peptide count: 53
A0383ATP5F1ATP synthase B chain, mitochondrial precursorXP_997887(K)CIEDLK(L)   peptide count: 53
A8117USP24Ubiquitin carboxyl-terminal hydrolase 24XP_131566(K)CIEDLK(L)   peptide count: 16
A0383ATP5F1ATP synthase B chain, mitochondrial precursorNP_033855(K)CIEDLKLLAK(K)   peptide count: 1
A0383ATP5F1ATP synthase B chain, mitochondrial precursorXP_997887(K)CIEDLKLLAK(K)   peptide count: 1
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorNP_848492(K)CIELSCGSVR(K)   peptide count: 1
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)CIELSSGSVK(L)   peptide count: 8
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorNP_031407(K)CIGAIAMTEPGAGSDLQGVR(T)   peptide count: 12
A4399TIMM13, TIM13B, TIMM13AMitochondrial import inner membrane translocase subunit TIM13 A/BNP_038923(K)CIGKPGGSLDNSEQK(C)   peptide count: 16
A7156NFS1, NIFS, HUSSY-08Cysteine desulfurase, mitochondrial precursorNP_035041(K)CIHHVKR(L)   peptide count: 1
A7214NUDT9, NUDT10, UNQ3012/PRO9771ADP-ribose pyrophosphatase, mitochondrialNP_083070(K)CILQFVAIK(R)   peptide count: 3
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)CIPIWWK(C)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)CIPIWWK(C)   peptide count: 1
A9852COPS7A, CSN7A, DERP10COP9 signallosome complex subunit 7ANP_036133(K)CIPYAVLLEALALR(N)   peptide count: 1
A3500PRKG2, PRKGR2cGMP-dependent protein kinase 2NP_032952(K)CIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRK(T)   peptide count: 1
A1928DNM3Dynamin 3NP_001033708(K)CIRDLIPKTIMHLMINNVK(D)   peptide count: 2
A2387MYO9A, MYR7Myosin-IXaXP_986298(K)CIRSNAEKLPLR(F)   peptide count: 1
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)CISFR(D)   peptide count: 1
A4750DSTN, ACTDP, DSNDestrinNP_062745(K)CIVVEEGK(E)   peptide count: 1
A4750DSTN, ACTDP, DSNDestrinNP_062745(K)CIVVEEGKEILVGDVGATITDPFK(H)   peptide count: 1
A7439PNPLA8, IPLA2GAMMA, IPLA22Calcium-independent phospholipase A2 gammaNP_080440(K)CIWPDTPLECIVSLGTGR(Y)   peptide count: 2
A1044RANBP2, NUP358Ran-binding protein 2NP_035370(K)CKFEEAQNILKALGTNTSTAPNHTLR(I)   peptide count: 2
A545DHYDIN, HYDIN2, HYDIN1Hydrocephalus-inducing protein homologNP_766504(K)CKLSK(I)   peptide count: 1
A0665USP9X, DFFRX, FAMUbiquitin carboxyl-terminal hydrolase FAF-XNP_033507(K)CLAENAVYLCDR(E)   peptide count: 1
A064CKIF23, KNSL5, MKLP1Kinesin-like protein KIF23NP_077207(K)CLAFKALLKEFDNSLSNK(E)   peptide count: 1
A4131FAM29A, HAUS6, DGT6Haus augmin-like complex subunit 6NP_775576(K)CLARSHVARNR(F)   peptide count: 1
A1954GSTM1, GST1Glutathione S-transferase Mu 1XP_896015(K)CLDAFPNLK(D)   peptide count: 2
A1955GSTM2, GSTmu3, GST4Glutathione S-transferase mu 2NP_032209(K)CLDAFPNLK(D)   peptide count: 2
A6669Gstm7Glutathione S-transferase Mu 7NP_080948(K)CLDAFPNLK(D)   peptide count: 2
A1954GSTM1, GST1Glutathione S-transferase Mu 1NP_034488(K)CLDAFPNLR(D)   peptide count: 2
A1957GSTM4, GSTGlutathione S-transferase mu 4NP_034489(K)CLDAFPNLR(D)   peptide count: 2
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1XP_125901(K)CLDAVVSTR(H)   peptide count: 3
A1958GSTM5Glutathione S-transferase M5NP_034490(K)CLDEFPNLK(A)   peptide count: 1
A6206CPT2, CPT1Carnitine O-palmitoyltransferase II, mitochondrial precursorNP_034079(K)CLEDMFDALEGK(A)   peptide count: 8
A7030MIPEP, MIPMitochondrial intermediate peptidase, mitochondrial precursorNP_081712(K)CLEELLSSR(D)   peptide count: 1
A6241GAD2, GAD65Glutamate decarboxylase, 65 kDa isoformNP_032104(K)CLELAEYLYTIIK(N)   peptide count: 1
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1NP_032328(K)CLELFSELAEDKENYKK(F)   peptide count: 1
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaNP_034610(K)CLELFTELAEDKENYK(K)   peptide count: 1
A4240TBRG4, CPR2, FASTKD4Cell cycle progression 2 proteinNP_598772(K)CLELVEQFGPDELRK(V)   peptide count: 3
A858BCADPS, CAPS, CAPS1Calcium-dependent secretion activator 1NP_001036082(K)CLEQAALVNYSR(L)   peptide count: 2
A858BCADPS, CAPS, CAPS1Calcium-dependent secretion activator 1NP_036191(K)CLEQAALVNYSR(L)   peptide count: 2
A432ETTC18Tetratricopeptide repeat-containing protein 18XP_127606(K)CLFSLFR(D)   peptide count: 1
A8870LETMD1, HCCR1LETM1 domain-containing protein 1NP_598854(K)CLFVGLISIPPFANYLVFLLMYLFPRQLLVK(H)   peptide count: 1
A6202CPS1, CPSICarbamoyl-phosphate synthase [ammonia], mitochondrial precursorXP_129769(K)CLGLTEAQTR(E)   peptide count: 17
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformNP_031534(K)CLGNPER(E)   peptide count: 1
A7312PCK2, pck2, PEPCK2Phosphoenolpyruvate carboxykinase, mitochondrial precursor [GTP]NP_083270(K)CLHSVGQPLTGHGDPVGQWPCNPEK(T)   peptide count: 1
A0416TCIRG1, ATP6N1C, ATP6V0A3Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3NP_058617(K)CLIAEVWCAAR(D)   peptide count: 1
