PADB-logoLSSR - PepMap molecular information by study

Study ID 18501002
Species mouse
Disease healthy
Tissue / Source kidney
Compartment cortex

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A9567RPL3660S ribosomal protein L36RL36_MOUSEALRYPM*AVGLNKG 2 
A9567RPL3660S ribosomal protein L36RL36_MOUSEALRYPM*AVGLNKG 3 
A9567RPL3660S ribosomal protein L36RL36_MOUSEALRYPMAVGLNKG 3 
A9567RPL3660S ribosomal protein L36RL36_MOUSEALRYPMAVGLNKG 2 
A6823AK2, ADK2Adenylate kinase 2, mitochondrialKAD2_MOUSEAPNVLASEPEIPKGIRA 3 
A5635GOT1, GIG18Aspartate aminotransferase, cytoplasmicAATC_MOUSEAPPSVFAQVPQAPPVLVFKL 2 
A896BCOPECoatomer epsilon subunitCOPE_MOUSEAPPVPGAVSGGSGEVDELFDVKN 2 
A9542RPL15, EC4560S ribosomal protein L15RL15_MOUSEGAYKYIQELWRK 2 
A3802EEF1B2, EEF1B, EF1BEukaryotic translation elongation factor 1 beta 2EF1B_MOUSEGFGDLKTPAGLQVLNDYLADKS 2 
A3802EEF1B2, EEF1B, EF1BEukaryotic translation elongation factor 1 beta 2EF1B_MOUSEGFGDLKTPAGLQVLNDYLADKS 3 
A306CUQCRQ, QP-CCytochrome B-C1 complex subunit 8UCRQ_MOUSEGREFGNLARI 2 
A7149MME, EPNNeprilysinNEP_MOUSEGRSESQM*DITDINAPKPKK 3 
A7149MME, EPNNeprilysinNEP_MOUSEGRSESQMDITDINAPKPKK 3 
A1008FKBP1A, FKBP1, FKBP12FK506-binding protein 1AFKB1A_MOUSEGVQVETISPGDGRT 2 
A952ARPF1, BXDC5Ribosome production factor 1RPF1_MOUSEKAAAEEPQEAAAASDGTAESGVQPAKA 3 
A952ARPF1, BXDC5Ribosome production factor 1RPF1_MOUSEKAAAEEPQEAAAASDGTAESGVQPAKA 2 
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPYL2_MOUSEKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKA 3 
A329DMST133, EFHD1, PP1187Swiprosin 2EFHD1_MOUSEKAAAGELQEDSGLLALAKF 2 
A3524SEPT11, SEP11Septin-11SEP11_MOUSEKAAAQLLQSQAQQSGAQQTKK 3 
A3524SEPT11, SEP11Septin-11SEP11_MOUSEKAAAQLLQSQAQQSGAQQTKK 2 
A3524SEPT11, SEP11Septin-11SEP11_MOUSEKAAAQLLQSQAQQSGAQQTKKD 3 
A681AMECP2Methyl-CpG-binding protein 2MECP2_MOUSEKAAASEGVQVKR 2 
A1201PTPRK, PTPKReceptor-type protein-tyrosine phosphatase kappa precursorPTPRK_MOUSEKAAATEEPEVIPDPAKQ 2 
A3205TPM3Tropomyosin alpha 3 chainTPM3_MOUSEKAADAEAEVASLNRR 2 
A3205TPM3Tropomyosin alpha 3 chainTPM3_MOUSEKAADAEAEVASLNRR 3 
A116ASEL1L, TSA305, UNQ128/PRO1063Sel-1 homolog precursorSEL1L_MOUSEKAADMGNPVGQSGLGMAYLYGRG 2 
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmicC1TC_MOUSEKAAEEIGIKA 2 
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorCHCH3_MOUSEKAAEEVEAKF 2 
A3793PHBProhibitinPHB_MOUSEKAAELIANSLATAGDGLIELRK 2 
A0787FKBP4, FKBP52FK506-binding protein 4FKBP4_MOUSEKAAENGAQSAPLPLEGVDISPKQ 2 
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7NDUA7_MOUSEKAAESSAMAATEKK 2 
A0778MAP4Microtubule-associated protein 4MAP4_MOUSEKAAEVESVKEQLPAKA 2 
A0280YWHAE14-3-3 protein epsilon1433E_MOUSEKAAFDDAIAELDTLSEESYKD 2 
A6254DCXR, KIDCRL-xylulose reductaseDCXR_MOUSEKAAGAQVVAVSRT 2 
A9941IGBP1, IBP1Immunoglobulin-binding protein 1IGBP1_MOUSEKAAGM*LSQLDLFSRN 2 
A9941IGBP1, IBP1Immunoglobulin-binding protein 1IGBP1_MOUSEKAAGMLSQLDLFSRN 2 
A4814FLNB, FLN3, TAPFilamin-BFLNB_MOUSEKAAGSGELGVTVKG 2 
A9579RPLP1, RRP160S acidic ribosomal protein P1RLA1_MOUSEKAAGVSVEPFWPGLFAKA 2 
A572CSTXBP2, UNC18B, Hunc18b2Syntaxin binding protein 2STXB2_MOUSEKAAHIFFTDTCPEPLFSELGRS 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAAHKQEPGLGFSFELTEQQKE 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAAHKQEPGLGFSFELTEQQKEFQATARK 3 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKAAIDWFDGKEFSGNPIKV 2 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKAAIDWFDGKEFSGNPIKV 3 
A7308Pbld2Phenazine biosynthesis-like domain-containing protein 2MAWB1_MOUSEKAAIGDTLVQDIRY 2 
A3793PHBProhibitinPHB_MOUSEKAAIISAEGDSKA 2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKAAIKHALSAGYRH 3 
A5242VIL1, VILVillin 1VILI_MOUSEKAAISDSVVEPAAKA 2 
A2536NCLNucleolinNUCL_MOUSEKAAKEAMEDGEIDGNKVTLDWAKPKG 3 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseDHPR_MOUSEKAALDGTPGM*IGYGMAKG 2 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseDHPR_MOUSEKAALDGTPGMIGYGM*AKG 2 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseDHPR_MOUSEKAALDGTPGMIGYGMAKG 2 
A4311DNAJC3, P58IPK, PRKRIP58DNJC3_MOUSEKAALPDLTKVIALKMDFTAARL 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAANEAGYFNEEM*APIEVKT 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAANEAGYFNEEMAPIEVKT 1 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAANEAGYFNEEMAPIEVKT 2 
A7067MST4, RP6-213H19.1, STK3Serine/threonine protein kinase MASKMST4_MOUSEKAANVLLSEQGDVKL 2 
A766ANHP2, NOLA2, HSPC286NHP2 proteinNOLA2_MOUSEKAAPEESEAQAEGCSEERT 2 
A6210CRLS1, CLS1Cardiolipin synthaseCRLS1_MOUSEKAAPEPAAGGGGAAAQAPSARW 2 
A6210CRLS1, CLS1Cardiolipin synthaseCRLS1_MOUSEKAAPEPAAGGGGAAAQAPSARW 3 
A7718RNF25RING finger protein 25RNF25_MOUSEKAAPEPQQPMELYQPSAESLRQ 2 
A6727HINT2HIT-17kDaHINT2_MOUSEKAAPGGASPTIFSRI 2 
A352ESSSCA1Sjogren's syndrome/scleroderma autoantigen 1SSA27_MOUSEKAAQAPPLPAAPPNTDAVASTQTALLQKL 2 
A352ESSSCA1Sjogren's syndrome/scleroderma autoantigen 1SSA27_MOUSEKAAQAPPLPAAPPNTDAVASTQTALLQKL 3 
A5652ACAD8, ARC42, IBDAcyl-CoA dehydrogenase family member 8, mitochondrial precursorACAD8_MOUSEKAAQLGFGGVYVRT 2 
A7831SLK, STK2, HSLKCTCL tumor antigen se20-9SLK_MOUSEKAAQSGEGDEALAPTQTLAEKPTEGPEAGGAEEEPPGGERV 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKAASADSTTEGTPTDGFTVLSTKS 2 
A0280YWHAE14-3-3 protein epsilon1433E_MOUSEKAASDIAMTELPPTHPIRL 3 
A2065TULP3, TUBL3Tubby related protein 3TULP3_MOUSEKAASETGASGVTAQQGDAQLGEVENLEDFAYSPAPRG 3 
A2065TULP3, TUBL3Tubby related protein 3TULP3_MOUSEKAASETGASGVTAQQGDAQLGEVENLEDFAYSPAPRG 2 
A4575ANXA4, PIG28, ANX4Annexin A4ANXA4_MOUSEKAASGFNATEDAQTLRK 2 
A4575ANXA4, PIG28, ANX4Annexin A4ANXA4_MOUSEKAASGFNATEDAQTLRKA 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKAASGTKEDPNLVPSISNKR 3 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKAASGTKEDPNLVPSISNKRI 3 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKAASGTKEDPNLVPSISNKRI 2 
A8416CASTCalpain inhibitorICAL_MOUSEKAASLGSSQPSRPHVGEAATATKV 3 
A059BSTRAP, MAWD, UNRIPSerone-threonine kinase receptor-associated proteinSTRAP_MOUSEKAATAAADFTAKV 2 
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainADHX_MOUSEKAAVAWEAGKPLSIEEIEVAPPKA 2 
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainADHX_MOUSEKAAVAWEAGKPLSIEEIEVAPPKAHEVRI 3 
A408AEWSR1, EWSRNA-binding protein EWSEWS_MOUSEKAAVEWFDGKDFQGSKL 2 
A0778MAP4Microtubule-associated protein 4MAP4_MOUSEKAAVGVTGNDITTPPNKEPPPSPEKKA 3 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKAAVLWELHKPFTIEDIEVAPPKA 3 
A5868ATG3, APG3, APG3LAutophagy-related protein 3ATG3_MOUSEKADAGGEDAILQTRT 2 
A4845GORASP2, GOLPH6Golgi reassembly-stacking protein 2GORS2_MOUSEKADASSLTVDVTSPASKV 2 
A4845GORASP2, GOLPH6Golgi reassembly-stacking protein 2GORS2_MOUSEKADASSLTVDVTSPASKVPTTVEDRV 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKADCTITM*ADSDLLALM*TGKM 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKADCTITM*ADSDLLALMTGKM 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKADCTITMADSDLLALMTGKM 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_MOUSEKADDPSSYMEVVQAANASGNWEELVKY 2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKADEGISFRG 2 
A3883PALMParalemmin-1PALM_MOUSEKADEVTLSEAGSTAGPAEPRG 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKADGSTQVIDTKN 2 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKADIGVAMGIVGSDVSKQ 2 
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialRT23_MOUSEKADIQDIFYQEDQIRA 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKADLINNLGTIAKS 2 
A7375PGM1Phosphoglucomutase 1PGM1_MOUSEKADNFEYSDPVDGSISKN 2 
A5008NID2Nidogen-2NID2_MOUSEKADPGLVDVGTSSPGSDRV 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKADPLGLEAEKDGVPVFKF 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKADPLGLEAEKDGVPVFKFPRW 3 
A5796ENPEPGlutamyl aminopeptidaseAMPE_MOUSEKADPSQPPSELGYTWNIPVRW 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14RS14_MOUSEKADRDESSPYAAM*LAAQDVAQRC 3 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14RS14_MOUSEKADRDESSPYAAMLAAQDVAQRC 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14RS14_MOUSEKADRDESSPYAAMLAAQDVAQRC 3 
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorCOX41_MOUSEKADWSSLSRD 2 
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorCOX41_MOUSEKADWSSLSRDEKVQLYRI 3 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKADYAQLLEDMQNAFRS 2 
A4632CAMSAP3, NEZHACalmodulin-regulated Spectrin-associated protein 3K1543_MOUSEKAEAESGLGSPTSTPVAPEALSSEMSELGARL 2 
A7350PDXK, PKH, PNKPyridoxal kinasePDXK_MOUSEKAEAGEGQKPSPAQLELRM 3 
A7350PDXK, PKH, PNKPyridoxal kinasePDXK_MOUSEKAEAGEGQKPSPAQLELRM 2 
A480EWBP2WW domain binding protein 2WBP2_MOUSEKAEAGGGWEGSASYKL 2 
A812CARMC1, ARCPArmadillo repeat-containing protein 1ARMC1_MOUSEKAEALASAIASTKV 2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinCHM2A_MOUSEKAEATASALADADADLEERL 2 
A130ASH3GLB1, CGI-61, BIF-1Endophilin B1SHLB1_MOUSEKAECTKIWTEKIM*KQ 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKS 3 
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 1HS105_MOUSEKAEDVSAIEIVGGATRIPAVKE 2 
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalTHIKA_MOUSEKAEELGLPILGVLRS 2 
A3574BASP1, NAP22Brain acid soluble protein 1BASP_MOUSEKAEGAGTEEEGTPKESEPQAAADATEVKE 3 
A030APDCD10, CCM3, TFAR15Programmed cell death protein 10PDC10_MOUSEKAEKENPGLTQDIIMKI 2 
A784BABCG2, ABCP, BCRPATP-binding cassette, sub-family G, member 2ABCG2_MOUSEKAELDQLPGAQEKK 2 
A6777IDI1Isopentenyl-diphosphate delta-isomerase 1IDI1_MOUSEKAELGIPLEEVDLNEMDYLTRI 2 
A5242VIL1, VILVillin 1VILI_MOUSEKAELGNSGDWSQIADEVMSPKV 2 
A5827ASL, LP3236Argininosuccinate lyaseARLY_MOUSEKAEMQQILQGLDKV 2 
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31BAP31_MOUSEKAENEALAMQKQ 2 
A3574BASP1, NAP22Brain acid soluble protein 1BASP_MOUSEKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKA 3 
A9978LRRFIP2Leucine rich repeat Flightless-interacting protein 2LRRF2_MOUSEKAEQDIATLEQSISRL 2 
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2STML2_MOUSEKAEQINQAAGEASAVLAKA 2 
A1308BLMHBleomycin hydrolaseBLMH_MOUSEKAERLAFGESLM*THAM*TFTAVSEKD 3 
