PADB-logoLSSR - PepMap molecular information by study

Study ID 18578523
Species human
Disease 
Tissue / Source PC3 cancer cell
Compartment secretion

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A0053GNG2Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunitIPI00470619AAADLMAYCEAHAK2 
A0053GNG2Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunitIPI00470619AAADLMAYCEAHAK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AAAGIQPPGYLIHESACWSDTLQR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012AAAIGIDLGTTYSCVGVFQHGK2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012AAAIGIDLGTTYSCVGVFQHGK2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012AAAIGIDLGTTYSCVGVFQHGK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AAAVSSGFDGAIQLVSLGGR2 
A4736CLSTN3, CS3Calsyntenin-3 precursorIPI00396423AADDAEVEIQVKPTCKPSWQGWNK3 
A4736CLSTN3, CS3Calsyntenin-3 precursorIPI00396423AADDAEVEIQVKPTCKPSWQGWNK3 
A4736CLSTN3, CS3Calsyntenin-3 precursorIPI00396423AADDAEVEIQVKPTCKPSWQGWNK3 
A4736CLSTN3, CS3Calsyntenin-3 precursorIPI00396423AADDAEVEIQVKPTCKPSWQGWNK3 
A4736CLSTN3, CS3Calsyntenin-3 precursorIPI00396423AADDAEVEIQVKPTCKPSWQGWNK3 
A0446CSE1L, CAS, XPO2Exportin-2IPI00022744,IPI00219994AADEEAFEDNSEEYIR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR3 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AAEAAAAPAESAAPAAGEEPSKEEGEPK2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A098CLTBP4Latent TGF-beta binding protein-4IPI00025686,IPI00395783,IPI00639893AAECLDVDECHR2 
A6564GALNT4, POC1B-GALNT4, GALNAC-T4Polypeptide N-acetylgalactosaminyltransferase 4IPI00339297,IPI00641183AAEVWMDEYKEHFYNR2 
A6564GALNT4, POC1B-GALNT4, GALNAC-T4Polypeptide N-acetylgalactosaminyltransferase 4IPI00339297,IPI00641183AAEVWMDEYKEHFYNR2 
A6564GALNT4, POC1B-GALNT4, GALNAC-T4Polypeptide N-acetylgalactosaminyltransferase 4IPI00339297,IPI00641183AAEVWMDEYKEHFYNR2 
A6564GALNT4, POC1B-GALNT4, GALNAC-T4Polypeptide N-acetylgalactosaminyltransferase 4IPI00339297,IPI00641183AAEVWMDEYKEHFYNR3 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseIPI00004669AAEVWMDEYKNFYYAAVPSAR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AAFDDAIAELDTLSEESYK2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AAFDDAIAELDTLSEESYK2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AAFDDAIAELDTLSEESYK2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AAGSGELGVTMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AAGSGELGVTMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AAGSGELGVTMK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527,IPI00455557AAGVNVEPFWPGLFAK2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527,IPI00455557AAGVNVEPFWPGLFAK2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AAGVPSATITWR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AAGVPSATITWR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AAGVPSATITWR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AAGVPSATITWR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000AAHLCAEAALR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779AAHSEGNTTAGLDMR2 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSIPI00221354,IPI00260715,IPI00428056,IPI00645208AAIDWFDGKEFSGNPIK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK3 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK3 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK3 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK3 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK3 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AALAHSEEVTASQVAATK2 
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1IPI00010414AALANLCIGDVITAIDGENTSNMTHLEAQNR3 
A5069PDLIM1, CLIM1, CLP36PDZ and LIM domain protein 1IPI00010414AALANLCIGDVITAIDGENTSNMTHLEAQNR3 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818AALEDTLAETEAR2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818AALEDTLAETEAR2 
A8440LXN, MUMLatexin proteinIPI00106687AALVAQNYINYQQGTPHR2 
A8440LXN, MUMLatexin proteinIPI00106687AALVAQNYINYQQGTPHR2 
A7891STK24, MST3, STK3Serine/threonine protein kinase 24IPI00002212,IPI00335281,IPI00640104AANVLLSEHGEVK2 
A6804PPA1, IOPPP, PPInorganic pyrophosphataseIPI00015018,IPI00643288AAPFSLEYR2 
A6804PPA1, IOPPP, PPInorganic pyrophosphataseIPI00015018,IPI00643288AAPFSLEYR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00296537,IPI00333852,IPI00413623AAQAQGQSCEYSLMVGYQCGQVFR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAQLPDMPLEELGQQVDCDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAQLPDMPLEELGQQVDCDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAQLPDMPLEELGQQVDCDR2 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A024DCDV3, H41Carnitine deficiency-associated gene expressed in ventricle 3IPI00014197,IPI00478154AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK3 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045AASASESALQTVIKEDLPR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045AASASESALQTVIKEDLPR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AASDIAMTELPPTHPIR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AASDIAMTELPPTHPIR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AASDIAMTELPPTHPIR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AASDIAMTELPPTHPIR2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AASDIAMTELPPTHPIR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959,IPI00644294AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959,IPI00644294AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959,IPI00644294AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959,IPI00644294AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00413959AASEFESSEGVFLFPELR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00413959AASEFESSEGVFLFPELR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELKDWFVGR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATHYTITIR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATHYTITIR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATHYTITIR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATHYTITIR1 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATHYTITIR2 
A1525TNC, HXBTenascin precursorIPI00031008AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AATPYTVSIYGVIQGYR2 
A1422COL6A2Collagen alpha 2(VI) chain precursorIPI00304840AAVFHEKDYDSLAQPGFFDR2 
A1422COL6A2Collagen alpha 2(VI) chain precursorIPI00304840AAVFHEKDYDSLAQPGFFDR2 
A1422COL6A2Collagen alpha 2(VI) chain precursorIPI00304840AAVFHEKDYDSLAQPGFFDR2 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00437593,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822,IPI00414694,IPI00418138,IPI00478853,IPI00479309,IPI00654556AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELRDNDK2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292AAVSHWQQQSYLDSGIHSGATTTAPSLSGK3 
A1466FN1, FNFibronectinIPI00414283,IPI00642991AAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLK3 