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1NP_058616(K)CLIAEVWCPVTDLDSIQFALR(R)   peptide count: 11
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1NP_058616(K)CLIAEVWCPVTDLDSIQFALRR(G)   peptide count: 1
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorNP_036149(K)CLIATGGTPR(S)   peptide count: 19
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)CLKDEDPYVR(K)   peptide count: 3
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)CLKDEDPYVR(K)   peptide count: 3
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1NP_031480(K)CLKDEDPYVR(K)   peptide count: 3
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)CLKDGGGDVAFVK(H)   peptide count: 1
A7504PITRM1, MP1Presequence protease, mitochondrialNP_660113(K)CLKENPK(F)   peptide count: 1
A0538TNK2, ACK1Activated CDC42 kinase 1NP_058068(K)CLKPDVLSQPEAMDDFIR(E)   peptide count: 1
A3745SLC25A20, CAC, CACTMitochondrial carnitine/acylcarnitine carrier proteinNP_065266(K)CLLQIQASSGENK(Y)   peptide count: 9
A0149MYO5A, MYH12Unconventional myosin-VaNP_034994(K)CLMEKLTNLEGVYNSETEK(L)   peptide count: 3
A6960ME2NAD-dependent malic enzyme, mitochondrial precursorNP_663469(K)CLPVCIDVGTDNMALLK(D)   peptide count: 2
A815CARMC4Armadillo repeat-containing protein 4XP_980630(K)CLSAETIANVAK(F)   peptide count: 1
A815CARMC4Armadillo repeat-containing protein 4XP_980682(K)CLSAETIANVAK(F)   peptide count: 1
A9600MRPL27, HSPC25039S ribosomal protein L27, mitochondrialNP_444391(K)CLYALEEGIVR(Y)   peptide count: 4
A9600MRPL27, HSPC25039S ribosomal protein L27, mitochondrialXP_892550(K)CLYALEEGIVR(Y)   peptide count: 4
A4401TIMM8A, DDP, DDP1Mitochondrial import inner membrane translocase subunit TIM8 ANP_038926(K)CMDKPGPK(L)   peptide count: 1
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)CMGGTPFFEDSSLFR(E)   peptide count: 3
A3814RPL14, RPL14L60S ribosomal protein L14NP_080250(K)CMQLTDFILK(F)   peptide count: 1
A827APAN3PABP1-dependent poly(A)-specific ribonuclease subunit 3NP_082567(K)CMVLVDMWKK(I)   peptide count: 3
A3672MAOAAmine oxidase [flavin-containing] ANP_776101(K)CMVYYK(E)   peptide count: 3
A3673MAOBAmine oxidase [flavin-containing] BNP_766366(K)CMVYYK(E)   peptide count: 3
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinNP_112442(K)CNEIISWLDK(N)   peptide count: 2
A0261PFKM, PFKX6-phosphofructokinase, muscle typeNP_067489(K)CNENYTTDFIFNLYSEEGK(G)   peptide count: 1
A7481CTSA, PPGBCathepsin ANP_001033581(K)CNFYDNKDPECVNNLLEVSR(I)   peptide count: 2
A7481CTSA, PPGBCathepsin ANP_032932(K)CNFYDNKDPECVNNLLEVSR(I)   peptide count: 2
A559DIQCGIQ domain-containing protein GNP_848465(K)CNRAEELLLEEIEKLR(M)   peptide count: 1
A0154ITPR1, INSP3R1Inositol 1,4,5-trisphosphate receptor type 1NP_034715(K)CNSLLPLDDIVR(V)   peptide count: 1
A4470ITPR2Inositol 1,4,5-trisphosphate receptor type 2NP_034716(K)CNSLLPLDDIVR(V)   peptide count: 1
A4470ITPR2Inositol 1,4,5-trisphosphate receptor type 2NP_064307(K)CNSLLPLDDIVR(V)   peptide count: 1
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_001017959(K)CNSVLTYNLTPVVQK(Y)   peptide count: 5
A8855LAMP2, lamp-2Lysosome-associated membrane glycoprotein 2 precursorNP_034815(K)CNSVLTYNLTPVVQK(Y)   peptide count: 5
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorNP_034814(K)CNTEEHIFVSK(M)   peptide count: 18
A7808SHPRHE3 ubiquitin-protein ligase SHPRHNP_766525(K)CNTEVAEAQQALQPVQQSIR(E)   peptide count: 2
A728AMTERFD3MTERF domain-containing protein 3, mitochondrial precursorNP_083108(K)CPALLCYPASVLEER(I)   peptide count: 1
A6464ESDS-formylglutathione hydrolaseNP_058599(K)CPALYWLSGLTCTEQNFISK(S)   peptide count: 1
A5144SPRR2B, SPRR2DSmall proline-rich protein 2BNP_035599(K)CPEPCPPPK(C)   peptide count: 2
A5145SPRR2DSmall proline-rich protein 2DNP_035600(K)CPEPCPPPK(C)   peptide count: 4
A5146SPRR2ESmall proline-rich protein 2ENP_035604(K)CPEPCPPPK(C)   peptide count: 8
A5148Sprr2kSmall proline-rich protein 2KNP_035607(K)CPEPCPPPK(C)   peptide count: 2
A1530MRC1L1, CLEC13DL, MRC1Macrophage mannose receptor 1-like protein 1NP_032651(K)CPESEQTAWIPFYGHCYYFESSFTR(S)   peptide count: 1
A9628RPS1140S ribosomal protein S11NP_038753(K)CPFTGNVSIR(G)   peptide count: 2
A0487HMOX2, HO2Heme oxygenase 2NP_034573(K)CPFYAAQPDK(G)   peptide count: 1
A1923ALDOA, ALDAFructose-bisphosphate aldolase ANP_031464(K)CPLLKPWALTFSYGR(A)   peptide count: 1
A0779ANP32A, LANP, MAPMAcidic leucine-rich nuclear phosphoprotein 32 family member ANP_033802(K)CPNLKHLNLSGNK(I)   peptide count: 1
A781CANP32C, PP32R1Acidic leucine-rich nuclear phosphoprotein 32 family member CNP_001005233(K)CPNLKHLNLSGNK(I)   peptide count: 1
A4990MUC3, MUC17Mucin-17XP_355711(K)CQCTSLFYGPR(C)   peptide count: 1
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinNP_032327(K)CQEVINWLDR(N)   peptide count: 1
A2006HSPA2Heat shock-related 70 kDa protein 2NP_001002012(K)CQEVINWLDR(N)   peptide count: 1