A586AEIF4G3Eukaryotic translation initiation factor 4 gamma, 3IF4G3_MOUSEKAESESDGQAEETADPQSLHSGRS 3 
A681AMECP2Methyl-CpG-binding protein 2MECP2_MOUSEKAETSESSGSAPAVPEASASPKQ 2 
A0787FKBP4, FKBP52FK506-binding protein 4FKBP4_MOUSEKAEVAAGDHPTDAEMKGERN 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKAEVITCDVLLVCIGRR 2 
A3531KTN1, CG1, PDIA6KinectinKTN1_MOUSEKAEVQKWQALANEQAATAHEVEKMQKS 3 
A5788AMACRAlpha-methylacyl-CoA racemaseAMACR_MOUSEKAEWCQIFDGTDACVTPVLTFEEALHHQHNRE 3 
A4617CDH16, UNQ695/PRO1340, UNQ695Cadherin-16 precursorCAD16_MOUSEKAEYQLQVTLESEDGRI 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKAFAAGADIKEM*QNRT 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKAFAAGADIKEMQNRT 2 
A0819RDXRadixinRADI_MOUSEKAFAAQEDLEKTKEELKT 2 
A0819RDXRadixinRADI_MOUSEKAFAAQEDLEKTKEELKT 3 
A9678MRPS31, IMOGN3828S ribosomal protein S31, mitochondrial precursorRT31_MOUSEKAFADEPPEPEASPSLWEIEFAKQ 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAFAGDIANQLATDAVQIFGGYGFNTEYPVEKL 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAFAGDIANQLATDAVQIFGGYGFNTEYPVEKL 3 
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorIPYR2_MOUSEKAFALDVINSAHERW 2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_MOUSEKAFAYLQVPERV 2 
A9670MRPS23, CGI-138, HSPC32928S ribososmal protein S23, mitochondrialRT23_MOUSEKAFDLFNPNFKS 2 
A0860CRADD, RAIDDDeath domain containing protein CRADDCRADD_MOUSEKAFDTFLDSLQEFPWVRE 2 
A681CHDLBP, HBP, VGLVigilinVIGLN_MOUSEKAFHPFIAGPYNRL 2 
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10IF3A_MOUSEKAFKDIDIEDLEELDPDFIM*AKQ 3 
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10IF3A_MOUSEKAFKDIDIEDLEELDPDFIMAKQ 3 
A3807RPLP060S acidic ribosomal protein P0RLA0_MOUSEKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKA 2 
A3807RPLP060S acidic ribosomal protein P0RLA0_MOUSEKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKA 3 
A3807RPLP060S acidic ribosomal protein P0RLA0_MOUSEKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKAEAKE 3 
A0621RAB10Ras-related protein Rab-10RAB10_MOUSEKAFLTLAEDILRK 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_MOUSEKAFM*TADLPNELIELLEKI 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_MOUSEKAFMTADLPNELIELLEKI 2 
A671AMBD3Methyl-CpG binding protein MBD3MBD3_MOUSEKAFMVTDDDIRKQEELVQQVRK 2 
A6464ESDS-formylglutathione hydrolaseESTD_MOUSEKAFSGYLGPDESKWKA 2 
A6464ESDS-formylglutathione hydrolaseESTD_MOUSEKAFSGYLGPDESKWKA 3 
A8906NSFL1C, UBXN2CNSFL1 cofactor P47NSF1C_MOUSEKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKA 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAFTGFIVEADTPGIHIGKKE 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKAFTGFIVEADTPGIHIGKKE 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKAGAGSATLSMAYAGARF 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKAGAGSATLSMAYAGARF 2 
A0784DYNC1LI1, DNCLI1Dynein light intermediate chain 1, cytosolicDC1L1_MOUSEKAGATSEGVLANFFNSLLSKK 2 
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCC2B_MOUSEKAGAYDFPSPEWDTVTPEAKN 2 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitETFB_MOUSEKAGDLGVDLTSKV 2 
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainADHX_MOUSEKAGDTVIPLYIPQCGECKF 2 
A1109BIN1, AMPHLMyc box dependent interacting protein 1BIN1_MOUSEKAGDVVLVIPFQNPEEQDEGWLMGVKE 2 
A3574BASP1, NAP22Brain acid soluble protein 1BASP_MOUSEKAGEASAESTGAADGAAPEEGEAKK 2 
A6774ICT1, DS1Immature colon carcinoma transcript 1 precursorICT1_MOUSEKAGELVLTSESSRY 2 
A150CMup1Major urinary protein 1MUP1_MOUSEKAGEYSVTYDGFNTFTIPKT 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKAGFAGDDAPRA 2 
A0097TLN1, TLNTalin 1TLN1_MOUSEKAGFLDLKDFLPKE 3 
A0097TLN1, TLNTalin 1TLN1_MOUSEKAGFLDLKDFLPKE 2 
A492AH2AFY2, MACROH2A2Core histone macro-H2A.2H2AW_MOUSEKAGGKEFLETVKELRK 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAGGLATTGDKDILDIVPTEIHQKA 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAGGLATTGDKDILDIVPTEIHQKA 3 
A610CTIMM22, TEX4, TIM22Mitochondrial import inner membrane translocase subunit TIM22TIM22_MOUSEKAGGSAPEAAGSAEAPLQYSLLLQYLVGDKR 2 
A610CTIMM22, TEX4, TIM22Mitochondrial import inner membrane translocase subunit TIM22TIM22_MOUSEKAGGSAPEAAGSAEAPLQYSLLLQYLVGDKRQ 3 
A7526PSMB1, PSC5Proteasome subunit beta type 1PSB1_MOUSEKAGGSASAM*LQPLLDNQVGFKN 2 
A7526PSMB1, PSC5Proteasome subunit beta type 1PSB1_MOUSEKAGGSASAMLQPLLDNQVGFKN 2 
A3695ACAT2, ACTLCytosolic acetoacetyl-coenzyme A thiolaseTHIC_MOUSEKAGHFDKEIVPVLVSSRK 2 
A3695ACAT2, ACTLCytosolic acetoacetyl-coenzyme A thiolaseTHIC_MOUSEKAGHFDKEIVPVLVSSRK 3 
A7689RIOK3, SUDDSerine/threonine-protein kinase RIO3RIOK3_MOUSEKAGIPCPTVVLLKK 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKAGIPKEEVKEVYM*GNVIQGGEGQAPTRQ 3 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQ 3 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAGKFPSLLTHNENMVAKV 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAGKFPSLLTHNENMVAKV 3 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKAGKQGLLGINIAEKH 3 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKAGKQGLLGINIAEKH 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKAGLENEDVIIEVNGENVQEEPYDRV 2 
A8652AURKAIP1, AIP, AKIPAurora-A kinase interacting proteinAKIP_MOUSEKAGLKEAPENWQTPKI 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAGLSLKDM*DLIDVNEAFAPQFLSVQKA 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAGLSLKDM*DLIDVNEAFAPQFLSVQKA 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAGLSLKDMDLIDVNEAFAPQFLSVQKA 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKAGLSLKDMDLIDVNEAFAPQFLSVQKA 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKAGLTM*NDIDAFEFHEAFSGQILANFKA 3 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKAGLTMNDIDAFEFHEAFSGQILANFKA 3 
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialGSTK1_MOUSEKAGMSTAQAQHFLEKI 2 
A9548RPL22, RPL22L260S ribosomal protein L22RL22_MOUSEKAGNLGGGVVTIERS 2 
A1374LMNA, LMN1Lamin A/CLMNA_MOUSEKAGQVVTIWASGAGATHSPPTDLVWKA 3 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKAGSRYEDSNNLGTSHLLRL 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKAGVLADDHLIEVNGENVENASHEEVVEKV 3 
A4684CGI-99, CLE7UPF0568 protein C14ORF166CN166_MOUSEKAGVMALANLLQIQRH 2 
A033APDCD6, ALG2, AHRRProgrammed cell death protein 6PDCD6_MOUSEKAGVNFSEFTGVWKY 2 
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorGATM_MOUSEKAGWTIVTPPTPVIPDDHPLWMSSKW 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKAGYTDQVVIGM*DVAASEFYRS 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKAGYTDQVVIGMDVAASEFYRS 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKAGYTDQVVIGMDVAASEFYRS 3 
A5250WDR1, PNAS-29WD-repeat containing protein 1WDR1_MOUSEKAHDGGIYAISWSPDSTHLLSASGDKTSKI 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKAHGGYSVFAGVGERT 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKAHGGYSVFAGVGERT 2 
A9559RPL3, rpl3, ASC-160S ribosomal protein L3RL3_MOUSEKAHLMEIQVNGGTVAEKL 2 
A9559RPL3, rpl3, ASC-160S ribosomal protein L3RL3_MOUSEKAHLMEIQVNGGTVAEKL 3 
A6642GPX1Glutathione peroxidase 1GPX1_MOUSEKAHPLFTFLRN 2 
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1BPNT1_MOUSEKAIAGIINQPYYNYQAGPDAALGRT 2 
A3542CCT8, CCTQT-complex protein 1, theta subunitTCPQ_MOUSEKAIAGTGANVIVTGGKV 2 
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13F10A1_MOUSEKAIDLFTDAIKL 2 
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13F10A1_MOUSEKAIDLFTDAIKLNPRL 2 
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13F10A1_MOUSEKAIDLFTDAIKLNPRL 3 
A1846ADAM10, KUZ, MADMADAM 10 precursorADA10_MOUSEKAIDTIYQTTDFSGIRN 2 
A568CSTX4, STX4ASyntaxin 4STX4_MOUSEKAIEPQKEEADENYNSVNTRM 3 
A0691AP1S1, AP19, CLAPS1Adapter-related protein complex 1 sigma 1A subunitAP1S1_MOUSEKAIEQADLLQEEDESPRS 2 
A5984CTSD, CPSDCathepsin D precursorCATD_MOUSEKAIGAVPLIQGEYMIPCEKV 2 
A979BFABP1, FABPLFatty acid-binding protein, liverFABPL_MOUSEKAIGLPEDLIQKG 2 
A0387ATP5H, My032ATP synthase D chain, mitochondrialATP5H_MOUSEKAIGNALKSWNETFHARL 3 
A0122CLTAClathrin light chain ACLCA_MOUSEKAIKELEEWYARQ 3 
A0122CLTAClathrin light chain ACLCA_MOUSEKAIKELEEWYARQ 2 
A0098VCLVinculinVINC_MOUSEKAIPDLTAPVAAVQAAVSNLVRV 3 
A0098VCLVinculinVINC_MOUSEKAIPDLTAPVAAVQAAVSNLVRV 2 
A6795INMT, INMT-FAM188BIndolethylamine N-methyltransferaseINMT_MOUSEKAIQDAGCQVLKC 2 
A1494FGG, PRO2061Fibrinogen gamma chain precursorFIBG_MOUSEKAIQVYYNPDQPPKPGMIDSATQKS 3 
A1324AP3D1, PRO0039Adapter-related protein complex 3 delta 1 subunitAP3D1_MOUSEKAIRKFAVSQMSSLLDSAHLVASSTQRN 3 
A5166SVILArchvillinSVIL_MOUSEKAISTRNRIDVRQ 2 
A424AFHL1, SLIM1Skeletal muscle LIM-protein 1FHL1_MOUSEKAIVAGDQNVEYKG 2 
A424AFHL1, SLIM1Skeletal muscle LIM-protein 1FHL1_MOUSEKAIVAGDQNVEYKGTVWHKD 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKAIWNVINWENVTERY 2 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKAIWNVINWENVTERY 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKAKAGAGSATLSM*AYAGARF 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKAKAGAGSATLSM*AYAGARF 2 
A9586MRPL11, CGI-11360S ribosomal protein L11, mitochondrial precursorRM11_MOUSEKAKDDAFAMQDVPLSSVVRS 2 
A3866EPB41L2Band 4.1-like protein 2E41L2_MOUSEKAKEVENEQTPVSEPEEEKG 3 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKAKEVGADFTIQVGKE 2 
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorGRPE1_MOUSEKAKLEEQLRETMEKY 2 
A1720DAB2, DOC2Disabled homolog 2DAB2_MOUSEKAKLIGIDDVPDARG 2 
A3971OPA1Optic atrophy 1 gene proteinOPA1_MOUSEKAKNEILDEVISLSQVTPKH 3 
A2433PSD3, EFA6R, HCA67PH and SEC7 domain-containing protein 3PSD3_MOUSEKAKPPPGGEQEPPPPAPQDVEMKE 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKAKPVVSFIAGITAPPGRR 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKAKPVVSFIAGITAPPGRRM 2 
A7476ALPLAlkaline phosphatase, tissue-nonspecific isozyme precursorPPBT_MOUSEKAKQALHEAVEMDQAIGKA 3 
A5242VIL1, VILVillin 1VILI_MOUSEKAKQYPPSTQVEVQNDGAESPIFQQLFQKW 2 
A5242VIL1, VILVillin 1VILI_MOUSEKAKQYPPSTQVEVQNDGAESPIFQQLFQKW 3 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKAKSALPAQSAATLPART 3 
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomerasePECI_MOUSEKAKWDAWNALGSLPKE 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKALAAAGYDVEKN 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKALAAAGYDVEKNNSRI 2 
A3698CYC1Cytochrome c1, heme protein, mitochondrialCY1_MOUSEKALAEEVEVQDGPNDDGEMFMRPGKL 2 
A3698CYC1Cytochrome c1, heme protein, mitochondrialCY1_MOUSEKALAEEVEVQDGPNDDGEMFMRPGKL 3 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKALAVSDLNRA 2 
A5925GUSB, F8Beta-glucuronidase precursorBGLR_MOUSEKALDGLWHFRA 2 
A7773AHCY, SAHHAdenosylhomocysteinaseSAHH_MOUSEKALDIAENEMPGLMRM 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKALDLDPSKTNVSGGAIALGHPLGGSGSRI 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKALDLDPSKTNVSGGAIALGHPLGGSGSRI 2 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKALDLDSSCKEAADGYQRC 2 
A421ETSPYL4Testis-specific Y-encoded-like protein 4TSYL4_MOUSEKALEACGAVGLGSQQMPGPKKTKE 3 
A2536NCLNucleolinNUCL_MOUSEKALELTGLKVFGNEIKL 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKALEQFLQEYFDGNLKR 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKALEQFLQEYFDGNLKRY 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKALEQFLQEYFDGNLKRY 2 
A9075SUGT1, HDCMD34Suppressor of G2 allele of SKP1 homologSUGT1_MOUSEKALEQNPDDAQYYCQRA 2 
A3967KIF5B, KNS, KNS1Kinesin family member 5BKINH_MOUSEKALESALKEAKENASRD 3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKALESPERPFLAILGGAKV 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKALESPERPFLAILGGAKV 3 
A5868ATG3, APG3, APG3LAutophagy-related protein 3ATG3_MOUSEKALEVAEYLTPVLKESKF 3 
A6831GCAT, KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial precursorKBL_MOUSEKALGGASGGYTTGPEPLVSLLRQ 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_MOUSEKALHGEQYLELYKPLPRS 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaEF1G_MOUSEKALIAAQYSGAQVRV 2 
A0089CTNNA1Alpha-1 cateninCTN1_MOUSEKALKPEVDKLNIMAAKR 3 
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorACE_MOUSEKALLEYFQPVSQWLEEQNQRN 2 
A7927NARSAsparaginyl-tRNA synthetase, cytoplasmicSYNC_MOUSEKALMTVGKEPFPTIYVDSQKENERW 3 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_MOUSEKALPGHLKPFETLLSQNQGGKA 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_MOUSEKALPGHLKPFETLLSQNQGGKA 3 
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1BCT077_MOUSEKALQDLENAASGDATVRQ 2 
A026CHOOK2Protein Hook homolog 2HOOK2_MOUSEKALQEQGGKTEDPTLLKRK 3 
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1ARK72_MOUSEKALQTTYGTNAPRM 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKALTGGIAHLFKQ 2 
A9616MRPL46, LIECG239S ribosomal protein L46, mitochondrialRM46_MOUSEKALTPLQEEMAGLLQQIEVERS 2 
A6227COX6A1, COX6AL, RP3-405J24.3Cytochrome c oxidase subunit 6A1, mitochondrial precursorCX6A1_MOUSEKALTYFVALPGVGVSM*LNVFLKS 2 
A6227COX6A1, COX6AL, RP3-405J24.3Cytochrome c oxidase subunit 6A1, mitochondrial precursorCX6A1_MOUSEKALTYFVALPGVGVSMLNVFLKS 2 
A6688HAO2, HAOX2, GIG16Hydroxyacid oxidase 2HAOX2_MOUSEKALVVTVDAPVLGNRR 2 
A0888BCAR1, CAS, CASS1Breast cancer anti-estrogen resistance 1 proteinBCAR1_MOUSEKALYDNVAESPDELSFRK 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1PABP1_MOUSEKALYDTFSAFGNILSCKVVCDENGSKG 3 
A7149MME, EPNNeprilysinNEP_MOUSEKALYGTTSETATWRR 2 
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorADX_MOUSEKAM*DNMTVRVPEAVADVRQ 3 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1PGAM1_MOUSEKAM*EAVAAQGKV 2 
A927KSDF2Stromal cell-derived factor 2 precursorSDF2_MOUSEKAM*EGIFMKPSELLRA 3 
A8145UGT1A1, UGT1, GNT1UDP-glucuronosyltransferase 1-1 precursor, microsomalUD11_MOUSEKAM*EIAEALGRIPQTVLWRY 3 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKAM*GAAQVVVTDLSASRL 2 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAM*GIM*NSFVNDIFERI 3 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAM*GIM*NSFVNDIFERI 2 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAM*GIMNSFVNDIFERI 2 
A497AHIST1H2BA, TSH2B, STBPHistone H2B, testisH2B1A_MOUSEKAM*SIMNSFVTDIFERI 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKAM*VNLQIQKD 2 
A529CWISP, SNX9, SH3PX1Sorting nexin 9SNX9_MOUSEKAMDDGVKELLTVGQEHWKR 3 
A1508LAMB1Laminin subunit beta-1LAMB1_MOUSEKAMDFDRDVLSALAEVEQLSKM 3 
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorADX_MOUSEKAMDNMTVRVPEAVADVRQ 3 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKAMDSDWFAQNYMGRK 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1PGAM1_MOUSEKAMEAVAAQGKV 2 
A927KSDF2Stromal cell-derived factor 2 precursorSDF2_MOUSEKAMEGIFMKPSELLRA 2 
A927KSDF2Stromal cell-derived factor 2 precursorSDF2_MOUSEKAMEGIFMKPSELLRA 3 
A8145UGT1A1, UGT1, GNT1UDP-glucuronosyltransferase 1-1 precursor, microsomalUD11_MOUSEKAMEIAEALGRIPQTVLWRY 3 
A8958PSMC3, TBP126S protease regulatory subunit 6APRS6A_MOUSEKAMEVDERPTEQYSDIGGLDKQ 3 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKAMGAAQVVVTDLSASRL 2 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAMGIM*NSFVNDIFERI 2 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAMGIMNSFVNDIFERI 1 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAMGIMNSFVNDIFERI 3 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKAMGIMNSFVNDIFERI 2 
A588AEIF5Eukaryotic translation initiation factor 5IF5_MOUSEKAMGPLVLTEVLFDEKI 2 
A4183PEX19, HK33, PXFPeroxisomal biogenesis factor 19PEX19_MOUSEKAMKELAEEEPHLVEQFQKL 3 
A6254DCXR, KIDCRL-xylulose reductaseDCXR_MOUSEKAMLDRIPLGKF 2 
A0961TCEB1Transcription elongation factor B polypeptide 1ELOC_MOUSEKAMLSGPGQFAENETNEVNFRE 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGRP75_MOUSEKAMQDAEVSKS 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGRP75_MOUSEKAMQDAEVSKSDIGEVILVGGMTRM 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGRP75_MOUSEKAMQDAEVSKSDIGEVILVGGMTRM 3 
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitTCPG_MOUSEKAMTGVEQWPYRA 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKAMVNLQIQKDNPKV 2 
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9NDUB9_MOUSEKAMYPDYFSKRE 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKANAGEESVMNLDKL 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKANAGEESVMNLDKLRF 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKANAGEESVMNLDKLRF 3 
A7476ALPLAlkaline phosphatase, tissue-nonspecific isozyme precursorPPBT_MOUSEKANEGTVGVSAATERT 2 
A5078PHLDB2, LL5B, LL5betaPleckstrin homology-like domain family B member 2PHLB2_MOUSEKANGDYSGSYLTLSQPVSAKR 2 
A0672AXIN2Axin 2AXN2_MOUSEKANGQVSLPHFPRTHRLPKE 2 
A7450NP, PNP, PRO1837Purine nucleoside phosphorylasePNPH_MOUSEKANHM*EVLDAGKAAAQTLERF 3 
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8ARAB8A_MOUSEKANINVENAFFTLARD 2 
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8ARAB8A_MOUSEKANINVENAFFTLARD 3 
A857BCALB1, CAB27CalbindinCALB1_MOUSEKANKTVDDTKLAEYTDLMLKL 3 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKANLQIDQINTDLNLERS 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKANLVFKEIEKK 2 
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorCOX41_MOUSEKANPIQGFSAKW 2 
A267COSBPL2, ORP2Oxysterol binding protein-related protein 2OSBL2_MOUSEKANSDVPGDVADDVPVAQETVQVIPGSKL 2 
A681CHDLBP, HBP, VGLVigilinVIGLN_MOUSEKANSFTVSSVSAPSWLHRF 3 
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorGATM_MOUSEKANTYEKYWPFYQKN 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKANWYFLLARS 2 
A4380PSMD926S proteasome non-ATPase regulatory subunit 9PSD9_MOUSEKANYDVLESQKG 2 
A8170UK114, HRSP12, PSPRibonuclease UK114UK114_MOUSEKAPAAIGPYSQAVQVDRT 2 
A8170UK114, HRSP12, PSPRibonuclease UK114UK114_MOUSEKAPAAIGPYSQAVQVDRT 3 
A9096TBC1D1TBC1 domain family member 1TBCD1_MOUSEKAPAQLCEGCPLQGLHKL 3 
A0796AKAP2, PRKA2, PALM2-AKAP2A-kinase anchor protein 2AKAP2_MOUSEKAPCVSESQSAGAGPANAATQGKE 2 
A7545PTRH2, BIT1, PTH2Peptidyl-tRNA hydrolase 2, mitochondrial precursorPTH2_MOUSEKAPDEDTLIQLLTHAKT 3 
A0326VIL2, EZREzrinEZRI_MOUSEKAPDFVFYAPRL 2 
A6264DDX17ATP-dependent RNA helicase DDX17DDX17_MOUSEKAPILIATDVASRG 2 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKAPIRPDIVNFVHTNLRK 2 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKAPIRPDIVNFVHTNLRK 3 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKAPIRPDIVNFVHTNLRKN 3 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKAPIRPDIVNFVHTNLRKN 2 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKAPKPDGPGGGPGGSHMGGNYGDDRR 3 
A261ABTF3, NACB, BTF3bTranscription factor BTF3BTF3_MOUSEKAPLATGEDDDDEVPDLVENFDEASKN 2 
A804CKAP, FKSG22Kidney androgen-regulated protein precursorANRE_MOUSEKAPLEDYTDDDLSTDSEQIMDFTPAANKQ 2 
A804CKAP, FKSG22Kidney androgen-regulated protein precursorANRE_MOUSEKAPLEDYTDDDLSTDSEQIMDFTPAANKQ 3 
A6071LP4947, PTD012Ester hydrolase C11ORF54CK054_MOUSEKAPLVCLPVFVSKDPGLDLRL 2 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKAPNSPDVLEIEFKK 2 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKAPNSPDVLEIEFKKG 3 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKAPNSPDVLEIEFKKG 2 
A100CMAGT1, IAG2, UNQ628/PRO1244Implantation-associated proteinIAG2_MOUSEKAPPRNYSVVVMFTALQLHRQ 2 
A8957PSMC126S protease regulatory subunit 4PRS4_MOUSEKAPQETYADIGGLDNQIQEIKE 2 
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_MOUSEKAPQVSTPTLVEAARN 2 
A0390ATP5LATP synthase G chain, mitochondrialATP5L_MOUSEKAPSMVAAAVTYSKPRL 3 
A0390ATP5LATP synthase G chain, mitochondrialATP5L_MOUSEKAPSMVAAAVTYSKPRL 2 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorETFA_MOUSEKAPSSSSVGISEWLDQKL 2 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorETFA_MOUSEKAPSSSSVGISEWLDQKLTKS 3 
A464AGTF2I, BAP135, WBSCR6General transcription factor II-IGTF2I_MOUSEKAPSYLEISSMRR 2 
A0452CANXCalnexin precursorCALX_MOUSEKAPVPTGEVYFADSFDRG 2 