A1466FN1, FNFibronectinIPI00414283,IPI00642991AAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLK3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931ACAELHQNVNVK2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931ACAELHQNVNVK2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931ACAELHQNVNVK2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931ACAELHQNVNVK2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931ACAELHQNVNVK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A7434PLOD2Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 precursorIPI00472165ACDELVEEMEHYGK2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00103397ACEDHCVAGCFCPEGTVLDDIGQTGCVPVSK3 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A5509VEGFCVascular endothelial growth factor C precursorIPI00028076ACEPGFSYSEEVCR2 
A2344ACTN4Alpha-actinin 4IPI00013808ACLISLGYDVENDR2 
A2344ACTN4Alpha-actinin 4IPI00013808ACLISLGYDVENDR2 
A2344ACTN4Alpha-actinin 4IPI00013808ACLISLGYDVENDR2 
A2344ACTN4Alpha-actinin 4IPI00013808ACLISLGYDVENDR2 
A9930MGSA alpha, CXCL1, GROGrowth-regulated alpha proteinIPI00013874ACLNPASPIVK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117ACNCNPMGSEPVGCR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117ACNCNPMGSEPVGCR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ACNCNPMGSEPVGCR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ACNCNPMGSEPVGCR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045ACPCPHTNSFATGCVVNGGDVR3 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00003951,IPI00377045ACPCPHTNSFATGCVVNGGDVR3 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045ACPCPHTNSFATGCVVNGGDVR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045ACPCPHTNSFATGCVVNGGDVR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045ACPCPHTNSFATGCVVNGGDVR2 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045ACPCPHTNSFATGCVVNGGDVR3 
A1516LamA3, LAMA3, LAMNALaminin alpha-3 chain precursorIPI00377045ACPCPHTNSFATGCVVNGGDVR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ACTEAEFACHSYNECVALEYR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ACTEAEFACHSYNECVALEYR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ACTEAEFACHSYNECVALEYR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ACTEAEFACHSYNECVALEYR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ACTEAEFACHSYNECVALEYR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693ADDGAGEFSTSVTRPSVLCDGQWHR3 
A8793smap-6, PTGFRN, CD9P1Prostaglandin F2 receptor negative regulator precursorIPI00022048ADDVRPEVTWSFSR2 
A0223PTPRF, LARProtein tyrosine phosphatase, receptor type, FIPI00107831,IPI00465186,IPI00642154ADEARPNTIDFGKDDQHFTVTGLHK3 
A0223PTPRF, LARProtein tyrosine phosphatase, receptor type, FIPI00107831,IPI00465186,IPI00642154ADEARPNTIDFGKDDQHFTVTGLHK3 
A0223PTPRF, LARProtein tyrosine phosphatase, receptor type, FIPI00107831,IPI00465186,IPI00642154ADEARPNTIDFGKDDQHFTVTGLHK3 
A0223PTPRF, LARProtein tyrosine phosphatase, receptor type, FIPI00107831,IPI00465186,IPI00642154ADEARPNTIDFGKDDQHFTVTGLHK3 
A8391CD109, CPAMD7Activated T-cell marker CD109IPI00152540ADGNQLTLEER2 
A5102PTK7, CCK4Tyrosine-protein kinase-like 7 precursorIPI00168812,IPI00174794,IPI00419941,IPI00478565,IPI00555762ADGSSLPEWVTDNAGTLHFAR2 
A5102PTK7, CCK4Tyrosine-protein kinase-like 7 precursorIPI00168812,IPI00174794,IPI00419941,IPI00478565,IPI00555762ADGSSLPEWVTDNAGTLHFAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ADLHAVQGWAAR2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470ADLINNLGTIAK2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470ADLINNLGTIAK2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00334775,IPI00414676ADLINNLGTIAK2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00334775,IPI00414676ADLINNLGTIAK2 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493,IPI00554481,IPI00554611,IPI00554702,IPI00554722,IPI00604710ADLLLSTQPGREEGSPLELER3 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493,IPI00554481,IPI00554611,IPI00554702,IPI00554722,IPI00604710ADLLLSTQPGREEGSPLELER3 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493,IPI00554481,IPI00554611,IPI00554702,IPI00554722,IPI00604710ADLLLSTQPGREEGSPLELER3 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237,IPI00554538ADPEEELSLTFALR2 
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1IPI00026268,IPI00641068,IPI00642117ADQELMTYSHDNIICGITSVSFSK3 
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1IPI00026268,IPI00641068,IPI00642117ADQELMTYSHDNIICGITSVSFSK3 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658,IPI00220813,IPI00220814,IPI00220815ADQVCINLR2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658,IPI00220813,IPI00220814,IPI00220815ADQVCINLR2 
A5973CAPN2, CANPL2Calpain-2 catalytic subunitIPI00289758,IPI00446140,IPI00644991ADYQAVDDEIEANLEEFDISEDDIDDGFRR3 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK1 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK1 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK1 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AEAEAWYQTK2 
A1668RPS1040S ribosomal protein S10IPI00008438,IPI00025842,IPI00398673AEAGAGSATEFQFR2 
A1668RPS1040S ribosomal protein S10IPI00008438,IPI00025842,IPI00398673AEAGAGSATEFQFR2 
A1754EFNB1, EFL3, EPLG2Ephrin-B1 precursorIPI00024307AEAGRPYEYYK2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AEAGVPAEFSIWTR2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901,IPI00099883,IPI00396108AEDMYSAQSHQAATPPK2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901,IPI00099883,IPI00396108AEDMYSAQSHQAATPPK2 
A0099ITGB1, FNRB, MDF2Integrin beta-1 precursorIPI00645194AEDYPIDLYYLMDLSYSMKDDLENVK3 
A9451PLXNB2, MM1Plexin B2IPI00398435,IPI00736693AEEASHWLWSR2 
A9451PLXNB2, MM1Plexin B2IPI00398435,IPI00736693AEEASHWLWSR2 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354,IPI00607623AEGEWLSFDVTDAVHEWLHHK2 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354,IPI00607623AEGEWLSFDVTDAVHEWLHHK3 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354,IPI00607623AEGEWLSFDVTDAVHEWLHHK3 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354,IPI00607623AEGEWLSFDVTDAVHEWLHHK2 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354,IPI00607623AEGEWLSFDVTDAVHEWLHHK3 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112AEGNPKPEIIWLR2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00383237,IPI00479186AEGSDVANAVLDGADCIMLSGETAK2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABIPI00011454,IPI00383581,IPI00441414,IPI00472068AEKDEPGAWEETFK2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABIPI00011454,IPI00383581,IPI00441414,IPI00472068AEKDEPGAWEETFK2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABIPI00011454,IPI00383581,IPI00472068AEKDEPGAWEETFK2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABIPI00011454,IPI00383581,IPI00472068AEKDEPGAWEETFK2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABIPI00011454,IPI00383581,IPI00472068AEKDEPGAWEETFK3 
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 2IPI00012268AELATEEFLPVTPILEGFVILR3 
A8967PSMD2, TRAP226S proteasome non-ATPase regulatory subunit 2IPI00012268AELATEEFLPVTPILEGFVILR3 
A5208TNS3, TEM6, TENS1Tensin 3IPI00470868,IPI00654623,IPI00658152AELDQLLSGFGLEDPGSSLK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AELELELGR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR2 