A0007ACTN2Alpha-actinin 2NP_150371(K)CQLEINFNTLQTK(L)   peptide count: 1
A2341ACTN1Alpha-actinin 1NP_598917(K)CQLEINFNTLQTK(L)   peptide count: 1
A2343ACTN3Alpha-actinin 3NP_038484(K)CQLEINFNTLQTK(L)   peptide count: 1
A2344ACTN4Alpha-actinin 4NP_068695(K)CQLEINFNTLQTK(L)   peptide count: 1
A0166STK39, SPAKSTE20/SPS1-related proline-alanine rich protein kinaseNP_058562(K)CQTSMDELLK(E)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)CQTTNICVPR(A)   peptide count: 1
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)CQTTNICVPR(A)   peptide count: 1
A9595MRPL20Mitochondrial ribosomal protein L20NP_079846(K)CQVELNR(K)   peptide count: 3
A9595MRPL20Mitochondrial ribosomal protein L20NP_079846(K)CQVELNRK(V)   peptide count: 1
A3212USH2AUsherinNP_067383(K)CQYPGKVCGHTCYSPGTK(V)   peptide count: 1
A246BZNF462Zinc finger protein 462NP_766455(K)CRHCPYINTRIHGVLTHYQK(R)   peptide count: 1
A4946LRRC4B, LRIG4Leucine-rich repeat-containing protein 4B precursorNP_937893(K)CRTGTSMTSVNWLTPNGTLMTHGSYR(V)   peptide count: 2
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorNP_083849(K)CSDFTEEICR(R)   peptide count: 15
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorNP_083849(K)CSDFTEEICRR(V)   peptide count: 6
A096BTDRD1Tudor domain containing protein 1NP_001002238(K)CSENGMINIAENLVMCGLAENLTSK(R)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_001002240(K)CSENGMINIAENLVMCGLAENLTSK(R)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_001002241(K)CSENGMINIAENLVMCGLAENLTSK(R)   peptide count: 1
A096BTDRD1Tudor domain containing protein 1NP_113564(K)CSENGMINIAENLVMCGLAENLTSK(R)   peptide count: 1
A5866ATAD3AATPase family, AAA domain containing, protein 3ANP_849534(K)CSEVAQLTEGMSGR(E)   peptide count: 1
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CSSMQK(F)   peptide count: 1
A1285TOP2B, topIIb, top2betaDNA topoisomerase 2 betaNP_033435(K)CSSVKYSK(I)   peptide count: 2
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)CSYDEHAK(L)   peptide count: 14
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorNP_038503(K)CSYTVEAHCR(D)   peptide count: 2
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainNP_001070022(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993410(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993705(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993740(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993773(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993811(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993853(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993888(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993920(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_993959(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994000(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994029(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994106(K)CTELNQAWTSLGK(R)   peptide count: 1
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainXP_994149(K)CTELNQAWTSLGK(R)   peptide count: 1
A925BCUBN, IFCRCubilinXP_130038(K)CTFDYVQIADGASINSYLGGR(F)   peptide count: 1
A925BCUBN, IFCRCubilinXP_904277(K)CTFDYVQIADGASINSYLGGR(F)   peptide count: 1
A025BSMARCD2, BAF60B, PRO2451SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily D, member 2NP_114084(K)CTLLLMLDHQPPQYKLDPR(L)   peptide count: 5
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorNP_077150(K)CTLPLTGK(Q)   peptide count: 6
A7782Oxct2bSuccinyl-CoA:3-ketoacid-coenzyme A transferase 2B, mitochondrialNP_862907(K)CTMPLTGK(R)   peptide count: 2
A7784OXCT2, FKSG25, H-SCOT-T3-oxoacid CoA transferase 2NP_071316(K)CTMPLTGK(R)   peptide count: 2
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)CTNIISNIISK(I)   peptide count: 2
A4768DNAH6, DNAHC6, DNHL1Dynein heavy chain 6, axonemalXP_918509(K)CTQAIPQVDISK(V)   peptide count: 1
A0429ACO2Aconitate hydratase, mitochondrial precursorNP_542364(K)CTTDHISAAGPWLK(F)   peptide count: 65
A3584FASN, FASFatty acid synthaseNP_032014(K)CTVFPK(A)   peptide count: 1
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1NP_034568(K)CTVSFLLSEDGSGK(G)   peptide count: 14
A015ANLRX1, NOD26, NOD5NLR family member X1NP_848507(K)CTVVASVLGSGR(H)   peptide count: 1
A4556ADAM2, FTNBADAM 2 precursorNP_033748(K)CVADTFLGYDCNLEK(C)   peptide count: 1
A1599CFH, HF, HF1Complement factor H precursorNP_034018(K)CVATDQLEK(C)   peptide count: 1
A1599CFH, HF, HF1Complement factor H precursorNP_001025148(K)CVATDQLEK(C)   peptide count: 1
A359DFAM136APutative uncharacterized protein FAM136ANP_079867(K)CVDDHMHLIPTMTK(K)   peptide count: 5
A359DFAM136APutative uncharacterized protein FAM136AXP_892663(K)CVDDHMHLIPTMTK(K)   peptide count: 5
A925BCUBN, IFCRCubilinXP_130038(K)CVDFVEIR(D)   peptide count: 4