A9766ACIN1, ACINUSApoptotic chromatin condensation inducer 1ACINU_MOUSEKAPVVLQPEQIVSEEETPPPLLTKE 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAPVVM*GSSEDVQEFLEIYRK 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAPVVM*GSSEDVQEFLEIYRKH 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAPVVMGSSEDVQEFLEIYRK 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAPVVMGSSEDVQEFLEIYRKH 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAPVVMGSSEDVQEFLEIYRKH 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKAQALRDNSTMGYMMAKK 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKAQALRDNSTMGYMMAKK 3 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKAQAYQTGKDISTNYYASQKK 3 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKAQAYQTGKDISTNYYASQKK 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKAQAYQTGKDISTNYYASQKKT 3 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKAQDTAELFFEDVRL 2 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKAQDTAELFFEDVRLPANALLGEENKG 3 
A290CPLIN3, M6PRBP1, TIP47Perilipin-3M6PBP_MOUSEKAQETLQQLTSVLGLMESVKQ 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKAQFGQPEILLGTIPGAGGTQRL 2 
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialDNJA3_MOUSEKAQGLYETINVTIPAGIQTDQKI 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKAQGTGELTQLLNSLCTAIKA 2 
A1230PPID, CYP40, CYPD40 kDa peptidyl-prolyl cis-trans isomerasePPID_MOUSEKAQGWQGLKEYDQALADLKKA 3 
A0619RAB11A, RAB11, 24KGRas-related protein Rab-11ARB11A_MOUSEKAQIWDTAGQERY 2 
A0808MSNMoesinMOES_MOUSEKAQKELEEQTRK 2 
A0819RDXRadixinRADI_MOUSEKAQKELEEQTRK 2 
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14UBP14_MOUSEKAQLFALTGVQPARQ 2 
A1004PPP1R12A, MBS, MYPT1Protein phosphatase 1 regulatory (inhibitor) subunit 12AMYPT1_MOUSEKAQLHDTNMELTDLKL 3 
A1004PPP1R12A, MBS, MYPT1Protein phosphatase 1 regulatory (inhibitor) subunit 12AMYPT1_MOUSEKAQLHDTNMELTDLKL 2 
A3812RPL860S ribosomal protein L8RL8_MOUSEKAQLNIGNVLPVGTM*PEGTIVCCLEEKPGDRG 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRG 2 
A3812RPL860S ribosomal protein L8RL8_MOUSEKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRG 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKL 3 
A9653RPS740S ribosomal protein S7RS7_MOUSEKAQQNNVEHKVETFSGVYKK 2 
A9653RPS740S ribosomal protein S7RS7_MOUSEKAQQNNVEHKVETFSGVYKK 3 
A0098VCLVinculinVINC_MOUSEKAQQVSQGLDVLTAKV 2 
A0380ATP5DATP synthase delta chain, mitochondrial precursorATPD_MOUSEKAQSELSGAADEAARA 2 
A1481HINT1, HINT, PKCI1Histidine triad nucleotide-binding protein 1HINT1_MOUSEKAQVAQPGGDTIFGKI 2 
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4DHRS4_MOUSEKAREDFIKEAMQIRR 3 
A3635DHRS4, UNQ851/PRO1800, UNQ851Dehydrogenase/reductase SDR family member 4DHRS4_MOUSEKAREDFIKEAMQIRR 2 
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomerasePECI_MOUSEKARESKDILVTSEDGITKI 3 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKARGPLAHQISGLFLPSKV 3 
A5937BPHL, MCNAABiphenyl hydrolase-like proteinBPHL_MOUSEKARKPLEALYGYDYLAKT 2 
A5937BPHL, MCNAABiphenyl hydrolase-like proteinBPHL_MOUSEKARKPLEALYGYDYLAKT 3 
A1283PLK2, SNKSerine/threonine-protein kinase PLK2PLK2_MOUSEKARKVLTEPEVRY 2 
A0683MAP3K5, ASK1, MAPKKK5Mitogen-activated protein kinase kinase kinase 5M3K5_MOUSEKARNLYTGKELAAELARI 3 
A3804EEF2, EF2Elongation factor 2EF2_MOUSEKARPFPDGLAEDIDKGEVSARQ 3 
A3804EEF2, EF2Elongation factor 2EF2_MOUSEKARPFPDGLAEDIDKGEVSARQ 2 
A7969TGM2Protein-glutamine gamma-glutamyltransferaseTGM2_MOUSEKARVDLFPTDIGLHKL 2 
A397EPrLZ, TPD52, PC-1Prostate and colon associated proteinTPD52_MOUSEKASAAFSSVGSVITKK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKASAELALGENNEVLKS 2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorODO2_MOUSEKASAFALQEQPVVNAVIDDATKE 2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorODO2_MOUSEKASAFALQEQPVVNAVIDDATKEVVYRD 3 
A284BZNF830, CCDC16Zinc finger protein 830CCD16_MOUSEKASAGPQVQPSTSASSANLDAARA 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKASANMDLMRA 2 
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseGALM_MOUSEKASDVVLGFAELEGYLQKQ 2 
A835BARFGAP1, ARF1GAPADP-ribosylation factor GTPase activating protein 1ARFG1_MOUSEKASELGHSLNENVLKPAQEKV 3 
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2CMC2_MOUSEKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKT 2 
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2CMC2_MOUSEKASGDAARPFLLQLAESAYRF 3 
A0204FLNA, FLN, FLN1Filamin AFLNA_MOUSEKASGPGLNTTGVPASLPVEFTIDAKD 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKASGPPVSELITKA 2 
A138ASPAG1Sperm associated antigen 1SPAG1_MOUSEKASHRLALAQKGLENCRE 2 
A2344ACTN4Alpha-actinin 4ACTN4_MOUSEKASIHEAWTDGKEAMLKQ 3 
A2344ACTN4Alpha-actinin 4ACTN4_MOUSEKASIHEAWTDGKEAMLKQ 2 
A3515SEPT2, DIFF6, NEDD5Septin-2SEPT2_MOUSEKASIPFSVVGSNQLIEAKG 2 
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetaseSYEP_MOUSEKASKDQVDSAVQELLQLKA 3 
A7915EPRS, GLNS, PARSBifunctional aminoacyl-tRNA synthetaseSYEP_MOUSEKASKDQVDSAVQELLQLKA 2 
A2330EEA1, ZFYVE2Early endosome antigen 1EEA1_MOUSEKASKEQALQSLQQQRQ 3 
A2330EEA1, ZFYVE2Early endosome antigen 1EEA1_MOUSEKASKEQALQSLQQQRQ 2 
A996ASF3A1, SAP114Splicing factor 3 subunit 1SF3A1_MOUSEKASKPLPPAPAPDEYLVSPITGEKI 3 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKASLAETDKITLEVAKL 2 
A3911NAPG, SNAPGGamma-soluble NSF attachment proteinSNAG_MOUSEKASMMYLENGTPDTAAMALERA 2 
A369CRRBP1Ribosome-binding protein 1RRBP1_MOUSEKASMVQSQEAPKQDAPAKK 3 
A0570EPN1, EPSINEH domain-binding mitotic phosphoproteinEPN1_MOUSEKASNPFLPSGAPPTGPSVTNPFQPAPPATLTLNQLRL 3 
A074BTAF10, TAF2A, TAF2HTranscription initiation factor TFIID 30 kDa subunitTAF10_MOUSEKASPAGTAGGPVAGVATAGTGPVAARA 2 
A955BENTH, CLINT1, EPN4Clathrin interactor 1EPN4_MOUSEKASPDQNASTHTPQSSAKPSVPSSKS 3 
A4617CDH16, UNQ695/PRO1340, UNQ695Cadherin-16 precursorCAD16_MOUSEKASPVPALTLSAGPSRH 2 
A9611MRPL40, NLVCF, URIM39S ribosomal protein L40, mitochondrial precursorRM40_MOUSEKASQELIPIEDFITPVRF 2 
A9611MRPL40, NLVCF, URIM39S ribosomal protein L40, mitochondrial precursorRM40_MOUSEKASQELIPIEDFITPVRF 1 
A114DCDA017Leucine-rich repeat-containing protein C10ORF11CJ011_MOUSEKASSEEEKAAAPENQPQYTPLPSGSRD 3 
A8906NSFL1C, UBXN2CNSFL1 cofactor P47NSF1C_MOUSEKASSSILINEAEPTTNIQIRL 2 
A207DCRIP2, CRP2Cysteine-rich protein 2CRIP2_MOUSEKASSVTTFTGEPNMCPRCNKRV 3 
A0135MAPT, MAPTL, MTBT1Microtubule-associated protein tauTAU_MOUSEKASTPKEQDLEGATVVGVPGEEQKA 3 
A0656DCTN2, DCTN50Dynactin 2DCTN2_MOUSEKASVEDADTQNKVHQLYETIQRW 3 
A681CHDLBP, HBP, VGLVigilinVIGLN_MOUSEKASVITQVFHVPLEERK 2 
A8812TXNL2, GLRX3, PICOTGlutaredoxin-3TXNL2_MOUSEKASVM*LFM*KGNKQ 2 
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 3ILF3_MOUSEKASYSSGYQSHQGQQQPYNQSQYSSYGTPQGKQ 3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKATAVMPDGQFKDISLSEYKG 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorIDHP_MOUSEKATDFVVDRA 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKATDLLLDDSLVSLFGNRR 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKATDLLLDDSLVSLFGNRRL 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKATDLLLDDSLVSLFGNRRL 3 
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicHYES_MOUSEKATEIGGILVNTPEDPNLSKI 2 
A887APTRF, FKSG13Polymerase I and transcript release factorPTRF_MOUSEKATEMVEVGPEDDEVGAERG 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_MOUSEKATFDAISKT 2 
A2536NCLNucleolinNUCL_MOUSEKATFIKVPQNPHGKPKG 3 
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GDIS_MOUSEKATFM*VGSYGPRPEEYEFLTPVEEAPKG 3 
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GDIS_MOUSEKATFMVGSYGPRPEEYEFLTPVEEAPKG 3 
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1IQGA1_MOUSEKATFYGEQVDYYKS 2 
A1560LAMA5Laminin subunit alpha-5LAMA5_MOUSEKATGDPWLTDGSYLDGSGFARI 2 
A6285DDX56, DDX21, NOH61Probable ATP-dependent 61 kDa nucleolar RNA helicaseDDX56_MOUSEKATGPVMEQAVRGLVLVPTKE 2 
A491AH2AFV, H2AVHistone H2A.F/Z variantH2AV_MOUSEKATIAGGGVIPHIHKS 2 
A332CRAB7A, RAB7Ras-related protein Rab-7ARAB7_MOUSEKATIGADFLTKE 2 
A7984TSTThiosulfate sulfurtransferaseTHTR_MOUSEKATLNLSLLKT 2 
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1UBE1X_MOUSEKATLPSPDKLPGFKM 2 
A6823AK2, ADK2Adenylate kinase 2, mitochondrialKAD2_MOUSEKATMDAGKLVSDEMVVELIEKN 3 
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorGRPE1_MOUSEKATQSVPKEEISNNNPHLKS 3 
A510CSNAP23, SNAP-23Synaptosomal-associated protein 23SNP23_MOUSEKATWGDGGDNSPSNVVSKQ 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_MOUSEKAVANYDSVEAGEKL 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_MOUSEKAVANYDSVEAGEKLVKT 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKAVAQGNLSSADVQAAKN 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKAVAQGNLSSADVQAAKN 3 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKAVAQGNLSSADVQAAKNKLKA 3 
A7842SOD1Superoxide dismutase [Cu-Zn]SODC_MOUSEKAVCVLKGDGPVQGTIHFEQKA 3 
A7904SUOXSulfite oxidase, mitochondrial precursorSUOX_MOUSEKAVDDSYNVQPDTVAPIWNLRG 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAVDIPHM*DIEALKK 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAVDIPHM*DIEALKKL 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAVDIPHMDIEALKK 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKAVDIPHMDIEALKKL 2 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKAVEAFETAKK 2 
A3566PSMD14, POH126S proteasome non-ATPase regulatory subunit 14PSDE_MOUSEKAVEEEDKMTPEQLAIKN 3 
A3566PSMD14, POH126S proteasome non-ATPase regulatory subunit 14PSDE_MOUSEKAVEEEDKMTPEQLAIKN 2 
A7989TKT, TKT1TransketolaseTKT_MOUSEKAVELAANTKG 2 
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3PSA3_MOUSEKAVENSSTAIGIRC 2 
A032APDCD5, TFAR19Programmed cell death protein 5PDCD5_MOUSEKAVENYLIQMARY 2 
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorAUHM_MOUSEKAVGLISHVLEQNQEGDAAYRK 2 
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorAUHM_MOUSEKAVGLISHVLEQNQEGDAAYRK 3 
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorAUHM_MOUSEKAVGLISHVLEQNQEGDAAYRKA 3 
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3CES3_MOUSEKAVIGDHGDEIFSVFGSPFLKD 2 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_MOUSEKAVITVKDINDNAPVFNPSTYQGQVPENEVNARI 3 
A5981CATCatalaseCATA_MOUSEKAVKNFTDVHPDYGARI 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKAVKNQVDLKELDQSQRE 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKAVKNQVDLKELDQSQRE 2 
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1IREB1_MOUSEKAVLAESYERI 2 
A3669IDH3GIsocitrate dehydrogenase 3 [NAD] subunit gamma, mitochondrial precursorIDH3G_MOUSEKAVLASMDNENMHTPDIGGQGTTSQAIQDIIRH 3 