A7935TARSThreonyl-tRNA synthetase, cytoplasmicIPI00329633AELNPWPEYIYTR2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEMNELMEQTSEIITFAESGTAR2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEMNELMEQTSEIITFAESGTAR3 
A9958INHBAInhibin beta A chain precursorIPI00028670AEMNELMEQTSEIITFAESGTAR2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEMNELMEQTSEIITFAESGTAR2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEMNELMEQTSEIITFAESGTAR3 
A1018DIAPH1, DIAP1Diaphanous 1IPI00030876AEPHFLSILQHLLLVR2 
A1018DIAPH1, DIAP1Diaphanous 1IPI00030876AEPHFLSILQHLLLVR2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AEPPKAPEQEQAAPGPAAGGEAPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AEPPKAPEQEQAAPGPAAGGEAPK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AEPPKAPEQEQAAPGPAAGGEAPK3 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00455904AESHPEVNIEHLGQVVQCSR3 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00455904AESHPEVNIEHLGQVVQCSR3 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00383112AESHPEVSIEHLGQVVQCSR2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00383112AESHPEVSIEHLGQVVQCSR2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00383112AESHPEVSIEHLGQVVQCSR2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00383112AESHPEVSIEHLGQVVQCSR2 
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursorIPI00045536,IPI00301185,IPI00306719AESVVLEHR2 
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursorIPI00045536,IPI00301185,IPI00306719AESVVLEHR2 
A095DCHID1, GL008, SB139Chitinase domain-containing protein 1 precursorIPI00045536,IPI00301185,IPI00306719AESVVLEHR2 
A0625MAP1BMicrotubule-associated protein 1BIPI00008868,IPI00374770AETEEAEEPEEDGEEHVCVSASK2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEVWLFLK2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEVWLFLK2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEVWLFLK2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEVWLFLK2 
A9958INHBAInhibin beta A chain precursorIPI00028670AEVWLFLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AEWLAVKDER2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AEWLAVKDER2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AEWLAVKDER2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A2490SULF2, UNQ559/PRO1120, UNQ559Extracellular sulfatase Sulf-2 precursorIPI00297252,IPI00384856,IPI00555879AEYQTACEQLGQK2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AFAHLQVPER2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AFAHLQVPER2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AFAHLQVPER2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AFAHLQVPER2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AFAHLQVPER2 
A9531PCBP1Poly(rC)-binding protein 1IPI00016610AFAMIIDKLEEDINSSMTNSTAASRPPVTLR3 
A9532PCBP2Poly(rC)-binding protein 2IPI00012066,IPI00216689,IPI00470509AFAMIIDKLEEDISSSMTNSTAASRPPVTLR3 
A9532PCBP2Poly(rC)-binding protein 2IPI00012066,IPI00216689,IPI00470509AFAMIIDKLEEDISSSMTNSTAASRPPVTLR3 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK3 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK3 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK3 
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorIPI00298281AFDITYVR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1IPI00216106,IPI00290416AFEDDDITHVEGSVDPIR2 
A0520METHepatocyte growth factor receptor precursorIPI00029273AFFMLDGILSK2 
A0520METHepatocyte growth factor receptor precursorIPI00029273,IPI00294528AFFMLDGILSK2 
A0520METHepatocyte growth factor receptor precursorIPI00029273,IPI00294528AFFMLDGILSK2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576AFGPGLQGGSAGSPAR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AFGQFFSPGEVIYNK2 
A738AMYCT1, MTLC, MTMC1MYC target protein 1IPI00297164,IPI00646807AFPDS1 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561AFQLWSNVTPLTFTK2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00455904AFSYTEVEECGCMGR2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00455904AFSYTEVEECGCMGR2 
A7558ATIC, PURHBifunctional purine biosynthesis protein PURHIPI00289499AFTHTAQYDEAISDYFR2 
A7558ATIC, PURHBifunctional purine biosynthesis protein PURHIPI00289499AFTHTAQYDEAISDYFR2 
A7558ATIC, PURHBifunctional purine biosynthesis protein PURHIPI00289499AFTHTAQYDEAISDYFR2 
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorIPI00014230AFVDFLSDEIKEER2 
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorIPI00014230AFVDFLSDEIKEER2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00218343,IPI00719529AFVHWYVGEGMEEGEFSEAR2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00218343,IPI00719529AFVHWYVGEGMEEGEFSEAR2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00179709,IPI00180675,IPI00218343,IPI00387144,IPI00552356,IPI00655535,IPI00719529AFVHWYVGEGMEEGEFSEAR2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00179709,IPI00180675,IPI00218343,IPI00387144,IPI00552356,IPI00655535,IPI00719529AFVHWYVGEGMEEGEFSEAR2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00179709,IPI00180675,IPI00218343,IPI00387144,IPI00552356,IPI00655535,IPI00719529AFVHWYVGEGMEEGEFSEAR3 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00179709,IPI00180675,IPI00387144,IPI00552356,IPI00655535AFVHWYVGEGMEEGEFSEAR2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00179709,IPI00180675,IPI00387144,IPI00552356,IPI00655535AFVHWYVGEGMEEGEFSEAR2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750,IPI00180675,IPI00218343,IPI00328163,IPI00387144,IPI00478908,IPI00655535,IPI00719529AFVHWYVGEGMEEGEFSEAR2 
A8972PSME2Proteasome activator subunit 2IPI00384051,IPI00398048AFYAELYHIISSNLEK2 
A8972PSME2Proteasome activator subunit 2IPI00384051,IPI00398048AFYAELYHIISSNLEK2 
A8972PSME2Proteasome activator subunit 2IPI00384051,IPI00398048AFYAELYHIISSNLEK2 
A8972PSME2Proteasome activator subunit 2IPI00384051,IPI00398048AFYAELYHIISSNLEK2 
A8972PSME2Proteasome activator subunit 2IPI00384051,IPI00398048AFYAELYHIISSNLEK2 
A608ECRTAP, CASPCartilage-associated protein precursorIPI00220959,IPI00643719AFYECLAACEGSR2 
A608ECRTAP, CASPCartilage-associated protein precursorIPI00220959,IPI00643719AFYECLAACEGSR2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK3 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK3 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274,IPI00641881,IPI00642414,IPI00644109,IPI00644589,IPI00646269,IPI00646869,IPI00647351AGAAPYVQAFDSLLAGPVAEYLK3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00217778,IPI00643034AGALQLLLVGDK2 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR2 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR2 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR2 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A928KPLTPPhospholipid transfer protein precursorIPI00022733,IPI00643034AGALQLLLVGDKVPHDLDMLLR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AGCHFYAVCNQHCDIDR3 
A5836SMPDL3B, ASML3BSphingomyelin phosphodiesterase, acid-like 3BIPI00386427,IPI00550115AGDMVYIVGHVPPGFFEK2 
A408AEWSR1, EWSRNA-binding protein EWSIPI00009841,IPI00065554,IPI00293254AGDWQCPNPGCGNQNFAWR2 