A925BCUBN, IFCRCubilinXP_130038(K)CVDFVEIRDGGFETSPLIGIYCGSVFPPR(I)   peptide count: 1
A0095DNM1, DNMDynamin-1NP_034195(K)CVDMVISELISTVR(Q)   peptide count: 2
A4021TIMM8B, DDP2, DDPLTranslocase of inner mitochondrial membrane 8 homolog BNP_038925(K)CVEKPGSR(L)   peptide count: 1
A6606GK2, GKP2, GKTAGlycerol kinase, testis specific 2NP_034424(K)CVFSEHGLLTTLAYK(L)   peptide count: 4
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorNP_032159(K)CVGVGESDGSIWNPDGIDPK(E)   peptide count: 2
A8400CSTB, CST6, STFBCystatin BNP_031819(K)CVHLR(V)   peptide count: 1
A0797AKAP3, AKAP110, SOB1A-kinase anchor protein 3NP_033780(K)CVHQSLYMGDEPTPHK(S)   peptide count: 3
A3667GPD2Glycerol-3-phosphate dehydrogenase, mitochondrial precursorNP_034404(K)CVINASGPFTDSVR(K)   peptide count: 12
A205DCRYBG3Beta/gamma crystallin domain-containing protein 3NP_777273(K)CVLEEGER(V)   peptide count: 1
A7601Gykl1Glycerol kinase-like 1NP_034423(K)CVNSEHGLLTTVAYQLGR(Q)   peptide count: 4
A4764DNAH17, DNAHL1, DNEL2Dynein heavy chain 17, axonemalXP_126677(K)CVQDAIR(A)   peptide count: 1
A3671GLS, GLS1Glutaminase, kidney isoform, mitochondrial precursorXP_129846(K)CVQSNIVLLTQAFR(R)   peptide count: 16
A3671GLS, GLS1Glutaminase, kidney isoform, mitochondrial precursorXP_905282(K)CVQSNIVLLTQAFR(R)   peptide count: 16
A6317DHRS1Dehydrogenase/reductase SDR family member 1NP_081095(K)CVVALATDPNILNLSGK(V)   peptide count: 4
A8466Serpinb9gSerine (Or cysteine) peptidase inhibitor, clade B, member 9gNP_035585(K)CVVEVNEEGTEAAAASAVK(F)   peptide count: 1
A0155CDC42Cell division control protein 42 homologNP_033991(K)CVVVGDGAVGK(T)   peptide count: 14
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1NP_033033(K)CVVVGDGAVGK(T)   peptide count: 14
A075ARAC2, GOXRas-related C3 botulinum toxin substrate 2 precursorNP_033034(K)CVVVGDGAVGK(T)   peptide count: 14
A076ARAC3Ras-related C3 botulinum toxin substrate 3NP_573486(K)CVVVGDGAVGK(T)   peptide count: 14
A096ARHOG, ARHGRho-related GTP-binding protein RhoGNP_062512(K)CVVVGDGAVGK(T)   peptide count: 14
A1086RHOQ, ARHQ, RASL7ARho-related GTP-binding protein RhoQNP_663466(K)CVVVGDGAVGK(T)   peptide count: 14
A5110RHOJ, ARHJ, RASL7BRho-related GTP-binding protein RhoJNP_075764(K)CVVVGDGAVGK(T)   peptide count: 14
A7228BCKDHB2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursorNP_954665(K)CYDALR(K)   peptide count: 2
A7228BCKDHB2-oxoisovalerate dehydrogenase beta subunit, mitochondrial precursorNP_954665(K)CYDALRK(M)   peptide count: 1
A0524PFN1Profilin INP_035202(K)CYEMASHLR(R)   peptide count: 9
A942BDYNC2H1, DHC1B, DHC2Dynein, cytoplasmic, heavy chain 2NP_084127(K)CYLTLTQAMK(M)   peptide count: 1
A5968CA5BCarbonic anhydrase VB, mitochondrial precursorNP_062386(K)CYPAELHLVHWNAVK(F)   peptide count: 1
A5968CA5BCarbonic anhydrase VB, mitochondrial precursorNP_851832(K)CYPAELHLVHWNAVK(F)   peptide count: 1
A4135INTS3Integrator complex subunit 3NP_663515(K)CYRDLALVSRDGMNIVLNK(I)   peptide count: 1
A4135INTS3Integrator complex subunit 3NP_849207(K)CYRDLALVSRDGMNIVLNK(I)   peptide count: 1
A494DFOV, AMP18, CA11Gastrokine 1 precursorNP_079742(K)CYTADILWILR(M)   peptide count: 5
A5113RMDN2, FAM82A1, FAM82ARegulator of microtubule dynamics protein 2NP_958749(K)CYVELGEPQEACK(F)   peptide count: 1
A3574BASP1, NAP22Brain acid soluble protein 1NP_081671(K)DAADGEAKAEEK(E)   peptide count: 2
A5862ATAD1ATPase family AAA domain-containing protein 1NP_080763(K)DAAFQNVLTHVCLD(-)   peptide count: 1
A3961MYH10, SmembMyosin-10NP_780469(K)DAAGLESQLQDTQELLQEETR(Q)   peptide count: 1
A565DISOC2Isochorismatase domain-containing protein 2 mitochondrialNP_080434(K)DAAHPQFK(E)   peptide count: 15
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialNP_033777(K)DAAKPVIELYK(S)   peptide count: 5
A885BCLPB, HSP78, SKD3Suppressor of potassium transport defect 3NP_033217(K)DAALMEAAR(A)   peptide count: 7
A367DFAM166A, HSD46UPF0605 protein FAM166ANP_080900(K)DAAPLQDTPGK(N)   peptide count: 1
A5573OPA3Optic atrophy 3 proteinNP_997408(K)DAARRSEFFK(T)   peptide count: 1
A9035RTN4, NOGOC, NOGOReticulon 4NP_918940(K)DAASNEIPTLTK(K)   peptide count: 1
A9035RTN4, NOGOC, NOGOReticulon 4NP_918943(K)DAASNEIPTLTK(K)   peptide count: 1
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorNP_059062(K)DAATGAVK(E)   peptide count: 12
A422ETTC21A, STI2Tetratricopeptide repeat protein 21ANP_083011(K)DAATNYELAWKYSHQANPAIGFK(L)   peptide count: 1
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorNP_659093(K)DADEAVR(I)   peptide count: 23
A9505TOMM20Mitochondrial import receptor subunit TOM20 homologNP_077176(K)DAEAVQK(F)   peptide count: 3
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)DAEEAK(A)   peptide count: 1
A242ABDP1, TFNR, TFIIIB150Transcription factor TFIIIB component B'' homologXP_127501(K)DAEEAK(A)   peptide count: 1