A6605GKGlycerol kinaseGLPK_MOUSEKAVLGPLVGAVDQGTSSTRF 2 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorHSP47_MOUSEKAVLSAEKLRDEEVHTGLGELLRS 3 
A5800CD13, ANPEP, APNAminopeptidase NAMPN_MOUSEKAVNQQTAVQPPATVRT 3 
A5800CD13, ANPEP, APNAminopeptidase NAMPN_MOUSEKAVNQQTAVQPPATVRT 2 
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_MOUSEKAVPQLQGYLRS 2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKAVPREELFVTSKL 2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKAVPREELFVTSKLWNTKH 3 
A4313DNAJC7, TPR2, TTC2DNAJ (HSP40) homolog, subfamily C, member 7DNJC7_MOUSEKAVQFFVQALRM 2 
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitARPC5_MOUSEKAVQSLDKNGVDLLMKY 2 
A0633YWHAH, YWHA114-3-3 protein eta1433F_MOUSEKAVTELNEPLSNEDRNLLSVAYKN 3 
A0633YWHAH, YWHA114-3-3 protein eta1433F_MOUSEKAVTELNEPLSNEDRNLLSVAYKN 2 
A0907YWHAQ14-3-3 protein tau1433T_MOUSEKAVTEQGAELSNEERN 2 
A0907YWHAQ14-3-3 protein tau1433T_MOUSEKAVTEQGAELSNEERN 3 
A0467YWHAB14-3-3 protein beta/alpha1433B_MOUSEKAVTEQGHELSNEERN 2 
A050BSRRM1, SRM160Serine/arginine repeptitive matrix protein 1SRRM1_MOUSEKAVTIATPATAAPAAVSAATTTSAQEEPAAAPEPRK 3 
A050BSRRM1, SRM160Serine/arginine repeptitive matrix protein 1SRRM1_MOUSEKAVTIATPATAAPAAVSAATTTSAQEEPAAAPEPRK 2 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialNUCM_MOUSEKAVTNMTLNFGPQHPAAHGVLRL 3 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformVATB2_MOUSEKAVVGEEALTSDDLLYLEFLQKF 2 
A1044RANBP2, NUP358Ran-binding protein 2RBP2_MOUSEKAVVSPPKFVFGSESVKS 3 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_MOUSEKAVYTVVNDPDQQFVVVTDPTTNDGILKT 3 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_MOUSEKAVYTVVNDPDQQFVVVTDPTTNDGILKT 2 
A617AIRF6Interferon regulatory factor 6IRF6_MOUSEKAWAVETGKYQEGVDDPDPAKW 3 
A8015TPMTThiopurine S-methyltransferaseTPMT_MOUSEKAWGLDYLFEKL 2 
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2PACN2_MOUSEKAWIAVMSEAERV 2 
A0693PACSIN3Protein kinase C and casein kinase substrate in neurons protein 3PACN3_MOUSEKAYAQQLADWARK 2 
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2PACN2_MOUSEKAYAQQLTEWARR 2 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLCX033_MOUSEKAYATSQQIFQAIKS 2 
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitNDUBA_MOUSEKAYDLVVDWPVTLVRE 2 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialKAD3_MOUSEKAYEAQTEPVLQYYQKK 2 
A5087PLS3Plastin 3PLST_MOUSEKAYFHLLNQIAPKG 2 
A5087PLS3Plastin 3PLST_MOUSEKAYFHLLNQIAPKG 3 
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainAT1B1_MOUSEKAYGENIGYSEKD 2 
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainAT1B1_MOUSEKAYGENIGYSEKDRF 2 
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainAT1B1_MOUSEKAYGENIGYSEKDRFQGRF 2 
A7776SARDH, DMGDHL1Sarcosine dehydrogenaseSARDH_MOUSEKAYGIESHVLSPAETKS 3 
A7776SARDH, DMGDHL1Sarcosine dehydrogenaseSARDH_MOUSEKAYGIESHVLSPAETKS 2 
A1176APOEApolipoprotein E precursorAPOE_MOUSEKAYKKELEEQLGPVAEETRA 3 
A5868ATG3, APG3, APG3LAutophagy-related protein 3ATG3_MOUSEKAYLPTDKQFLVTKN 2 
A5953MTHFD1, MTHFC, MTHFDC-1-tetrahydrofolate synthase, cytoplasmicC1TC_MOUSEKAYTEEDLDLVEKG 2 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKAYVEANQM*LGDLIKV 2 
A421ETSPYL4Testis-specific Y-encoded-like protein 4TSYL4_MOUSEKCAISVATGKEGEAGAAMQEKKG 2 
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_MOUSEKCCAEANPPACYGTVLAEFQPLVEEPKN 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKCEFQDAYVLLSEKK 2 
A0452CANXCalnexin precursorCALX_MOUSEKCESAPGCGVWQRPM*IDNPNYKGKW 3 
A0452CANXCalnexin precursorCALX_MOUSEKCESAPGCGVWQRPMIDNPNYKG 2 
A0452CANXCalnexin precursorCALX_MOUSEKCESAPGCGVWQRPMIDNPNYKGKW 3 
A0452CANXCalnexin precursorCALX_MOUSEKCESAPGCGVWQRPMIDNPNYKGKW 2 
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorCLPX_MOUSEKCGDLCTHVETFVSSTRF 2 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKCGPMVLDALIKI 2 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKCIGAIAMTEPGAGSDLQGVRT 2 
A9722SPAG9, HSS, MAPK8IP4C-Jun-amino-terminal kinase-interacting protein 4JIP4_MOUSEKCLHSIKLKDSILSIVHVKG 2 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKCPNPTCENMNFSWRN 2 
A1522ITGB5Integrin beta-5 precursorITB5_MOUSEKCPTCPDACSSKRD 2 
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_MOUSEKCTKCGPGYSTPLEAMKGPRE 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKCVGVGESDGSIWNPDGIDPKE 2 
A1283PLK2, SNKSerine/threonine-protein kinase PLK2PLK2_MOUSEKCYEMTDLTNNKVYAAKIIPHSRV 2 
A297AZNF9, CNBP, RNF163Zinc finger protein 9CNBP_MOUSEKCYSCGEFGHIQKD 2 
A297AZNF9, CNBP, RNF163Zinc finger protein 9CNBP_MOUSEKCYSCGEFGHIQKD 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKDAAEAIKKYNVGVKC 3 
A3961MYH10, SmembMyosin-10MYH10_MOUSEKDAAGLESQLQDTQELLQEETRQ 2 
A3961MYH10, SmembMyosin-10MYH10_MOUSEKDAAGLESQLQDTQELLQEETRQ 3 
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialKAD4_MOUSEKDAAKPVIELYKS 3 
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialKAD4_MOUSEKDAAKPVIELYKS 2 
A6503TSTA3, SDR4E1GDP-L-fucose synthetaseFCL_MOUSEKDADLTDAAQTQALFQKV 2 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKDAQM*VHSNALNEDTQDELGDPRL 3 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKDAQMVHSNALNEDTQDELGDPRL 3 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKDAQMVHSNALNEDTQDELGDPRL 2 
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GDIS_MOUSEKDAQPQLEEADDDLDSKL 2 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKDASDDLDDLNFFNQKK 2 
A5254WIPF2, WICH, WIREWAS/WASL-interacting protein family member 2WIRE_MOUSEKDASEAPAGKPALQVPSSRA 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKDASVVGFFRD 2 
A4644CD2APCD2-associated proteinCD2AP_MOUSEKDASYSSKPSLSTPSSASKV 3 
A4644CD2APCD2-associated proteinCD2AP_MOUSEKDASYSSKPSLSTPSSASKV 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKDATNVGDEGGFAPNILENKE 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKDATNVGDEGGFAPNILENKEALELLKT 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKDATNVGDEGGFAPNILENKEALELLKT 3 
A002CGLRX, GRXGlutaredoxin-1GLRX1_MOUSEKDCIGGCSDLISM*QQTGELM*TRL 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKDCVGPEVENACANPAAGTVILLENLRF 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKDCVGPEVENACANPAAGTVILLENLRF 3 
A9559RPL3, rpl3, ASC-160S ribosomal protein L3RL3_MOUSEKDDASKPVHLTAFLGYKA 3 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNNTM_MOUSEKDDFDFGTMSHVIRG 2 
A4318ERP44, TXNDC4, UNQ532/PRO1075Thioredoxin domain containing protein 4 precursorTXND4_MOUSEKDDTESLEIFQNEVARQ 2 
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateMARCS_MOUSEKDEAAAAAGGEGAAAPGEQAGGAGAEGAAGGEPRE 3 
A0796AKAP2, PRKA2, PALM2-AKAP2A-kinase anchor protein 2AKAP2_MOUSEKDEDHGILDQFSRS 2 
A3816RPS340S ribosomal protein S3RS3_MOUSEKDEILPTTPISEQKG 2 
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_MOUSEKDELHHSGWNTCSSCFGDSTKS 3 
A0461DDAH1, DDAHN(G),N(G)-dimethylarginine dimethylaminohydrolase 1DDAH1_MOUSEKDENATLDGGDVLFTGRE 2 
A4617CDH16, UNQ695/PRO1340, UNQ695Cadherin-16 precursorCAD16_MOUSEKDENDQVPQFSQAIYRA 2 
A6710ALADDelta-aminolevulinic acid dehydrataseHEM2_MOUSEKDEQGSAADSEDSPTIEAVRL 2 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKDESQEGKQQYLQSIEDRE 3 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKDESQEGKQQYLQSIEDRE 2 
A2209SOX5Transcription factor SOX-5SOX5_MOUSEKDEVAQPLNLSAKPKT 2 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorCOIA1_MOUSEKDEVLSPSWDSLFSGSQGQLQPGARI 2 
A8437CCAR2, DBC1, DBC-1Protein KIAA1967K1967_MOUSEKDEVQNEGTAAESDSPLKEDGLLPKR 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKDFDPAINEYLQRK 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKDFDPAINEYLQRKK 2 
A1243UBE3A, E6AP, EPVE6APUbiquitin-protein ligase E3AUBE3A_MOUSEKDFKDVIYLTEEKV 2 
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_MOUSEKDFLAGGVAAAISKT 2 
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_MOUSEKDFLAGGVAAAISKT 1 
A1517LAMB2, LAMSLaminin beta-2 chain precursorLAMB2_MOUSEKDFLSQEGADPDSIEMVATRV 2 
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialNUGM_MOUSEKDFPLTGYVELRY 2 
A0570EPN1, EPSINEH domain-binding mitotic phosphoproteinEPN1_MOUSEKDFQYVDRDGKDQGVNVRE 3 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKDFSAFFQKI 2 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKDFSALESQLQDTQELLQEENRQKL 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDFSATDLTEFAARA 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKDFSSVFQYLRE 2 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKDFTATFGPLDSLNTRL 2 
A150CMup1Major urinary protein 1MUP1_MOUSEKDGETFQLM*GLYGREPDLSSDIKE 3 
A150CMup1Major urinary protein 1MUP1_MOUSEKDGETFQLM*GLYGREPDLSSDIKERF 3 
A150CMup1Major urinary protein 1MUP1_MOUSEKDGETFQLMGLYGREPDLSSDIKERF 3 
A1971GSTZ1, MAAIGlutathione S-transferase zeta 1MAAI_MOUSEKDGGQQFTEEFQTLNPMKQ 2 
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalTHIKA_MOUSEKDGGSTTAGNSSQVSDGAAAVLLARR 2 
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalTHIKA_MOUSEKDGGSTTAGNSSQVSDGAAAVLLARR 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKDGKTLNDELEIIEGMKF 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKDGKTLNDELEIIEGMKF 2 
A9636RPS18, D6S218E40S ribosomal protein S18RS18_MOUSEKDGKYSQVLANGLDNKL 2 
A9636RPS18, D6S218E40S ribosomal protein S18RS18_MOUSEKDGKYSQVLANGLDNKL 3 
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1ACOT1_MOUSEKDGLKDVVDALQSPLVDKKS 3 
A5673ACOT2, PTE2, PTE2APeroxisomal acyl-coenzyme A thioester hydrolase 2aACOT2_MOUSEKDGLLDVVEALQSPLVDKKS 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKDGLTDVYNKIHMGNCAENTAKK 3 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKDGM*TIAKEEIFGPVMQILKF 3 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKDGM*TIAKEEIFGPVMQILKF 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKDGMTIAKEEIFGPVM*QILKF 3 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKDGMTIAKEEIFGPVM*QILKF 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKDGMTIAKEEIFGPVMQILKF 2 
A1949GSTA1, GST2Glutathione S-transferase A1GSTA1_MOUSEKDGNLMFDQVPMVEIDGMKL 2 
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitTCPZ_MOUSEKDGNVLLHEMQIQHPTASIIAKV 3 