A408AEWSR1, EWSRNA-binding protein EWSIPI00009841,IPI00065554,IPI00293254AGDWQCPNPGCGNQNFAWR2 
A408AEWSR1, EWSRNA-binding protein EWSIPI00009841,IPI00065554,IPI00293254AGDWQCPNPGCGNQNFAWR2 
A408AEWSR1, EWSRNA-binding protein EWSIPI00009841,IPI00065554,IPI00293254AGDWQCPNPGCGNQNFAWR2 
A606EIGSF9, IGSF9A, NRT1Immunoglobulin superfamily, member 9IPI00024053,IPI00514747AGESVVLGCDLLPPAGRPPLHVIEWLR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGFFGDAMK2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGFFGDAMK2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AGGAFLMAGQVAEQLR2 
A1695COL2A1Alpha-1 type II collagenIPI00186460,IPI00328134,IPI00383762,IPI00395679AGGAQLGVMQGPMGPMGPR2 
A5456pp6170, SCRIB, CRIB1Scribble homologIPI00410666,IPI00425560,IPI00425562,IPI00425566AGGPLGLSIVGGSDHSSHPFGVQEPGVFISK3 
A5733ADKAdenosine kinaseIPI00234368,IPI00290279AGHYAASIIIR2 
A5733ADKAdenosine kinaseIPI00234368,IPI00290279AGHYAASIIIR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136,IPI00719088AGIEIFVVVVGR2 
A5087PLS3Plastin 3IPI00216694,IPI00477225AGKPHLVLGLLWQIIK2 
A5087PLS3Plastin 3IPI00216694,IPI00477225AGKPHLVLGLLWQIIK3 
A5087PLS3Plastin 3IPI00216694,IPI00477225AGKPHLVLGLLWQIIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00383237,IPI00479186,IPI00735524AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00220644,IPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186AGKPVICATQMLESMIK2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2 
A491AH2AFV, H2AVHistone H2A.F/Z variantIPI00018278,IPI00026272,IPI00031562,IPI00045109,IPI00081836,IPI00102165,IPI00141938,IPI00216456,IPI00216457,IPI00216730,IPI00218448,IPI00219037,IPI00220855,IPI00249267,IPI00255316,IPI00291764,IPI00303315,IPI00339274,IPI00373807,IPI00398805,IPI00552873,IPIAGLQFPVGR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGLSSGFIGCVR2 
A4972MFGE8Lactadherin precursorIPI00002236,IPI00334005AGMVNAWTPSSNDDNPWIQVNLLR3 
A701CVPS4B, SKD1, VPS42Vacuolar sorting protein 4bIPI00182728,IPI00646952AGNYEEALQLYQHAVQYFLHVVK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AGPGTLSVTIEGPSK2 
A4201RAD23AUV excision repair protein RAD23 homolog AIPI00008219AGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAR3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK2 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK2 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK2 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK2 
A1374LMNA, LMN1Lamin A/CIPI00021405,IPI00216952,IPI00216953,IPI00514320,IPI00514817,IPI00644087AGQVVTIWAAGAGATHSPPTDLVWK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AGSNMLLIGVHGPTTPCEEVSMK3 
A7159NIT2, CUA002Omega-amidase NIT2IPI00549467AGTEEAIVYSDIDLKK2 
A7159NIT2, CUA002Omega-amidase NIT2IPI00549467AGTEEAIVYSDIDLKK2 
A7159NIT2, CUA002Omega-amidase NIT2IPI00549467AGTEEAIVYSDIDLKK2 
A7159NIT2, CUA002Omega-amidase NIT2IPI00549467AGTEEAIVYSDIDLKK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AGTLDLSLTVQGK2 
A4792EPPK1, EPIPLEpiplakin 1IPI00010951,IPI00735278AGTLTVEELGATLTSLLAQAQAQAR3 
A4792EPPK1, EPIPLEpiplakin 1IPI00010951,IPI00735278AGTLTVEELGATLTSLLAQAQAQAR3 
A4792EPPK1, EPIPLEpiplakin 1IPI00010951,IPI00735278AGTLTVEELGATLTSLLAQAQAQAR3 
A4792EPPK1, EPIPLEpiplakin 1IPI00010951,IPI00735278AGTLTVEELGATLTSLLAQAQAQAR3 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A1525TNC, HXBTenascin precursorIPI00031008,IPI00220213AGTPYTVTLHGEVR2 
A2344ACTN4Alpha-actinin 4IPI00013808AGTQIENIDEDFRDGLK2 
A2344ACTN4Alpha-actinin 4IPI00013808AGTQIENIDEDFRDGLK2 
A2344ACTN4Alpha-actinin 4IPI00013808AGTQIENIDEDFRDGLK3 
A2344ACTN4Alpha-actinin 4IPI00013808AGTQIENIDEDFRDGLK2 
A2344ACTN4Alpha-actinin 4IPI00013808AGTQIENIDEDFRDGLK2 
A2341ACTN1Alpha-actinin 1IPI00013508AGTQIENIEEDFRDGLK2 
A2341ACTN1Alpha-actinin 1IPI00013508AGTQIENIEEDFRDGLK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AGVENGKPTHFTVYTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AGVENGKPTHFTVYTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AGVENGKPTHFTVYTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AGVENGKPTHFTVYTK2 
A1155SEMA3B, SEMA5, SEMAASemaphorin 3B precursorIPI00012283,IPI00448569,IPI00556335,IPI00556441,IPI00655622AGVTAHTQVLAEER2 
A1155SEMA3B, SEMA5, SEMAASemaphorin 3B precursorIPI00012283,IPI00448569,IPI00556335,IPI00556441,IPI00655622AGVTAHTQVLAEER2 
A1155SEMA3B, SEMA5, SEMAASemaphorin 3B precursorIPI00012283,IPI00448569,IPI00556335,IPI00556441,IPI00655622AGVTAHTQVLAEER2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AGVVGPELHEQLLSAEK2 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK2 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK2 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK2 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESK3 
A584EITGBL1, OSCP, TIEDIntegrin beta-like protein 1IPI00170919,IPI00640865AGWHGDKCEFQCDITPWESKR3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572AGYFGDPLAPNPADK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572AGYFGDPLAPNPADK2 
A476DFXR2, FMR1L2Fragile X mental retardation syndrome related protein 2IPI00016250AGYSTDESSSSSLHATR2 
A476DFXR2, FMR1L2Fragile X mental retardation syndrome related protein 2IPI00016250AGYSTDESSSSSLHATR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330AHAVEGQVEDVVGNLR2 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A5250WDR1, PNAS-29WD-repeat containing protein 1IPI00182856,IPI00216256AHDGGIYAISWSPDSTHLLSASGDK3 
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorIPI00000877AHFNLDESGVLSLDR2 
A4350HYOU1, GRP170, ORP150Hypoxia up-regulated protein 1 precursorIPI00000877AHFNLDESGVLSLDR2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590,IPI00465016AHFSPSNIILDFPAAGSAAR3 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605,IPI00645888AHFWTWTNSWENFR2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00382697,IPI00382700,IPI00477536,IPI00480131AHGPGLEGGLVGKPAEFTIDTK2 
A1673COL4A5Collagen alpha 5(IV) chain precursorIPI00514121AHGQDLGTAGSCLR2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AHGVSSYDTVISR2 
A9072STC2Stanniocalcin 2 precursorIPI00008780AHHGEAGHHLPEPSSR2 
A9072STC2Stanniocalcin 2 precursorIPI00008780AHHGEAGHHLPEPSSR2 
A9072STC2Stanniocalcin 2 precursorIPI00008780AHHGEAGHHLPEPSSR2 
A9072STC2Stanniocalcin 2 precursorIPI00008780AHHGEAGHHLPEPSSR2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131AHIANPSGASTECFVTDNADGTYQVEYTPFEK3 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A7316PCSK9, NARC1Proprotein convertase subtilisin/kexin type 9IPI00387168AHNAFGGEGVYAIAR2 
A1670COL4A2Collagen alpha 2(IV) chain precursorIPI00306322,IPI00479324AHNQDLGLAGSCLAR2 
A1670COL4A2Collagen alpha 2(IV) chain precursorIPI00306322,IPI00479324AHNQDLGLAGSCLAR2 
A1670COL4A2Collagen alpha 2(IV) chain precursorIPI00306322,IPI00479324AHNQDLGLAGSCLAR2 
A1670COL4A2Collagen alpha 2(IV) chain precursorIPI00306322,IPI00479324AHNQDLGLAGSCLAR2 
A4042PPP1CCSerine/threonine protein phosphatase PP1-gamma catalytic subunitIPI00005705,IPI00027423,IPI00218187,IPI00218236,IPI00410128,IPI00550451AHQVVEDGYEFFAK2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774,IPI00478540AHVIVMAATNRPNSIDPALR3 