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)DAEEAK(R)   peptide count: 1
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)DAEEAKR(V)   peptide count: 11
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)DAEEAKRVESQLK(I)   peptide count: 1
A3741Krt42Keratin, type I cytoskeletal 42NP_997648(K)DAEEWFFTK(T)   peptide count: 2
A428DFAM49B, BM009, BM-009Protein FAM49BNP_659095(K)DAEGILEDLQSYR(G)   peptide count: 4
A5303Catsperg2Cation channel sperm-associated protein subunit gamma 2NP_001034810(K)DAEMPCFLFR(D)   peptide count: 1
A858BCADPS, CAPS, CAPS1Calcium-dependent secretion activator 1NP_001036082(K)DAENVGR(L)   peptide count: 1
A580AMTIF2Mitochondrial translational initiation factor 2 precursorNP_598528(K)DAEVPIILAINK(C)   peptide count: 6
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorNP_084501(K)DAFLKK(H)   peptide count: 6
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorNP_659149(K)DAFQNAYLELGGLGER(V)   peptide count: 2
A0029ANXA6, ANX6Annexin A6NP_038500(K)DAFVAIVQSVK(N)   peptide count: 3
A594CTCN2, TC2Transcobalamin-2NP_056564(K)DAGDREYWQLLR(A)   peptide count: 2
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)DAGQISGLNVLR(V)   peptide count: 89
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinNP_112442(K)DAGTIAGLNVLR(I)   peptide count: 18
A0451HSPA5, GRP78Heat shock 70kDa protein 5NP_071705(K)DAGTIAGLNVMR(I)   peptide count: 11
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinNP_032327(K)DAGTITGLNVLR(I)   peptide count: 3
A2006HSPA2Heat shock-related 70 kDa protein 2NP_001002012(K)DAGTITGLNVLR(I)   peptide count: 3
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1NP_034608(K)DAGVIAGLNVLR(I)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1XP_001002795(K)DAGVIAGLNVLR(I)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1XP_001002803(K)DAGVIAGLNVLR(I)   peptide count: 1
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1NP_034609(K)DAGVIAGLNVLR(I)   peptide count: 1
A2008HSPA1LHeat shock 70 kDa protein 1-HOMNP_038586(K)DAGVIAGLNVLR(I)   peptide count: 1
A012CSLC2A3, GLUT3Solute carrier family 2, facilitated glucose transporter, member 3NP_035531(K)DAGVQEPIYATIGAGVVNTIFTVVSLFLVER(A)   peptide count: 1
A7249OXSM3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial precursorNP_081971(K)DAGVSPEQISYVNAHATSTPLGDAAENR(A)   peptide count: 1
A9610MRPL39, MRPL5, RPML539S ribosomal protein L39, mitochondrialNP_059100(K)DAHALIYR(D)   peptide count: 8
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)DAHDDIVTSEVDFTSEAVTAAETTEALR(A)   peptide count: 1
A3913GBAS, NIPSNAP2Protein NIPSNAP homolog 2NP_032121(K)DAHSNLLAK(K)   peptide count: 30
A3914NIPSNAP1NipSnap1 proteinNP_032724(K)DAHSTLLSK(K)   peptide count: 19
A4023MCU, CCDC109ACalcium uniporter protein, mitochondrialNP_001028431(K)DAIAQAEMDLK(R)   peptide count: 3
A4023MCU, CCDC109ACalcium uniporter protein, mitochondrialNP_001028431(K)DAIAQAEMDLKR(L)   peptide count: 17
A885BCLPB, HSP78, SKD3Suppressor of potassium transport defect 3NP_033217(K)DAIFIMTSNVASDEIAQHALQLR(Q)   peptide count: 8
A0024SYNGAP1Ras GTPase-activating protein SynGAPXP_990642(K)DAIGEFIR(A)   peptide count: 1
A5954MTHFD1L, FTHFSDC1Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-likeNP_758512(K)DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADK(I)   peptide count: 3
A0684SNAP91Clathrin coat assembly protein AP180NP_038697(K)DALEIYK(R)   peptide count: 4
A0684SNAP91Clathrin coat assembly protein AP180NP_038697(K)DALEIYKR(F)   peptide count: 6
A5817APRTAdenine phosphoribosyltransferaseNP_033828(K)DALEPGQR(V)   peptide count: 2
A7173NPLN-acetylneuraminate pyruvate lyase-like proteinNP_083025(K)DALISFLR(E)   peptide count: 1
A2330EEA1, ZFYVE2Early endosome antigen 1NP_001001932(K)DALLAELSTTK(E)   peptide count: 1
A6499FAN1, MTMR15Coiled-coil domain-containing protein MTMR15XP_890895(K)DALVSKDQNELPNQSVEIMPLGSLTSKLSRR(Y)   peptide count: 2
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorNP_058052(K)DAMLNAAFALAADISSK(S)   peptide count: 97
A2563CIRBP, A18HNRNP, CIRPCold-inducible RNA-binding proteinNP_031731(K)DAMMAMNGKSVDGR(Q)   peptide count: 1
A494DFOV, AMP18, CA11Gastrokine 1 precursorNP_079742(K)DAMPSLQDLDTMVK(E)   peptide count: 2
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)DAMQYASESK(D)   peptide count: 9
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)DAMQYASESKDTELAEELLQWFLQEEK(R)   peptide count: 2
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1NP_001003908(K)DAMQYASESKDTELAEELLQWFLQEEKR(E)   peptide count: 2
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)DAMVSQLSR(G)   peptide count: 5
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformXP_897768(K)DANGNGFATRLSNIFMIWKGKKPWISLPR(G)   peptide count: 2
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformXP_897768(K)DANGNGFATRLSNIFMIWKGKKPWISLPR(G)   peptide count: 8