A3547CCT6BT-complex protein 1, zeta-2 subunitTCPW_MOUSEKDGNVLLHEMQIQHPTASIIAKV 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKDGPGGKEATWVVDVKN 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKDGPGGKEATWVVDVKN 3 
A6913ALOX15, LOG15Arachidonate 15-lipoxygenaseLX12L_MOUSEKDGTILNVAATSISDLPVDQRF 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDGTVTAGNASGVSDGAGAVIIASEDAVKK 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDGTVTAGNASGVSDGAGAVIIASEDAVKK 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDGTVTAGNASGVSDGAGAVIIASEDAVKKH 3 
A7842SOD1Superoxide dismutase [Cu-Zn]SODC_MOUSEKDGVANVSIEDRV 2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKDGVDFGKWRA 2 
A9639RPS2140S ribosomal protein S21RS21_MOUSEKDHASIQM*NVAEVDRT 3 
A9639RPS2140S ribosomal protein S21RS21_MOUSEKDHASIQMNVAEVDRT 3 
A9639RPS2140S ribosomal protein S21RS21_MOUSEKDHASIQMNVAEVDRT 2 
A1510JAG1, JAGL1Jagged 1 precursorJAG1_MOUSEKDHCRTTTCEVIDSCTVAMASNDTPEGVRY 3 
A0097TLN1, TLNTalin 1TLN1_MOUSEKDHFGLEGDEESTMLEDSVSPKK 2 
A0568PCLO, ACZProtein piccoloPCLO_MOUSEKDHTVSGNGLGIRI 2 
A6998MEP1BMeprin A subunit betaMEP1B_MOUSEKDIDGGIDQDIFDINQGLGLDLFEGDIKL 2 
A6998MEP1BMeprin A subunit betaMEP1B_MOUSEKDIDGGIDQDIFDINQGLGLDLFEGDIKL 3 
A3803EEF1D, EF1DElongation factor 1-deltaEF1D_MOUSEKDIDLFGSDEEEEDKE 2 
A0496GGT1, GGT, GTTGamma-glutamyltranspeptidase 1 precursorGGT1_MOUSEKDIDQVVTAGLKI 1 
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorNUHM_MOUSEKDIEEIIDELKAGKVPKPGPRS 3 
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitNACAM_MOUSEKDIELVM*SQANVSRA 2 
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitNACAM_MOUSEKDIELVMSQANVSRA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKDIEPGSPAEAAGLKN 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKDIFAM*DDKSENEPIENEAARY 3 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKDIFAMDDKSENEPIENEAARY 3 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKDIFAMDDKSENEPIENEAARY 2 
A5008NID2Nidogen-2NID2_MOUSEKDIGLPNGLTFDPFSKL 2 
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomerasePECI_MOUSEKDILVTSEDGITKI 2 
A0432PRDX6, AOP2Peroxiredoxin 6PRDX6_MOUSEKDINAYNGETPTEKLPFPIIDDKG 2 
A0432PRDX6, AOP2Peroxiredoxin 6PRDX6_MOUSEKDINAYNGETPTEKLPFPIIDDKG 3 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_MOUSEKDINDNAPVFNPSTYQGQVPENEVNARI 3 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorCADH1_MOUSEKDINDNAPVFNPSTYQGQVPENEVNARI 2 
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1ACSL1_MOUSEKDINKAILDDLLKLGKE 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKDINQEVYNFLATAGAKY 1 
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_MOUSEKDIPGLTDTTVPRR 2 
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2SPFH2_MOUSEKDIPNMFMDSAGGLGKQ 2 
A1720DAB2, DOC2Disabled homolog 2DAB2_MOUSEKDIPSDAFTGLDPLGDKEVKE 2 
A0496GGT1, GGT, GTTGamma-glutamyltranspeptidase 1 precursorGGT1_MOUSEKDIQEAGGIMTVEDLNNYRA 2 
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_MOUSEKDIQMPDGIRRE 2 
A4353MESDC2, MESD, UNQ1911/PRO4369LDLR chaperone MESDMESD2_MOUSEKDIRDYNDADMARL 3 
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3PSA3_MOUSEKDIREEAEKYAKE 3 
A028AOSTF1Osteoclast stimulating factor 1OSTF1_MOUSEKDIVEVLFTQPNVELNQQNKL 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKDIVHSGLAYTM*ERS 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKDIVHSGLAYTMERS 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKDIVHSGLAYTMERS 3 
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2AT2A2_MOUSEKDIVPGDIVEIAVGDKVPADIRL 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKDKDDDLPQFTSAGESFNKL 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKDKDDDLPQFTSAGESFNKL 3 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKDKDDDLPQFTSAGESFNKLVSGKL 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKDKDDDLPQFTSAGESFNKLVSGKL 3 
A0787FKBP4, FKBP52FK506-binding protein 4FKBP4_MOUSEKDKFSFDLGKGEVIKA 3 
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorBDH_MOUSEKDKGDAGVKELDSLKS 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGRP75_MOUSEKDKGTGREQQIVIQSSGGLSKD 3 
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richSFPQ_MOUSEKDKLESEMEDAYHEHQANLLRQ 3 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitPARK7_MOUSEKDKMMNGSHYSYSESRV 2 
A1319EHD1, PAST, PAST1EH-domain containing protein 1EHD1_MOUSEKDKPTYDEIFYTLSPVNGKI 2 
A1390EHD4, HCA10, HCA11EH-domain containing protein 4EHD4_MOUSEKDKPVYDELFYTLSPINGKI 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorIDHP_MOUSEKDLAGCIHGLSNVKL 2 
A5922BCKDK[3-methyl-2-oxobutanoate] dehydrogenase [lipoamide] kinase, mitochondrial precursorBCKD_MOUSEKDLDRVM*DYHFTTAEASTQDPRI 3 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKDLEAHIDTANKNREEAIKQ 3 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_MOUSEKDLGATWVVLGHSERR 2 
A5217TMOD3Ubiquitous tropomodulinTMOD3_MOUSEKDLGDYKDLDEDELLGKL 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKDLGLAQDSATSTKT 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKDLGLAQDSATSTKTPILLGSLAHQIYRM 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKDLGLAQDSATSTKTPILLGSLAHQIYRM 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKDLGLSESGEDVNAAILDESGKKF 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGDIB_MOUSEKDLGTDSQIFISRA 2 
A5615HAAO3-hydroxyanthranilate 3,4-dioxygenase3HAO_MOUSEKDLGTQLAPIIQEFFHSEQYRT 2 
A5615HAAO3-hydroxyanthranilate 3,4-dioxygenase3HAO_MOUSEKDLGTQLAPIIQEFFHSEQYRT 3 
A9678MRPS31, IMOGN3828S ribosomal protein S31, mitochondrial precursorRT31_MOUSEKDLLDIIKDMKV 2 
A7508PRPF4B, PRP4, PRP4HSerine/threonine-protein kinase PRP4 homologPRP4B_MOUSEKDLLDQILM*LDPAKRI 2 
A0533S100A1, S100AProtein S100-A1S10A1_MOUSEKDLLQTELSGFLDVQKD 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKDLLTAYYDVDYEKN 2 
A4294JDP1, DNAJC12J domain containing protein 1DJC12_MOUSEKDLMLEGSGQTFTSSVPNKERS 3 
A4294JDP1, DNAJC12J domain containing protein 1DJC12_MOUSEKDLMLEGSGQTFTSSVPNKERS 2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKDLNSQADSLM*TSSAFDTSQVKE 2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKDLNSQADSLMTSSAFDTSQVKE 2 
A4114SPFH1, ERLIN1, KE04Erlin-1SPFH1_MOUSEKDLNTMAPGLTIQAVRV 2 
A9664MRPS1428S ribosomal protein S14, mitochondrialRT14_MOUSEKDLQEM*AGDEIAALPRD 2 
A9664MRPS1428S ribosomal protein S14, mitochondrialRT14_MOUSEKDLQEMAGDEIAALPRD 2 
A3793PHBProhibitinPHB_MOUSEKDLQNVNITLRI 2 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorSCOT_MOUSEKDLTAVSNNAGVDNFGLGLLLRS 2 
A726AMTA2, MTA1L1, PIDMetastasis associated protein MTA2MTA2_MOUSEKDLVAQAPLKPKT 2 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKDLVPDLSNFYAQYKS 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKDLYANNVLSGGTTM*YPGIADRM 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKDLYANNVLSGGTTMYPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_MOUSEKDLYANTVLSGGTTM*YPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_MOUSEKDLYANTVLSGGTTM*YPGIADRM 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_MOUSEKDLYANTVLSGGTTMYPGIADRM 2 
A6276DDX46Probable ATP-dependent RNA helicase DDX46DDX46_MOUSEKDM*AAPGTSSVPAPTAGNAEKL 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKDM*AIATGGAVFGEEGLNLNLEDVQAHDLGKV 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDM*DLIDVNEAFAPQFLSVQKA 2 
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursorCC47_MOUSEKDM*ESLLPLMNM*VIYSIDKA 2 
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursorCC47_MOUSEKDM*ESLLPLMNMVIYSIDKA 2 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKDM*TSEELDDILRY 2 
A6276DDX46Probable ATP-dependent RNA helicase DDX46DDX46_MOUSEKDMAAPGTSSVPAPTAGNAEKL 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKV 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDMDLIDVNEAFAPQFLSVQKA 2 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKDMDLIDVNEAFAPQFLSVQKA 3 
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursorCC47_MOUSEKDMESLLPLMNMVIYSIDKA 2 
A0778MAP4Microtubule-associated protein 4MAP4_MOUSEKDMSPLPESEVTLGKD 2 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKDMTSEELDDILRY 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKDNHLLGTFDLTGIPPAPRG 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKDNHLLGTFDLTGIPPAPRG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_MOUSEKDNNLLGKFELTGIPPAPRG 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKDNPKVVHAFDMEDLGDKA 3 
A6066CHST10Carbohydrate sulfotransferase 10CHSTA_MOUSEKDPDGYSAKQEFVFLTTM*PEAEKLRG 3 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorETFA_MOUSEKDPEAPIFQVADYGIVADLFKV 2 
A0466AKT2RAC-beta serine/threonine protein kinaseAKT2_MOUSEKDPKQRLGGGPSDAKE 2 
A9735OLFML3, UNQ663/PRO1294, HNOEL-isoOlfactomedin-like protein 3 precursorOLFL3_MOUSEKDPLGPAEKIYVLDGTQNDTAFVFPRL 3 
A6573GCDHGlutaryl-CoA dehydrogenase, mitochondrial precursorGCDH_MOUSEKDPLILEEQLTADEKLIRDTFRN 2 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKDPQALSEHLKNPVIAQKI 3 
A1575DST, BPAG1, DMHDystoninBPA1_MOUSEKDQAEALGQTSCAVPKM 2 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorHSP47_MOUSEKDQAVENILLSPLVVASSLGLVSLGGKA 2 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorHSP47_MOUSEKDQAVENILLSPLVVASSLGLVSLGGKA 3 
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_MOUSEKDQLIVNLLKEEQAPQNKI 3 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKDQLLLGPTYATPKV 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKDQLLLGPTYATPKV 1 
A0660ACTR1A, CTRN1Alpha-centractinACTZ_MOUSEKDQLQTFSEEHPVLLTEAPLNPRK 3 
A6091COASY, NBPBifunctional coenzyme A synthaseCOASY_MOUSEKDQSHNENEEDKVSSSSFRQ 3 
A1782Serpina1aAlpha-1-antitrypsin 1-1A1AT1_MOUSEKDQSPASHEIATNLGDFAISLYRE 3 
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7UCR6_MOUSEKDQWTKYEEDKFYLEPYLKE 3 
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7UCR6_MOUSEKDQWTKYEEDKFYLEPYLKE 2 
A5890AUHMethylglutaconyl-CoA hydratase, mitochondrial precursorAUHM_MOUSEKDRLEGLLAFKE 2 
A7132NME2, NM23B, NME1-NME2Nucleoside diphosphate kinase BNDKB_MOUSEKDRPFFPGLVKY 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase ANDKA_MOUSEKDRPFFTGLVKY 2 