A1477RBBP7, RBAP46Histone acetyltransferase type B subunit 2IPI00395865,IPI00552530,IPI00642026,IPI00646512AIFTGHSAVVEDVAWHLLHESLFGSVADDQK3 
A1477RBBP7, RBAP46Histone acetyltransferase type B subunit 2IPI00395865,IPI00552530,IPI00642026,IPI00646512AIFTGHSAVVEDVAWHLLHESLFGSVADDQK3 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK2 
A7521PSMA5Proteasome subunit alpha type 5IPI00291922AIGSASEGAQSSLQEVYHK2 
A7521PSMA5Proteasome subunit alpha type 5IPI00291922AIGSASEGAQSSLQEVYHK2 
A1164IPO5, KPNB3, RANBP5Importin 5IPI00329200AIGTEPDSDVLSEIMHSFAK2 
A1164IPO5, KPNB3, RANBP5Importin 5IPI00329200AIGTEPDSDVLSEIMHSFAK2 
A1164IPO5, KPNB3, RANBP5Importin 5IPI00329200AIGTEPDSDVLSEIMHSFAK2 
A3893HAPLN1, CRTL1Hyaluronan and proteoglycan link protein 1IPI00023601AIHIQAENGPHLLVEAEQAK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997,IPI00657796AIHYALNCCGLAGGVEQFISDICPK3 
A0248PXNPaxillinIPI00220030,IPI00220031,IPI00335634AILENYISALNTLWHPECFVCR3 
A0248PXNPaxillinIPI00220030,IPI00220031,IPI00335634AILENYISALNTLWHPECFVCR3 
A0248PXNPaxillinIPI00220030,IPI00220031,IPI00335634,IPI00335727AILENYISALNTLWHPECFVCR3 
A0248PXNPaxillinIPI00220030,IPI00220031,IPI00335634,IPI00335727AILENYISALNTLWHPECFVCR3 
A0248PXNPaxillinIPI00220030,IPI00220031,IPI00335634,IPI00335727AILENYISALNTLWHPECFVCR3 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK2 
A2341ACTN1Alpha-actinin 1IPI00013508AIMTYVSSFYHAFSGAQK3 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK2 
A2344ACTN4Alpha-actinin 4IPI00013808AIMTYVSSFYHAFSGAQK3 
A0098VCLVinculinIPI00291175,IPI00307162AIPDLTAPVAAVQAAVSNLVR2 
A0098VCLVinculinIPI00291175,IPI00307162AIPDLTAPVAAVQAAVSNLVR2 
A8868LTBP2, LTBP-2, LTBP3Latent-transforming growth factor beta-binding protein 2IPI00292150,IPI00718809,IPI00718986AISMLQGLCYR2 
A8868LTBP2, LTBP-2, LTBP3Latent-transforming growth factor beta-binding protein 2IPI00292150,IPI00718809,IPI00718986AISMLQGLCYR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803,IPI00296534,IPI00552981AITPPHPASQANIIFDITEGNLR3 
A6397DDX39, DDX39AATP dependent RNA helicase DDX39IPI00062206,IPI00166874,IPI00328343,IPI00552922,IPI00640787,IPI00641325,IPI00641634,IPI00641829,IPI00641926,IPI00641952,IPI00642800,IPI00642880,IPI00643815,IPI00644431AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK3 
A6397DDX39, DDX39AATP dependent RNA helicase DDX39IPI00062206,IPI00166874,IPI00328343,IPI00552922,IPI00640787,IPI00641325,IPI00641634,IPI00641829,IPI00641926,IPI00641952,IPI00642800,IPI00642880,IPI00643815,IPI00644431AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK3 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR3 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR3 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A3494AGRN, AGRINAgrinIPI00479925AIVDVHFDPTTAFR2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK3 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK2 
A1174ldlr, LDLRLow-density lipoprotein receptor precursorIPI00000070AIVVDPVHGFMYWTDWGTPAK3 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875,IPI00640222,IPI00737999,IPI00738289,IPI00738381,IPI00738462AKDPFAHLPK2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A1722APLP2, APPL2, HSD-2Amyloid-like protein 2 precursorIPI00031030,IPI00220977,IPI00220978,IPI00334946AKEQLEIR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362AKFEELNMDLFR2 
A8400CSTB, CST6, STFBCystatin BIPI00021828AKHDELTYF2 
A8400CSTB, CST6, STFBCystatin BIPI00021828AKHDELTYF2 
A1609CALR, CRTCCalreticulin precursorIPI00020599AKIDDPTDSKPEDWDKPEHIPDPDAK3 
A1609CALR, CRTCCalreticulin precursorIPI00020599AKIDDPTDSKPEDWDKPEHIPDPDAK3 
A1609CALR, CRTCCalreticulin precursorIPI00020599AKIDDPTDSKPEDWDKPEHIPDPDAK3 
A1609CALR, CRTCCalreticulin precursorIPI00020599AKIDDPTDSKPEDWDKPEHIPDPDAK3 
A1609CALR, CRTCCalreticulin precursorIPI00020599AKIDDPTDSKPEDWDKPEHIPDPDAK3 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012AKIHDIVLVGGSTR2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012AKIHDIVLVGGSTR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKLEAAIAEAEER2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AKLEQLFQDEVAK2 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK2 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK2 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK2 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A4791EPCAM, GA733-2, M1S2Epithelial cell adhesion moleculeIPI00296215AKPEGALQNNDGLYDPDCDESGLFK3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00232311,IPI00332887,IPI00375705,IPI00479267,IPI00656087,IPI00656113AKPSAPVVSGPAAR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A3848KRT7, SCLKeratin, type II cytoskeletal 7IPI00306959AKQEELEAALQR2 
A4163NASP, PRO1999Nuclear autoantigenic sperm proteinIPI00179953,IPI00219821,IPI00332499,IPI00646459AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR3 
A4163NASP, PRO1999Nuclear autoantigenic sperm proteinIPI00179953,IPI00219821,IPI00332499,IPI00646459AKQEPEVNGGSGDAVPSGNEVSENMEEEAENQAESR3 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY2 
A084CMMAA, IMAA, SLC7A5Large neutral amino acids transporter small subunit 1IPI00008986,IPI00643866ALAAPAAEEKEEAR2 
A084CMMAA, IMAA, SLC7A5Large neutral amino acids transporter small subunit 1IPI00008986,IPI00643866ALAAPAAEEKEEAR2 
A084CMMAA, IMAA, SLC7A5Large neutral amino acids transporter small subunit 1IPI00008986,IPI00643866ALAAPAAEEKEEAR2 
A084CMMAA, IMAA, SLC7A5Large neutral amino acids transporter small subunit 1IPI00008986,IPI00643866ALAAPAAEEKEEAR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ALAAVLEELR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ALAAVLEELR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ALAAVLEELR2 
A8978PTX3, TSG14, TNFAIP5Pentraxin-related protein PTX3IPI00029568ALAAVLEELR2 
A8446PCSK1NPROSAAS precursorIPI00002280,IPI00607596ALAHLLEAER2 
A8446PCSK1NPROSAAS precursorIPI00002280,IPI00607596ALAHLLEAER2 
A8446PCSK1NPROSAAS precursorIPI00002280,IPI00607596ALAHLLEAER2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ALANSLACQGKYTPSGQAGAAASESLFVSNHAY3 
A152ATGFB2Transforming growth factor beta 2 precursorIPI00220156,IPI00235354ALDAAYCFR2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK2 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAK3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571,IPI00644989ALDLFSDNAPPPELLEIINEDIAKR3 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818ALEAANGELEVK2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818ALEAANGELEVK2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818ALEAANGELEVK2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145,IPI00550818ALEAANGELEVK2 
A1585NID1, NIDNidogen-1IPI00026944,IPI00384542ALEGLQYPFAVTSYGK2 
A1585NID1, NIDNidogen-1IPI00026944,IPI00384542ALEGLQYPFAVTSYGK2 
A1585NID1, NIDNidogen-1IPI00026944,IPI00384542ALEGLQYPFAVTSYGK2 
A1585NID1, NIDNidogen-1IPI00026944,IPI00384542ALEGLQYPFAVTSYGK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00220848,IPI00478296ALEHVDGTHVCQLPEDQK3 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00220848,IPI00478296ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK3 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00027422,IPI00220845,IPI00220846,IPI00220847,IPI00478296ALEHVDGTHVCQLPEDQK3 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK3 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK2 