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformNP_033120(K)DANGNSFATR(L)   peptide count: 2
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformNP_033120(K)DANGNSFATRLSNIFVIGKGNKPWISLPR(G)   peptide count: 4
A8657ANKRD11, MU-MB-20.240, LZ16Ankyrin repeat domain-containing protein 11XP_134514(K)DANKDMSR(A)   peptide count: 5
A8657ANKRD11, MU-MB-20.240, LZ16Ankyrin repeat domain-containing protein 11XP_907698(K)DANKDMSR(A)   peptide count: 5
A8657ANKRD11, MU-MB-20.240, LZ16Ankyrin repeat domain-containing protein 11XP_907700(K)DANKDMSR(A)   peptide count: 5
A8657ANKRD11, MU-MB-20.240, LZ16Ankyrin repeat domain-containing protein 11XP_907702(K)DANKDMSR(A)   peptide count: 5
A8657ANKRD11, MU-MB-20.240, LZ16Ankyrin repeat domain-containing protein 11XP_907711(K)DANKDMSR(A)   peptide count: 5
A0432PRDX6, AOP2Peroxiredoxin 6NP_031479(K)DANNMPVTAR(V)   peptide count: 1
A3767SLC25A33Solute carrier family 25 member 33NP_081736(K)DAPIVSSTDGAEK(S)   peptide count: 1
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1NP_766307(K)DAPNDASYDAVR(Q)   peptide count: 1
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorNP_080448(K)DAPQSK(F)   peptide count: 1
A450DFASTKD2Fast kinase domain-containing protein 2NP_766010(K)DAPSALK(K)   peptide count: 1
A5005NEBNebulinXP_130232(K)DAQANITNTNYKR(L)   peptide count: 2
A5981CATCatalaseNP_033934(K)DAQLFIQK(K)   peptide count: 15
A040CKPNA3, QIP2Importin alpha-3 subunitNP_032493(K)DAQVVQVVLDGLSNILK(M)   peptide count: 5
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorNP_062708(K)DAQWVGFITR(S)   peptide count: 12
A8481RTN4IP1, NIMPReticulon-4-interacting protein 1, mitochondrialNP_570962(K)DASELVR(K)   peptide count: 6
A6108CYP11A1, CYP11ACytochrome P450 11A1, mitochondrial precursorNP_062753(K)DASILFSCEGPNPER(F)   peptide count: 2
A8724COMMD3, BUPCOMM domain-containing protein 3NP_680087(K)DASKSLER(A)   peptide count: 1
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)DASPGSPLEK(L)   peptide count: 56
A6733HMGCS2Hydroxymethylglutaryl-CoA synthase, mitochondrial precursorNP_032282(K)DASPGSPLEKLVSSVSDLPK(R)   peptide count: 1
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorNP_031978(K)DASVVGFFR(D)   peptide count: 5
A7726ELAC2, HPC2Zinc phosphodiesterase ELAC protein 2NP_075968(K)DATLLIHEATLEDGLEEEAVEK(T)   peptide count: 1
A3615ENO1, ENO1L1, MBPB1Alpha enolaseNP_075608(K)DATNVGDEGGFAPNILENKEALELLK(T)   peptide count: 2
A3615ENO1, ENO1L1, MBPB1Alpha enolaseNP_001020559(K)DATNVGDEGGFAPNILENKEALELLK(T)   peptide count: 2
A3617ENO3Beta enolaseNP_031959(K)DATNVGDEGGFAPNILENNEALELLK(T)   peptide count: 1
A3616ENO2Gamma enolaseNP_038537(K)DATNVGDEGGFAPNILENSEALELVK(E)   peptide count: 1
A4033DMXL2, RC3DmX-like protein 2XP_358382(K)DATPPPVPAERPSYK(E)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)DATVLSFFHILNGAALR(G)   peptide count: 200
A8203XPNPEP1, XPNPEPL, XPNPEPL1Metallopeptidase M24 family proteinNP_573479(K)DAVALCELFNWLEQEVPK(G)   peptide count: 5
A146D Putative uncharacterized protein C12orf63XP_994223(K)DAVCETSR(N)   peptide count: 1
A5937BPHL, MCNAABiphenyl hydrolase-like proteinNP_080788(K)DAVDLMK(A)   peptide count: 16
A5937BPHL, MCNAABiphenyl hydrolase-like proteinNP_080788(K)DAVDLMKALQFK(Q)   peptide count: 1
A1215GANAB, G2ANNeutral alpha-glucosidase ABNP_032086(K)DAVHYGGWEHR(D)   peptide count: 1
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_666301(K)DAVILAK(V)   peptide count: 1
A5000MYBPC2, MYBPCFMyosin-binding protein C, fast-typeNP_835168(K)DAVILAK(V)   peptide count: 1
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorNP_067370(K)DAVITVPAFFNQAER(R)   peptide count: 1
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeNP_035229(K)DAVLNAWAEDVDLR(V)   peptide count: 14
A581DVWA8Uncharacterized protein KIAA0564XP_001002205(K)DAVPEDVKR(A)   peptide count: 9
A3163KAT8, MOF, MYST1Histone acetyltransferase MYST1NP_080646(K)DAVQKNSEKYLSELAEQPERK(I)   peptide count: 1
A7767SLC27A2, ACSVL1, FACVL1Very long-chain acyl-CoA synthetaseNP_036108(K)DAVSVFYVSR(T)   peptide count: 2
A772BABCA9ATP-binding cassette sub-family A member 9NP_671753(K)DAVVTITRLVNALK(L)   peptide count: 1
A0423GOT2Aspartate aminotransferase, mitochondrial precursorNP_034455(K)DAWAVR(H)   peptide count: 3
A7505PRODH, PIG6, POX2Proline oxidase, mitochondrial precursorNP_035302(K)DAYDNVTLDMELAR(R)   peptide count: 4
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)DAYNIFLK(A)   peptide count: 13
A159ATMEM35Transmembrane protein 35NP_080515(K)DAYSEMK(R)   peptide count: 1
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLNP_080841(K)DAYVYLK(N)   peptide count: 2
A6813IVDIsovaleryl-CoA dehydrogenase, mitochondrial precursorNP_062800(K)DCAGVILYAAECATQVALDGIQCLGGNGYINDFPMGR(F)   peptide count: 16