A0496GGT1, GGT, GTTGamma-glutamyltranspeptidase 1 precursorGGT1_MOUSEKDSEEGGLSVAVPGEIRG 2 
A1044RANBP2, NUP358Ran-binding protein 2RBP2_MOUSEKDSLITPHVSHLSTPRE 3 
A992AEEFSEC, SELBSelenocysteine-specific elongation factorSELB_MOUSEKDSMPTATEGDDEADPKA 2 
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2STML2_MOUSEKDSNTVLLPSNPSDVTSMVAQAMGVYGALTKA 2 
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2STML2_MOUSEKDSNTVLLPSNPSDVTSMVAQAMGVYGALTKA 3 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKDSQGNLFRN 2 
A3732SLC25A10, DICMitochondrial dicarboxylate carrierDIC_MOUSEKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRM 3 
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3XDDX3X_MOUSEKDSSGWSSSKDKDAYSSFGSRG 3 
A3865EPB41L3, DAL1Band 4.1-like protein 3E41L3_MOUSEKDSVSAAEVGTGQYATTKG 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKDSYVGDEAQSKR 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKDSYVGDEAQSKRG 2 
A9638RPS2040S ribosomal protein S20RS20_MOUSEKDTGKTPVEPEVAIHRI 3 
A0176PAK1, PAK1BSerine/threonine-protein kinase PAK 1PAK1_MOUSEKDTGTLNHGSKPLPPNPEEKK 3 
A8190VNN1Vanin 1VNN1_MOUSEKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQ 3 
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorPPIB_MOUSEKDTNGSQFFITTVKT 2 
A0405ATP6V1F, ATP6S14, VATFV-type proton ATPase subunit FVATF_MOUSEKDTTINEIEDTFRQ 2 
A7976ACAA1, ACAA, PTHIO3-ketoacyl-CoA thiolase, peroxisomal precursorTHIKB_MOUSEKDTTPDELLSAVLTAVLQDVKL 2 
A0778MAP4Microtubule-associated protein 4MAP4_MOUSEKDVAPPM*EEEIVPGNDTTSPKE 2 
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformMYH11_MOUSEKDVASLGSQLQDTQELLQEETRQ 2 
A9619MRPL49, NOF1Mitochondrial 60s ribosomal protein L49RM49_MOUSEKDVEEFLSPLLGKT 1 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKY 3 
A3479VDAC3Voltage-dependent anion-selective channel protein 3VDAC3_MOUSEKDVFNKGYGFGMVKI 2 
A6531FUCA1Tissue alpha-L-fucosidase precursorFUCO_MOUSEKDVGPHRDLVGELGAAVRK 3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKDVLFLKDCVGPEVENACANPAAGTVILLENLRF 3 
A7149MME, EPNNeprilysinNEP_MOUSEKDVLQEPKTEDIVAVQKA 3 
A9637RPS1940S ribosomal protein S19RS19_MOUSEKDVNQQEFVRA 2 
A4198RAD17, R24L, HRAD17Cell cycle checkpoint protein RAD17RAD17_MOUSEKDVSLFLFRALGKI 2 
A8971PSME1, IFI5111Proteasome activator complex subunit 1PSME1_MOUSEKDVTEQLNLVTTWLQLQIPRI 2 
A0461DDAH1, DDAHN(G),N(G)-dimethylarginine dimethylaminohydrolase 1DDAH1_MOUSEKDYAVSTVPVADSLHLKS 2 
A9629RPS1240S ribosomal protein S12RS12_MOUSEKDYGKESQAKDVIEEYFKC 3 
A6795INMT, INMT-FAM188BIndolethylamine N-methyltransferaseINMT_MOUSEKDYLTTYYSFHSGPVAEQEIVKF 3 
A6795INMT, INMT-FAM188BIndolethylamine N-methyltransferaseINMT_MOUSEKDYLTTYYSFHSGPVAEQEIVKF 2 
A4783EMD, EDMD, STAEmerinEMD_MOUSEKDYNDDYYEESYLTTKT 2 
A0083CTTN, EMS1CortactinSRC8_MOUSEKDYSSGFGGKYGVQADRVDKS 3 
A3623LGMN, PRSC1Legumain precursorLGMN_MOUSEKDYTGEDVTPENFLAVLRG 2 
A0406ATP6V1G1, ATP6G, ATP6G1Vacuolar ATP synthase subunit G 1VATG1_MOUSEKEAAALGSHGSCSSEVEKETRE 3 
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateMARCS_MOUSEKEAAEAEPAEPSSPAAEAEGASASSTSSPKA 2 
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateMARCS_MOUSEKEAAEAEPAEPSSPAAEAEGASASSTSSPKA 3 
A0280YWHAE14-3-3 protein epsilon1433E_MOUSEKEAAENSLVAYKA 2 
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyaseAPEX1_MOUSEKEAAGEGPVLYEDPPDQKT 2 
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyaseAPEX1_MOUSEKEAAGEGPVLYEDPPDQKTSPSGKS 3 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKEAALTNEEVGADLEQVEVLQKK 2 
A8437CCAR2, DBC1, DBC-1Protein KIAA1967K1967_MOUSEKEAAPDTGAEPSPEDSDPTYSSKV 2 
A2127DYNC1I2, DNCI2, DNCIC2Dynein intermediate chain 2, cytosolicDC1I2_MOUSEKEAAVSVQEESDLEKK 2 
A0450GRIPAP1GRIP1-associated protein 1GRAP1_MOUSEKEADLKAQLARTQKL 2 
A0450GRIPAP1GRIP1-associated protein 1GRAP1_MOUSEKEADLKAQLARTQKL 3 
A8944SAPS1, PPP6R1, PP6R1Serine/threonine-protein phosphatase 6 regulatory subunit 1SAPS1_MOUSEKEADMSSIQIPSSPPAHGSPQLRS 3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_MOUSEKEADQGAYTCEAMNSRG 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKEAEKLESEHPDQAQAILSRL 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKEAESCDCLQGFQLTHSLGGGTGSGM*GTLLISKI 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKI 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKI 2 
A9106TXN delta 3, TXN, TRDXThioredoxinTHIO_MOUSEKEAFQEALAAAGDKL 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKEAGEQVASSPAEVAEKA 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKEAGEQVASSPAEVAEKADRI 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKEAGEQVASSPAEVAEKADRI 2 
A2370MACGAP, ARHGAP18Rho GTPase-activating protein 18RHG18_MOUSEKEAGLSNLFGESIDDPQESILFLSTLTRT 2 
A327BC2CD2L, TMEM24, DLNB23C2 domain-containing protein 2-likeTMM24_MOUSEKEAGLSQSHDDLSNTTATPSVRK 3 
A9628RPS1140S ribosomal protein S11RS11_MOUSEKEAIEGTYIDKK 2 
A9628RPS1140S ribosomal protein S11RS11_MOUSEKEAIEGTYIDKKCPFTGNVSIRG 3 
A332CRAB7A, RAB7Ras-related protein Rab-7ARAB7_MOUSEKEAINVEQAFQTIARN 2 
A1508LAMB1Laminin subunit beta-1LAMB1_MOUSEKEALEEAEKAQVAAEKA 2 
A700CVPS4A, VPS4, VPS4-1Vacuolar protein sorting factor 4AVPS4A_MOUSEKEALKEAVILPIKFPHLFTGKR 3 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain4F2_MOUSEKEALSSWLQDGVDGFQFRD 2 
A2536NCLNucleolinNUCL_MOUSEKEAMEDGEIDGNKVTLDWAKPKG 3 
A099CLYST, CHS, CHS1Lysosomal trafficking regulatorLYST_MOUSEKEAQSILLEPSQLKG 2 
A141D Uncharacterized protein C12ORF4CL004_MOUSEKEARDSGNQNGGSDDKSKN 3 
A4636CAPZA1F-actin capping protein alpha-1 subunitCAZA1_MOUSEKEASDPQPEDVDGGLKS 2 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKEATDPRPYEAENAIESWRT 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKEATWVVDVKN 2 
A7933SARS, SERSSeryl-tRNA synthetase, cytoplasmicSYS_MOUSEKEAVGDDESVPENVLNFDDLTADALAALKV 2 
A7933SARS, SERSSeryl-tRNA synthetase, cytoplasmicSYS_MOUSEKEAVGDDESVPENVLNFDDLTADALAALKV 3 
A1489ITGA3, MSK18Integrin alpha-3 precursorITA3_MOUSEKEAVNPGSLFGYSVALHRQ 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEAWDAGKFASEITPITISVKG 2 
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialNUYM_MOUSEKEDAIAFAEKNGWSYDVEEKK 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKEDDSYGFHLNAIRG 2 
A545AHMGN5, NSBP1Nucleosomal binding protein 1NSBP1_MOUSEKEDRKEEGEQEVAVDEGSDENKV 2 
A0406ATP6V1G1, ATP6G, ATP6G1Vacuolar ATP synthase subunit G 1VATG1_MOUSEKEEAQAEIEQYRL 2 
A304CUQCRHUbiquinol-cytochrome C reductase complex 11 kDa protein, mitochondrial precursorUCRH_MOUSEKEEEEEELVDPLTTVRE 2 
A304CUQCRHUbiquinol-cytochrome C reductase complex 11 kDa protein, mitochondrial precursorUCRH_MOUSEKEEEEEELVDPLTTVREHCEQLEKCVKA 3 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLCX033_MOUSEKEEEPKKQLVRPDQLPIYTAPPLHSKY 3 
A7646CRYZCrystallin zetaQOR_MOUSEKEEFQQFAGLLQAGIEKG 2 
A0672AXIN2Axin 2AXN2_MOUSEKEEIEAEATQRVRC 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKEEIFGPVM*QILKF 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKEEIFGPVMQILKF 2 
A8694CALUCalumenin precursorCALU_MOUSEKEEIVDKYDLFVGSQATDFGEALVRH 3 
A461CSAR1B, SARA2, SARBGTP-binding protein SAR1bSAR1B_MOUSEKEELDSLMTDETIANVPILILGNKI 2 
A7521PSMA5Proteasome subunit alpha type 5PSA5_MOUSEKEELEEVIKD 2 
A3883PALMParalemmin-1PALM_MOUSEKEENQTGPTTTPSDTQDLDMKK 2 
A425AFHL2, DRAL, SLIM3Skeletal muscle LIM-protein 3FHL2_MOUSEKEEQLLCTDCYSNEYSSKC 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKEESFGPIM*IISRF 2 
A788ANOP56, NOL5ANucleolar protein Nop56NOP56_MOUSEKEEVASEPEEAASPTTPKK 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEEVKEVYM*GNVIQGGEGQAPTRQ 3 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEEVKEVYMGNVIQGGEGQAPTRQ 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEEVKEVYMGNVIQGGEGQAPTRQ 3 
A5940BRCC3, BRCC36, C6.1ALys-63-specific deubiquitinase BRCC36BRCC3_MOUSEKEEVMGLCIGELNDDIRS 2 
A314CRAB1A, RAB1Ras-related protein Rab-1ARAB1A_MOUSEKEFADSLGIPFLETSAKN 2 
A315CRAB1B, rab1bRas-related protein Rab-1BRAB1B_MOUSEKEFADSLGVPFLETSAKN 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKEFEPLLNWMKDKA 2 
A5166SVILArchvillinSVIL_MOUSEKEFGETTSEQTEVAARK 2 
A1107TWF1, PTK9Protein tyrosine kinase 9TWF1_MOUSEKEFGGGHIKDEVFGTVKE 2 
A3940STX7Syntaxin 7STX7_MOUSEKEFGSLPTTPSEQRQ 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKEFKEAGEQVASSPAEVAEKA 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKEFKEAGEQVASSPAEVAEKA 3 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKEFVEEFIWPAVQSSALYEDRY 2 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKEFVEEFIWPAVQSSALYEDRY 3 
A6455CES1, CES1A1a, CES1A1Carboxylesterase 1A1EST1_MOUSEKEGASEEEINLSKM 2 
A5830AS3MT, CYT19Arsenite methyltransferaseAS3MT_MOUSEKEGEAVAVDEETAAVLKN 2 
A1389CDC37, CDC37A, MBD5Hsp90 co-chaperone Cdc37CDC37_MOUSEKEGEEAGPGDPLLEAVPKA 2 
A3464PGRMC1, HPR6.6, PGRMCMembrane associated progesterone receptor component 1PGRC1_MOUSEKEGEEPTVYSDDEEPKDETARK 3 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKEGGAGGGFGSPM*DIFDM*FFGGGGRM 2 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKEGGAGGGFGSPM*DIFDMFFGGGGRM 2 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKEGGAGGGFGSPMDIFDM*FFGGGGRM 2 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKEGGAGGGFGSPMDIFDM*FFGGGGRM 3 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKEGGAGGGFGSPMDIFDMFFGGGGRM 2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2PRDX2_MOUSEKEGGLGPLNIPLLADVTKS 2 
A0793MPP6, VAM1MAGUK p55 subfamily member 6MPP6_MOUSEKEGGSAGLIPSQFLEEKR 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKEGHEVVGVFTIPDKDGKA 3 
A0466AKT2RAC-beta serine/threonine protein kinaseAKT2_MOUSEKEGISDGATM*KT 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKEGLELPEDEEEKK 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKEGLELPEDEEEKKKQ 2 
A3159DPF2, BAF45D, REQZinc-finger protein ubi-d4REQU_MOUSEKEGLISQDGSSLEALLRT 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKEGM*QLISEKPETEAVVKEKL 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase APPIA_MOUSEKEGMNIVEAMERF 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKEGMQLISEKPETEAVVKE 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKEGNSFGFSLKT 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKEGPAPIPAPLEATGSEPTEDAEGHKPKL 2 