A1569ITGB4Integrin beta-4IPI00220845,IPI00220846,IPI00220847ALEHVDGTHVCQLPEDQK3 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALEPQGLLLYNGNAR2 
A4642ALCAM, MEMDCD166 antigen precursorIPI00015102ALFLETEQLKK2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576ALGALVDSCAPGLCPDWDSWDASKPVTNAR3 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576ALGALVDSCAPGLCPDWDSWDASKPVTNAR3 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576ALGALVDSCAPGLCPDWDSWDASKPVTNAR3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ALGALVDSCAPGLCPDWESWDPQKPVDNAR3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ALGALVDSCAPGLCPDWESWDPQKPVDNAR3 
A3584FASN, FASFatty acid synthaseIPI00026781,IPI00645907ALGLGVEQLPVVFEDVVLHQATILPK3 
A3584FASN, FASFatty acid synthaseIPI00026781,IPI00645907ALGLGVEQLPVVFEDVVLHQATILPK3 
A3584FASN, FASFatty acid synthaseIPI00026781,IPI00645907ALGLGVEQLPVVFEDVVLHQATILPK3 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALGPAGCEADASAPATCAEMR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALGPAGCEADASAPATCAEMR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALGPAGCEADASAPATCAEMR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALGPAGCEADASAPATCAEMR2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ALGTHVIHSTHTLPLTVTSQQGVK3 
A800CSOWAHC, ANKRD57Ankyrin-repeat domain-containing protein 57IPI00253323ALHAELVQHFR2 
A800CSOWAHC, ANKRD57Ankyrin-repeat domain-containing protein 57IPI00253323ALHAELVQHFR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572ALHEGVGSGSGSPDGAVVQGLVEK3 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainIPI00413728,IPI00478292,IPI00513786ALINADELASDVAGAEALLDR2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR2 
A6471EXT2Exostosin-2IPI00004047,IPI00414468ALLAGGGFSTWTYR2 
A6471EXT2Exostosin-2IPI00004047,IPI00414468ALLAGGGFSTWTYR2 
A6471EXT2Exostosin-2IPI00004047,IPI00414468ALLAGGGFSTWTYR2 
A6471EXT2Exostosin-2IPI00004047,IPI00414468ALLAGGGFSTWTYR2 
A6471EXT2Exostosin-2IPI00004047,IPI00414468ALLAGGGFSTWTYR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ALLELQLEPEELYQTFQR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ALLELQLEPEELYQTFQR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ALLELQLEPEELYQTFQR2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK3 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 
A064CKIF23, KNSL5, MKLP1Kinesin-like protein KIF23IPI00291579,IPI00293884ALLQEFDNAVLSK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ALMLCEGLFVADVTDFEGWK2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102ALMLQGVDLLADAVAVTMGPK3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102ALMLQGVDLLADAVAVTMGPK3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7481CTSA, PPGBCathepsin AIPI00021794,IPI00640525ALNIPEQLPQWDMCNFLVNLQYR3 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00453476,IPI00549725,IPI00740800ALPFWNEEIVPQIK2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK2 
A555EADAM8, MS2ADAM 8 precursorIPI00019158ALPSHLGLHPER2 
A555EADAM8, MS2ADAM 8 precursorIPI00019158ALPSHLGLHPER2 
A555EADAM8, MS2ADAM 8 precursorIPI00019158ALPSHLGLHPER2 
A555EADAM8, MS2ADAM 8 precursorIPI00019158ALPSHLGLHPER1 
A555EADAM8, MS2ADAM 8 precursorIPI00019158ALPSHLGLHPER2 
A7495PPT1, PPTPalmitoyl-protein thioesterase 1 precursorIPI00002412ALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIK3 
A7495PPT1, PPTPalmitoyl-protein thioesterase 1 precursorIPI00002412ALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIK3 
A7495PPT1, PPTPalmitoyl-protein thioesterase 1 precursorIPI00002412ALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIK3 
A6600GBA, GC, GLUCGlucosylceramidase precursorIPI00021807,IPI00374040ALQLAQRPVSLLASPWTSPTWLK2 
A6600GBA, GC, GLUCGlucosylceramidase precursorIPI00021807,IPI00374040ALQLAQRPVSLLASPWTSPTWLK3 
A6600GBA, GC, GLUCGlucosylceramidase precursorIPI00021807,IPI00374040ALQLAQRPVSLLASPWTSPTWLK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00479925ALQSNHFELSLR2 
A3494AGRN, AGRINAgrinIPI00479925ALQSNHFELSLR2 
A0218CTNND1, TXNDC14Catenin delta-1IPI00182469,IPI00182540,IPI00219725,IPI00219726,IPI00219727,IPI00219728,IPI00219730,IPI00219731,IPI00219732,IPI00219733,IPI00219734,IPI00219735,IPI00219737,IPI00219738,IPI00219739,IPI00219741,IPI00219742,IPI00219743,IPI00219744,IPI00219745,IPI00219746,IPIALSAIADLLTNEHER2 
A0218CTNND1, TXNDC14Catenin delta-1IPI00182469,IPI00182540,IPI00219725,IPI00219726,IPI00219727,IPI00219728,IPI00219730,IPI00219731,IPI00219732,IPI00219733,IPI00219734,IPI00219735,IPI00219737,IPI00219738,IPI00219739,IPI00219741,IPI00219742,IPI00219743,IPI00219744,IPI00219745,IPI00219746,IPIALSAIADLLTNEHER2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439,IPI00549682ALSDHHIYLEGTLLKPNMVTPGHACTQK3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439,IPI00549682ALSDHHIYLEGTLLKPNMVTPGHACTQK3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439,IPI00549682ALSDHHIYLEGTLLKPNMVTPGHACTQK3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439,IPI00549682ALSDHHIYLEGTLLKPNMVTPGHACTQK3 
A0821CD44, LHR, MDU2CD44 antigenIPI00297160,IPI00305064,IPI00418465,IPI00419219ALSIGFETCR2 
A0821CD44, LHR, MDU2CD44 antigenIPI00297160,IPI00305064,IPI00418465,IPI00419219ALSIGFETCR2 
A0821CD44, LHR, MDU2CD44 antigenIPI00297160,IPI00305064,IPI00418465,IPI00419219ALSIGFETCR2 
A1705IGFBP5, IBP5Insulin-like growth factor binding protein 5 precursorIPI00029236ALSMCPPSPLGCELVK2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918,IPI00549413,IPI00643231ALTGHLEEVVLALLK2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918,IPI00549413,IPI00643231ALTGHLEEVVLALLK2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918,IPI00549413,IPI00643231ALTGHLEEVVLALLK2 
A0808MSNMoesinIPI00219365,IPI00514912ALTSELANAR2 
A0808MSNMoesinIPI00219365,IPI00514912ALTSELANAR2 
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorIPI00014230ALVLDCHYPEDEVGQEDEAESDIFSIR3 
A7941WARS, IFI53, WRSTryptophanyl-tRNA synthetase, cytoplasmicIPI00383754ALXEVLQPLIAEHQAR2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524,IPI00012726,IPI00410017,IPI00478522,IPI00555747,IPI00642904,IPI00642944,IPI00644016ALYDTFSAFGNILSCK2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524,IPI00012726,IPI00410017,IPI00478522,IPI00555747,IPI00642904,IPI00642944,IPI00644016ALYDTFSAFGNILSCK2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935,IPI00018534,IPI00020101,IPI00152785,IPI00152906,IPI00166293,IPI00220403,IPI00303133,IPI00329665,IPI00419833,IPI00477495,IPI00515061,IPI00554445,IPI00554798,IPI00619923,IPI00655873,IPI00719084,IPI00719086AMGIMNSFVNDIFER2 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A1169APP, A4, AD1Amyloid beta A4 proteinIPI00006608,IPI00219187,IPI00412681,IPI00412924AMISRWYFDVTEGK3 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959AMQHISYLNSR2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257,IPI00413959AMQHISYLNSR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693AMTFHGHGFLR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693AMTFHGHGFLR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693AMTFHGHGFLR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693AMTFHGHGFLR2 