A7223OATOrnithine aminotransferase, mitochondrial precursorNP_058674(K)DCDAWK(V)   peptide count: 15
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)DCEDPNPLIR(A)   peptide count: 5
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)DCEDPNPLIR(A)   peptide count: 5
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1NP_031480(K)DCEDPNPLIR(A)   peptide count: 5
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorNP_663493(K)DCFIVYQGHHGDVGAPMADVILPGAAYTEK(S)   peptide count: 22
A6981MCEEMethylmalonyl-CoA epimerase, mitochondrial precursorNP_082902(K)DCGGVLVELEQA(-)   peptide count: 10
A0493GJA1, GJALGap junction alpha-1 proteinNP_034418(K)DCGSPK(Y)   peptide count: 1
A9700CMC1COX assembly mitochondrial protein homologNP_080718(K)DCLTAYYNDPAFYEECKLEYLK(E)   peptide count: 1
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorNP_080237(K)DCPVSSYNEWDPLEEVIVGR(A)   peptide count: 31
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_130308(K)DCSDGSDESDLCPHR(F)   peptide count: 4
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorXP_904952(K)DCSDGSDESDLCPHR(F)   peptide count: 4
A205DCRYBG3Beta/gamma crystallin domain-containing protein 3NP_777273(K)DCSIPVIELCPK(T)   peptide count: 1
A4403TOMM34, URCC3Mitochondrial import receptor subunit TOM34NP_080272(K)DCTSALALVPFSIKPLLR(R)   peptide count: 1
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorNP_035710(K)DCVGDVTENQVCNK(Q)   peptide count: 2
A332DEPDR1, MERP1, UCC1Mammalian ependymin related protein-1 precursorNP_598826(K)DCYPVQETFIR(N)   peptide count: 8
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorNP_034607(K)DDAMLLK(G)   peptide count: 88
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorXP_484008(K)DDAMLLK(G)   peptide count: 88
A8036TRIP12, ULFProbable E3 ubiquitin-protein ligase TRIP12NP_598736(K)DDARAQLMK(E)   peptide count: 1
A9553RPL2660S ribosomal protein L26NP_033106(K)DDEVQVVR(G)   peptide count: 4
A9553RPL2660S ribosomal protein L26XP_138109(K)DDEVQVVR(G)   peptide count: 4
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNP_032736(K)DDFDFGTMSHVIR(G)   peptide count: 16
A0114ATP2B4, MXRA1Plasma membrane calcium-transporting ATPase 4NP_998781(K)DDFLCLEGK(E)   peptide count: 3
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)DDFTQAMHVK(D)   peptide count: 36
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorNP_034611(K)DDIENMVK(N)   peptide count: 62
A537BMPV17LMPV17-like proteinNP_291042(K)DDIFLDLK(Q)   peptide count: 4
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorNP_083058(K)DDKDAIEEK(F)   peptide count: 19
A3971OPA1Optic atrophy 1 gene proteinNP_598513(K)DDKGIHHR(K)   peptide count: 10
A0742TTNTitinNP_035782(K)DDKGRYK(I)   peptide count: 1
A0742TTNTitinNP_082280(K)DDKGRYK(I)   peptide count: 1
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2NP_033852(K)DDKPVK(C)   peptide count: 1
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainNP_659170(K)DDKSSPK(K)   peptide count: 1
A036D UPF0600 protein C5ORF51NP_666042(K)DDLDFR(L)   peptide count: 1
A912C Uncharacterized protein C1ORF194XP_131080(K)DDLDFR(L)   peptide count: 1
A0099ITGB1, FNRB, MDF2Integrin beta-1 precursorNP_034708(K)DDLENVKSLGTDLMNEMR(R)   peptide count: 1
A5496TMEM11, PM1Transmembrane protein 11NP_775655(K)DDLHR(K)   peptide count: 2
A5599TMEM126ATransmembrane protein 126ANP_079736(K)DDLILNIISR(K)   peptide count: 15
A0216SLMAP, SLAP, UNQ1847/PRO3577Sarcolemmal associated protein 1NP_114397(K)DDLQGTQSETEAK(Q)   peptide count: 6
A1581ALB, GIG20, GIG42Serum albumin precursorNP_033784(K)DDNPSLPPFERPEAEAMCTSFK(E)   peptide count: 10
A2343ACTN3Alpha-actinin 3NP_038484(K)DDPIGNLNTAFEVAEK(Y)   peptide count: 1
A7040MMABCob(I)alamin adenosyltransferase, mitochondrial precursorNP_084232(K)DDQVFEAVGTTDELSSAIGFAMELVTEK(G)   peptide count: 13
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)DDQVFSMNPPK(Y)   peptide count: 2
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_001030931(K)DDREAQSICER(V)   peptide count: 8
A0253AP2B1, ADTB2, CLAPB1Adapter-related protein complex 2 beta 1 subunitNP_082191(K)DDREAQSICER(V)   peptide count: 8
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1NP_031480(K)DDREAQSICER(V)   peptide count: 8
A2345CLIP-170, CLIP1, CYLN1CAP-GLY domain-containing linker protein 1NP_062739(K)DDREDQLVK(A)   peptide count: 1
A2186TFAM, TCF6, TCF6L2Transcription factor A, mitochondrial precursorNP_033386(K)DDRIR(Y)   peptide count: 1
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialNP_080070(K)DDSIPVNR(N)   peptide count: 29
A473DFSIP2Fibrous sheath-interacting protein 2XP_141020(K)DDTQDPILNSIATIMK(S)   peptide count: 2
A0742TTNTitinNP_035782(K)DDVEAPR(I)   peptide count: 1
A0742TTNTitinNP_082280(K)DDVEAPR(I)   peptide count: 1
A6528FTMT, MTFFerritin, mitochondrial precursorNP_080562(K)DDWECGLR(A)   peptide count: 1
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateNP_032564(K)DEAAAATEPGAGAADK(E)   peptide count: 1
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorNP_077150(K)DEADADLINAGK(E)   peptide count: 7
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5XP_890015(K)DEAGNNVLTPPEAIQLGK(V)   peptide count: 1
A5051PCDHGA8Protocadherin gamma A8 precursorNP_291069(K)DEDACAPQAPPNTDWR(F)   peptide count: 2
A4388SCO1, SCOD1SCO1 protein homolog, mitochondrial precursorNP_001035115(K)DEDEDYIVDHTIIMYLIGPDGEFLDYFGQNK(K)   peptide count: 2
A4388SCO1, SCOD1SCO1 protein homolog, mitochondrial precursorXP_906712(K)DEDEDYIVDHTIIMYLIGPDGEFLDYFGQNK(K)   peptide count: 2
A599CTXN2, TRX2Thioredoxin, mitochondrial precursorNP_064297(K)DEDQLEAFLK(K)   peptide count: 5
A3916NIPSNAP3A, NIPSNAP4, HSPC299NipSnap4 proteinXP_485380(K)DEDWQEQFLIPNLPLIDK(Q)   peptide count: 1
A3916NIPSNAP3A, NIPSNAP4, HSPC299NipSnap4 proteinXP_485380(K)DEDWQEQFLIPNLPLIDKQESEITYLVPWCK(I)   peptide count: 1
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)DEEIDQLK(R)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)DEEIDQLK(R)   peptide count: 1
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)DEEIDQLK(R)   peptide count: 1
A3198MYH8Myosin-8NP_796343(K)DEEIDQLK(R)   peptide count: 1
A3195MYH4Myosin heavy chain, skeletal muscle, fetalNP_034985(K)DEEIDQLKR(N)   peptide count: 3
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_109604(K)DEEIDQLKR(N)   peptide count: 3
A3196MYH1Myosin heavy chain, skeletal muscle, adult 1NP_001034634(K)DEEIDQLKR(N)   peptide count: 3
A3198MYH8Myosin-8NP_796343(K)DEEIDQLKR(N)   peptide count: 3
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1NP_031476(K)DEGANAFFK(G)   peptide count: 271
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1XP_134169(K)DEGANAFFK(G)   peptide count: 271
A9987MACROD1, LRP16O-acetyl-ADP-ribose deacetylase MACROD1NP_598908(K)DEGIYR(E)   peptide count: 3
A889DGm904Gene model 904, (NCBI)XP_996053(K)DEIKVENVKGVDPREER(E)   peptide count: 6
A0802AKAP12, AKAP250A-kinase anchor protein 12NP_112462(K)DEKEHAADGPQHQSLAK(A)   peptide count: 4
A4311DNAJC3, P58IPK, PRKRIP58NP_032955(K)DEKPVEAIR(I)   peptide count: 1
A170DUNQ2439/PRO5000, PFTL2439, UNQ2439UPF0317 protein C14ORF159, mitochondrialNP_663423(K)DELLQAALSLSHAR(S)   peptide count: 2
A9493TFRCTransferrin receptor protein 1NP_035768(K)DESLAYYIENQFHEFK(F)   peptide count: 1
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)DESSDNFGSFFLR(H)   peptide count: 32
A7439PNPLA8, IPLA2GAMMA, IPLA22Calcium-independent phospholipase A2 gammaNP_080440(K)DETLQAAVR(E)   peptide count: 1
A0757CNTN1Contactin-1 precursorNP_031753(K)DETMTPSTAFQVKVKAFNNK(G)   peptide count: 1
A9475SCARB2, CD36L2, LIMPIILysosome membrane protein 2NP_031670(K)DEVLYLFPSDLCR(S)   peptide count: 8
A1591SERPING1, C1IN, C1NHSerine/cysteine proteinase inhibitor clade G member 1NP_033906(K)DFACVHQALK(G)   peptide count: 2
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorNP_031409(K)DFAEK(G)   peptide count: 2
A652ALRRFIP1, GCF2, TRIPLeucine-rich repeat Flightless-interacting protein 1NP_032541(K)DFAEK(G)   peptide count: 2
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinNP_082509(K)DFAETHIK(G)   peptide count: 39
A0911FRAP1, MTOR, FRAPSerine/threonine protein kinase MTORNP_064393(K)DFAHKRQK(T)   peptide count: 11
A6125CYP27A1, CYP27Cytochrome P450 27, mitochondrial precursorNP_077226(K)DFAHMPLLK(A)   peptide count: 1
A1552APOA1, A175PApolipoprotein A-I precursorNP_033822(K)DFANVYVDAVK(D)   peptide count: 1
A0429ACO2Aconitate hydratase, mitochondrial precursorNP_542364(K)DFAPGKPLK(C)   peptide count: 150
A643CTF, PRO1400Serotransferrin precursorNP_598738(K)DFASCHLAQAPNHVVVSR(K)   peptide count: 10
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorNP_080784(K)DFASESR(V)   peptide count: 8
A1598C3, CPAMD1Complement C3 precursorNP_033908(K)DFDSVPPVVR(W)   peptide count: 1
A0625MAP1BMicrotubule-associated protein 1BNP_032660(K)DFEELKAEEIDVAK(D)   peptide count: 1
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)DFEEMR(K)   peptide count: 6
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)DFEEMR(K)   peptide count: 6
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorNP_444301(K)DFEEMRK(A)   peptide count: 24
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorXP_920836(K)DFEEMRK(A)   peptide count: 24
A6206CPT2, CPT1Carnitine O-palmitoyltransferase II, mitochondrial precursorNP_034079(K)DFENGIGK(E)   peptide count: 24
A7191NT5M, DNT25'(3')-deoxyribonucleotidase, mitochondrial precursorNP_598790(K)DFFFELEPLPGAVEAVK(Q)   peptide count: 18
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialNP_083831(K)DFFGETVK(K)   peptide count: 5
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialNP_083831(K)DFFGETVKK(G)