A7526PSMB1, PSC5Proteasome subunit beta type 1IPI00025019,IPI00556291AMTTGAIAAMLSTILYSR2 
A5065PCDH1Protocadherin 1 precursorIPI00000024,IPI00176458,IPI00215992ANDSDQGANAEIEYTFHQAPEVVR3 
A5065PCDH1Protocadherin 1 precursorIPI00000024,IPI00176458,IPI00215992ANDSDQGANAEIEYTFHQAPEVVR3 
A5065PCDH1Protocadherin 1 precursorIPI00000024,IPI00176458,IPI00215992ANDSDQGANAEIEYTFHQAPEVVR3 
A5065PCDH1Protocadherin 1 precursorIPI00000024,IPI00176458,IPI00215992ANDSDQGANAEIEYTFHQAPEVVR3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334,IPI00382696,IPI00477536,IPI00480131ANEPTHFTVDCTEAGEGDVSVGIK3 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A7564PXDN, MG50, PRG2Peroxidasin homologIPI00016112ANEQLGLTSMHTLWFR2 
A9554RPL26L1, RPL26P160S ribosomal protein L26-like 1IPI00007144,IPI00027270,IPI00433834,IPI00737562,IPI00741964ANGTTVHVGIHPSK2 
A5789PAMPeptidyl-glycine alpha-amidating monooxygenase precursorIPI00177543,IPI00219041,IPI00219042,IPI00219043ANILYAWAR2 
A5789PAMPeptidyl-glycine alpha-amidating monooxygenase precursorIPI00177543,IPI00219041,IPI00219042,IPI00219043ANILYAWAR2 
A0412ATP6AP2, ATP6IP2, CAPERRenin receptorIPI00168884,IPI00642797ANSVFEDLSVTLR2 
A0412ATP6AP2, ATP6IP2, CAPERRenin receptorIPI00168884,IPI00642797ANSVFEDLSVTLR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A1652MMP1, CLGInterstitial collagenase precursorIPI00008561ANSWFNCR2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00182138,IPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALK2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR3 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR3 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00181753,IPI00182138,IPI00296713APAHLSLPDPQALKR3 
A9929GRNGranulins precursorIPI00181753,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00181753,IPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR2 
A9929GRNGranulins precursorIPI00296713APAHLSLPDPQALKR3 
A0808MSNMoesinIPI00219365,IPI00514912APDFVFYAPR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A3623LGMN, PRSC1Legumain precursorIPI00293303APLTGHSCYPEALLHFR3 
A4275BAT3, BAG6, G3Large proline-rich protein BAT3IPI00082831,IPI00465128,IPI00513728,IPI00640922,IPI00641333,IPI00641784,IPI00641833,IPI00642424,IPI00642962,IPI00644058,IPI00644483,IPI00645431APPQTHLPSGASSGTGSASATHGGGSPPGTR3 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR3 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR2 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR3 
A1560LAMA5Laminin subunit alpha-5IPI00641693APQQGLLSLHPCLYSTLCR2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576APSVANVGSHCDLSLK2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592,IPI00333541,IPI00644576APSVANVGSHCDLSLK2 
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-AIPI00412206,IPI00478659,IPI00654736APVDFGYVGIDSILEQMR2 
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-AIPI00412206,IPI00478659,IPI00654736APVDFGYVGIDSILEQMR2 
A565EBEX5, NADE2, NGFRAP1L1NGFRAP1-like 1IPI00257933APVQNEAPALGGGEYQEPGGNVK2 
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorIPI00642217APWIEQEGPEYWDEETGK2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778APYYNYKDPAGHFHQVWYDNPQSISLK3 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778,IPI00643023APYYNYKDPAGHFHQVWYDNPQSISLK3 
A1941PLEC1, PLECPlectinIPI00014898,IPI00186711,IPI00215942,IPI00215943,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AQAEAQQPTFDALRDELR3 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096AQAEAQQPTFDALRDELR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLGELGQVVECSLDFGLVCR3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQASAQLVIQALPSVLINIR3 
A4963MATN2, UNQ193/PRO219, UNQ193Matrilin-2IPI00168520,IPI00473118,IPI00554542AQDDVSEWASK2 
A4963MATN2, UNQ193/PRO219, UNQ193Matrilin-2IPI00168520,IPI00473118,IPI00554542AQDDVSEWASK2 
A8959PSMC4, MIP224, TBP726S protease regulatory subunit 6BIPI00020042,IPI00216770AQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSR3 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR2 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A8409PI3, WAP3, WFDC14Elafin precursorIPI00021434AQEPVKGPVSTKPGSCPIILIR3 
A5557MAGED2, BCG1Melanoma-associated antigen D2IPI00009542,IPI00337823,IPI00477809,IPI00549529AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK3 
A5557MAGED2, BCG1Melanoma-associated antigen D2IPI00009542,IPI00337823,IPI00477809,IPI00549529AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK3 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQFDLAFVVR2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQFDLAFVVR2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQFDLAFVVR2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQFDLAFVVR2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorIPI00007765AQFEGIVTDLIR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572AQGGDGVVPDTELEGR2 
A1519LAMC2, LAMB2T, LAMNB2Laminin gamma-2 chain precursorIPI00015117,IPI00220572AQGGDGVVPDTELEGR2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVK3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE3 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQGYSGLSVK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQGYSGLSVK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQGYSGLSVK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQGYSGLSVK2 
A9472SARGSpecifically androgen-regulated gene proteinIPI00028392,IPI00719030,IPI00719131AQHLSPAPGLAQPAAPAQASAAIPAAGK3 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932AQIHDLVLVGGSTR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932AQIHDLVLVGGSTR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012AQIHDLVLVGGSTR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012AQIHDLVLVGGSTR2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012AQIHDLVLVGGSTR2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012AQIHDLVLVGGSTR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQLYIDCEK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQLYIDCEK2 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQLYIDCEK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154,IPI00419384AQQEQELAADAFK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192AQVEEFLAQHGSEYQSVK2 
A4614CDH11Cadherin-11 precursorIPI00293539,IPI00304227,IPI00386476AQYTLMAQAVDR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00339269,IPI00514377,IPI00643932,IPI00647012,IPI00736182,IPI00739759ARFEELCSDLFR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00339269,IPI00514377,IPI00643932,IPI00647012,IPI00736182,IPI00739759ARFEELCSDLFR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012ARFEELCSDLFR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012ARFEELCSDLFR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012ARFEELCSDLFR2 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269,IPI00736182ARFEELCSDLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00007702,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00037070ARFEELNADLFR2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865,IPI00037070ARFEELNADLFR2 
A4323FKBP3, FKBP25FK506-binding protein 3IPI00024157ARLEIEPEWAYGK2 
A3588PYGBGlycogen phosphorylase, brain formIPI00004358ARPEYMLPVHFYGR2 
A3588PYGBGlycogen phosphorylase, brain formIPI00004358ARPEYMLPVHFYGR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR2 
A9498TNFRSF12A, FN14Tumor necrosis factor receptor superfamily member 12AIPI00010277ARPHSDFCLGCAAAPPAPFR3 
A1489ITGA3, MSK18Integrin alpha-3 precursorIPI00215995,IPI00290043,IPI00556667ARPVINIVHK2 
A1489ITGA3, MSK18Integrin alpha-3 precursorIPI00215995,IPI00290043,IPI00556667ARPVINIVHK2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A1941PLEC1, PLECPlectinIPI00186711,IPI00398002,IPI00398775,IPI00398776,IPI00398777,IPI00398778,IPI00398779,IPI00420096ARQEELYSELQAR2 
A0083CTTN, EMS1CortactinIPI00029601,IPI00062884ASAGHAVSIAQDDAGADDWETDPDFVNDVSEK3 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ASCYNSALGCCSDGK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ASCYNSALGCCSDGK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ASCYNSALGCCSDGK2 
A3494AGRN, AGRINAgrinIPI00374563,IPI00479925ASCYNSALGCCSDGK2 
A6915LOXL1, LOXLLysyl oxidase homolog 1 precursorIPI00001597ASFCLEDSTCDFGNLKR2 
A6915LOXL1, LOXLLysyl oxidase homolog 1 precursorIPI00001597ASFCLEDSTCDFGNLKR2 
A587ELOXL2Lysyl oxidase homolog 2 precursorIPI00294839ASFCLEDTECEGDIQK2 
A587ELOXL2Lysyl oxidase homolog 2 precursorIPI00294839ASFCLEDTECEGDIQK2 
A587ELOXL2Lysyl oxidase homolog 2 precursorIPI00294839ASFCLEDTECEGDIQK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2344ACTN4Alpha-actinin 4IPI00013808ASFNHFDKDHGGALGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A2341ACTN1Alpha-actinin 1IPI00013508ASFNHFDRDHSGTLGPEEFK3 
A5297CRIM1, S52, UNQ1886/PRO4330Cysteine-rich motor neuron 1 protein precursorIPI00009294ASGKPGECCDLYECKPVFGVDCR3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249,IPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK3 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00302679,IPI00410152ASGLGDHCEDINECLEDK2 
A4638URB, CCDC80, DRO1Coiled-coil domain-containing protein 80 precursorIPI00260630ASGVEGQVVAEGNDGGGGAGRPSLGSEK3 
A4638URB, CCDC80, DRO1Coiled-coil domain-containing protein 80 precursorIPI00260630ASGVEGQVVAEGNDGGGGAGRPSLGSEK3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK1 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673,IPI00644992,IPI00646772ASHEEVEGLVEK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2341ACTN1Alpha-actinin 1IPI00013508ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A2344ACTN4Alpha-actinin 4IPI00013808ASIHEAWTDGK2 
A6470EXT1Exostosin-1IPI00293128ASISTENFRPNFDVSIPLFSK3 
A6470EXT1Exostosin-1IPI00293128ASISTENFRPNFDVSIPLFSK3 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQR2 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQR2 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQR2 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQR2 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQR2 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8IPI00554648,IPI00736008,IPI00736370,IPI00737728,IPI00737756,IPI00741505ASLEAAIADAEQRGELAIK2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorIPI00007765ASNGDAWVEAHGK2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorIPI00007765ASNGDAWVEAHGK2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorIPI00007765ASNGDAWVEAHGK2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorIPI00007765ASNGDAWVEAHGK2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1509FBN2, PP187Fibrillin 2 precursorIPI00019439ASQDQTMCMDVDECER2 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A1560LAMA5Laminin subunit alpha-5IPI00477868ASQSLDGTYQGGGVCIDCQHHTAGVNCER3 
A0229ARPC1B, ARC41ARP2/3 complex 41 kDa subunitIPI00005160,IPI00737530ASSEGGTAAGAGLDSLHK2 
A0229ARPC1B, ARC41ARP2/3 complex 41 kDa subunitIPI00005160,IPI00737530ASSEGGTAAGAGLDSLHK2 
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorIPI00013698,IPI00059685,IPI00418446,IPI00642660ASSFAGYVGMLTGFKPGLFSLTLNER3 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262,IPI00400826ASSIIDELFQDR2 
A3623LGMN, PRSC1Legumain precursorIPI00293303ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A3623LGMN, PRSC1Legumain precursorIPI00293303,IPI00384155,IPI00384156ASSPVPLPPVTHLDLTPSPDVPLTIMK3 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404ASSTCGLTKPETYCTQYGEWQMK3 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404ASSTCGLTKPETYCTQYGEWQMK3 
A1506LAMB3, LAMNB1Laminin beta-3 chain precursorIPI00299404,IPI00478330ASSTCGLTKPETYCTQYGEWQMK3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180,IPI00604414,IPI00645018ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00604414ASTDTMGRPCLPWNSATVLQQTYHAHR3 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012ATAGDTHLGGEDFDNR2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925,IPI00514377,IPI00643932,IPI00647012ATAGDTHLGGEDFDNR2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012ATAGDTHLGGEDFDNR2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMIPI00301277,IPI00304925,IPI00514377,IPI00643152,IPI00643932,IPI00647012ATAGDTHLGGEDFDNR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR2 
A6415EGLN2, EIT6Egl nine homolog 2IPI00074957ATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTK3 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350,IPI00375400ATAVVDGAFK2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350,IPI00375400ATAVVDGAFK2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00005033,IPI00019590,IPI00479511ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00005033,IPI00019590,IPI00479511ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00005033,IPI00019590,IPI00479511ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1496PLAT, tPATissue-type plasminogen activator precursorIPI00019590ATCYEDQGISYR2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR3 
A0446CSE1L, CAS, XPO2Exportin-2IPI00022744,IPI00219994ATIELCSTHANDASALR2 
A0446CSE1L, CAS, XPO2Exportin-2IPI00022744,IPI00219994ATIELCSTHANDASALR2 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR2 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR2 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR2 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR2 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A1157SEMA7A, CD108, SEMALSemaphorin 7A precursorIPI00025257ATIVHQDQAYDDKIYYFFR3 
A9055SIRPB1Signal-regulatory protein beta-1IPI00299724,IPI00412212ATPEHTVSFTCESHGFSPR2 
A1377PCNAProliferating cell nuclear antigenIPI00021700ATPLSSTVTLSMSADVPLVVEYK2 
A1377PCNAProliferating cell nuclear antigenIPI00021700ATPLSSTVTLSMSADVPLVVEYK2 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887,IPI00375705,IPI00479267,IPI00656087,IPI00656113ATPQHTVSFTCESHGFSPR2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK3 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK3 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK2 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDK3 
A5211SPOCK1, SPOCK, TIC1Testican-1 precursorIPI00005292ATQCHGSTGQCWCVDKYGNELAGSR3