A9611MRPL40, NLVCF, URIM39S ribosomal protein L40, mitochondrial precursorRM40_MOUSEKEGPHYTPPISNYQAPEGRY 3 
A6306DAKBifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)DAK_MOUSEKEGPSLTSPAQVLSRL 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKEGWPLDIRV 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase ANDKA_MOUSEKEHYTDLKDRPFFTGLVKY 2 
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1AL9A1_MOUSEKEIADKFINEVVKQ 2 
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorUCRI_MOUSEKEIDQEAAVEVSQLRDPQHDLDRV 3 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorODPA_MOUSEKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRG 3 
A4168NEDD8, NEDD8-MDP1Ubiquitin-like protein NEDD8NEDD8_MOUSEKEIEIDIEPTDKVERI 2 
A4832GAS2Growth-arrest-specific protein 2GAS2_MOUSEKEIEQEETLSAPSPSPSPSSKS 2 
A4832GAS2Growth-arrest-specific protein 2GAS2_MOUSEKEIEQEETLSAPSPSPSPSSKS 3 
A7132NME2, NM23B, NME1-NME2Nucleoside diphosphate kinase BNDKB_MOUSEKEIHLWFKPEELIDYKS 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKEIHQFNRDVEDEILWVGERM 3 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitETFB_MOUSEKEIIAVSCGPSQCQETIRT 2 
A6562GALNT2, GALNAC-T2UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferaseGALT2_MOUSEKEIILVDDYSNDPEDGALLGKI 2 
A9634RPS1640S ribosomal protein S16RS16_MOUSEKEIKDILIQYDRT 2 
A9541RPL1260S ribosomal protein L12RL12_MOUSEKEILGTAQSVGCNVDGRH 2 
A784BABCG2, ABCP, BCRPATP-binding cassette, sub-family G, member 2ABCG2_MOUSEKEILSDINGIMKPGLNAILGPTGGGKS 3 
A0999CFL1, CFLCofilin, non-muscle isoformCOF1_MOUSEKEILVGDVGQTVDDPYTTFVKM 2 
A5259ZNF185Zinc finger protein 185ZN185_MOUSEKEIPGTLQDGQSDPTVASQQLADLSILEPLGSPSGAEQQIKA 3 
A171ATRIAP1, 15E1.1, HSPC132TP53-regulated inhibitor of apoptosis 1TRIA1_MOUSEKEIPIEGLEFMGHGKE 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase ANDKA_MOUSEKEISLWFQPEELVEYKS 2 
A5077BGN, SLRR1ABiglycan precursorPGS1_MOUSEKEISPDTTLLDLQNNDISELRKD 3 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKEITALAPSTM*KI 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_MOUSEKEITALAPSTMKI 2 
A6276DDX46Probable ATP-dependent RNA helicase DDX46DDX46_MOUSEKEKDAGNFDQNKL 2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorGLU2B_MOUSEKEKESLQQLAEVTRE 3 
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialDNJA3_MOUSEKEKFSQLAEAYEVLSDEVKRK 3 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKEKGADFLVTEVENGGSLGSKK 3 
A220BZFHX3, ATBF1, ATBF1-BZinc finger homeobox protein 3ATBF1_MOUSEKEKKDLAPGGGSEGTMLPPRI 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorIDHP_MOUSEKEKLILPHVDVQLKY 2 
A4142PRPSAP1Phosphoribosyl pyrophosphate synthetase-associated protein 1KPRA_MOUSEKEKPPITVVGDVGGRI 2 
A6604HAGH, GLO2, HAGH1Hydroxyacylglutathione hydrolase, mitochondrialGLO2_MOUSEKEKTVQQHAGETDPVTTM*RA 3 
A6604HAGH, GLO2, HAGH1Hydroxyacylglutathione hydrolase, mitochondrialGLO2_MOUSEKEKTVQQHAGETDPVTTMRA 3 
A6604HAGH, GLO2, HAGH1Hydroxyacylglutathione hydrolase, mitochondrialGLO2_MOUSEKEKYAIGEPTVPSTLAEEFTYNPFMRV 2 
A6604HAGH, GLO2, HAGH1Hydroxyacylglutathione hydrolase, mitochondrialGLO2_MOUSEKEKYAIGEPTVPSTLAEEFTYNPFMRV 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKEKYGKDATNVGDEGGFAPNILENKE 3 
A380AEIF3G, EIF3S4Eukaryotic translation initiation factor 3 subunit 4IF34_MOUSEKELAEQLGLSTGEKEKLPGELEPVQAAQSKT 2 
A380AEIF3G, EIF3S4Eukaryotic translation initiation factor 3 subunit 4IF34_MOUSEKELAEQLGLSTGEKEKLPGELEPVQAAQSKT 3 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_MOUSEKELASQPDVDGFLVGGASLKPEFVDIINAKQ 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_MOUSEKELASQPDVDGFLVGGASLKPEFVDIINAKQ 3 
A612ChTIM44, TIMM44, MIMT44Import inner membrane translocase subunit TIM44, mitochondrial precursorTIM44_MOUSEKELDESVLGQTGPYRRPERL 3 
A4015LCA5LebercilinCF152_MOUSEKELDIKNIYANRLPKS 2 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKELDSITPDITPGWKG 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKELEDFKLQHGSILGFPKA 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKELEDFKLQHGSILGFPKA 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKELEEIVQPIISKL 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKELGAFGLQVPSELGGLGLSNTQYARL 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKELGAFGLQVPSELGGLGLSNTQYARL 3 
A7358NPEPL1Probable aminopeptidase NPEPL1PEPL1_MOUSEKELGITPTIIRD 2 
A7320PCYOX1, PCL1, UNQ597/PRO1183Prenylcysteine oxidase precursorPCYOX_MOUSEKELGLSSVPASGGLVGVYNGKS 2 
A3939STX12Syntaxin 12STX12_MOUSEKELGSLPLPLSASEQRQ 2 
A4187PIWIL1, HIWIHIWIPIWL1_MOUSEKELIGLIVLTKYNNKT 2 
A4187PIWIL1, HIWIHIWIPIWL1_MOUSEKELIGLIVLTKYNNKT 1 
A0533S100A1, S100AProtein S100-A1S10A1_MOUSEKELKDLLQTELSGFLDVQKD 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKELKIDILPNPQERT 2 
A7067MST4, RP6-213H19.1, STK3Serine/threonine protein kinase MASKMST4_MOUSEKELLKHKFIVKN 2 
A0231ARPC4, ARC20, ARPC4-TTLL3Actin-related protein 2/3 complex subunit 4ARPC4_MOUSEKELLLQPVTISRN 2 
A7223OATOrnithine aminotransferase, mitochondrial precursorOAT_MOUSEKELMKLPSDVVTSVRG 2 
A587AEIF4H, WBSCR1, WSCR1Eukaryotic translation initiation factor 4HIF4H_MOUSEKELPTEPPYTAYVGNLPFNTVQGDIDAIFKD 2 
A587AEIF4H, WBSCR1, WSCR1Eukaryotic translation initiation factor 4HIF4H_MOUSEKELPTEPPYTAYVGNLPFNTVQGDIDAIFKD 3 
A548ATCF2, HNF1BHepatocyte nuclear factor 1-betaHNF1B_MOUSEKELQALNTEEAAEQRA 2 
A857BCALB1, CAB27CalbindinCALB1_MOUSEKELQNLIQELLQARK 2 
A6048CHDHCholine dehydrogenase, mitochondrial precursorCHDH_MOUSEKELQPGSHVQSDKEIDAFVRA 2 
A4015LCA5LebercilinCF152_MOUSEKELQRLHHKLKE 2 
A6521FOLH1, FOLH, NAALAD1Glutamate carboxypeptidase 2FOLH1_MOUSEKELQSPDEGFEGKS 2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKELSEIAQRI 2 
A4342HS24/P52, HSPA4, APG2Heat shock protein, 110 kDaHSP74_MOUSEKELSTTLNADEAVTRG 2 
A8008TOP1DNA topoisomerase-1TOP1_MOUSEKELTAPDENVPAKI 2 
A5942RNF40, BRE1BE3 ubiquitin-protein ligase BRE1BBRE1B_MOUSEKELTLRSQALELNKR 2 
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorACADS_MOUSEKELVPIAAQLDREHLFPTAQVKK 3 
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorACADS_MOUSEKELVPIAAQLDREHLFPTAQVKKM 3 
A8810GIMAP4, IAN1, IMAP4Immunity-associated protein 4GIMA4_MOUSEKELVVVDTPGIFDTEVPDADTQRE 2 
A3911NAPG, SNAPGGamma-soluble NSF attachment proteinSNAG_MOUSEKEM*QKLPEAVQLIEKA 3 
A5704ASPA, ACY2, ASPAspartoacylaseACY2_MOUSEKEM*SEDLPYEVRR 2 
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitTCPZ_MOUSEKEMDRETLIDVART 2 
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIAMY18A_MOUSEKEMESRDEEVEEARQ 2 
A1720DAB2, DOC2Disabled homolog 2DAB2_MOUSEKEMFKDFQLRQPPLVPSRK 3 
A3911NAPG, SNAPGGamma-soluble NSF attachment proteinSNAG_MOUSEKEMQKLPEAVQLIEKA 2 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNNTM_MOUSEKEMSKEFIEAEMKL 2 
A3918VCPTransitional endoplasmic reticulum ATPaseTERA_MOUSEKEMVELPLRHPALFKA 2 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseG6PD1_MOUSEKEMVQNLMVLRF 2 
A4539TRPV6, ECAC2Transient receptor potential channel 6, subfamily VTRPV6_MOUSEKENDVQALSKLLKF 2 
A5989CTSL1, CTSL, MEPCathepsin L1 precursorCATL_MOUSEKENGGLDSEESYPYEAKD 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKENGTITAANASTLNDGAAALVLM*TAEAAQRL 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKENGTITAANASTLNDGAAALVLMTAEAAQRL 3 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKENGTITAANASTLNDGAAALVLMTAEAAQRL 2 
A857APNN, DRS, MEMAPininPININ_MOUSEKENINSQEVEKE 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKENLKAAQEEYIKRA 3 
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_MOUSEKENPTTFMGHYLHEVARR 2 
A297DDMXL1, XL1DmX-like protein 1DMXL1_MOUSEKENQAFPLWDSTKIVPLSKF 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKENVLIGEGAGFKI 2 
A198BZC3H11A, ZC3HDC11AZinc finger CCCH domain-containing protein 11AZC11A_MOUSEKENVRTVVRMVTLSSKPEEPLVRL 3 
A178D UPF0235 protein C15ORF40U235_MOUSEKEPETAPPAAGPVATDPKG 2 
A586AEIF4G3Eukaryotic translation initiation factor 4 gamma, 3IF4G3_MOUSEKEQAGQM*PETAAGEPTPEPPRT 2 
A0135MAPT, MAPTL, MTBT1Microtubule-associated protein tauTAU_MOUSEKEQDLEGATVVGVPGEEQKA 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKEQFLDGDAWTNRW 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKEQFLDGDAWTNRWVESKH 2 
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1ADT1_MOUSEKEQGFLSFWRG 2 
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_MOUSEKEQGVLSFWRG 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKEQIDIFEGIKDSQAQRM 2 
A9543RPL17, RPL17P960S ribosomal protein L17RL17_MOUSEKEQIVPKPEEEVAQKK 2 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKEQPLDEELKDAFQNAYLELGGLGERV 3 
A696AMED4, ARC36, DRIP36Vitamin D3 receptor-interacting protein complex 36 kDa componentMED4_MOUSEKERMGGVSGM*AGLGSTRERL 2 
A9722SPAG9, HSS, MAPK8IP4C-Jun-amino-terminal kinase-interacting protein 4JIP4_MOUSEKERPISLGIFPLPAGDGLLTPDTQKG 3 
A354ADPY30, HDPY-30Protein dpy-30 homologDPY30_MOUSEKERPPNPIEFLASYLLKN 2 
A354ADPY30, HDPY-30Protein dpy-30 homologDPY30_MOUSEKERPPNPIEFLASYLLKN 3 
A0808MSNMoesinMOES_MOUSEKERQEAEEAKEALLQASRD 3 
A0808MSNMoesinMOES_MOUSEKERQEAEEAKEALLQASRD 2 
A647ALMCD1LIM and cysteine-rich domains protein 1LMCD1_MOUSEKERQPVTGTEGALYRR 3 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGRP75_MOUSEKERVEAVNMAEGIIHDTETKM 3 
A8063TTBK2Tau-tubulin kinase 2TTBK2_MOUSEKERYDHRLMLKH 2 
A1009CDC5L, PCDC5RP, HSCDC5Cell division cycle 5-like proteinCDC5L_MOUSEKESDLPSAILQTSGVSEFTKK 2 
A0808MSNMoesinMOES_MOUSEKESEAVEWQQKA 2 
A524AHDGF, HMG1L2Hepatoma-derived growth factorHDGF_MOUSEKESGDHEEEDKEIAALEGERPLPVEVEKN 3 
A0044GNA11, GA11Guanine nucleotide-binding protein G(Y), alpha subunit 11GNA11_MOUSEKESKRINAEIEKQ 2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_MOUSEKESLEVQIHPSRS 2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorGLU2B_MOUSEKESLQQLAEVTRE 2 
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2STML2_MOUSEKESMQMQVEAERR 2 
A6119CYP24, CYP24A1Cytochrome P450 24A1, mitochondrial precursorCP24A_MOUSEKESMRLTPSVPFTTRT 2 
A984AUTP3, CRLZ1, SAS10Something about silencing protein 10SAS10_MOUSEKESPELLELIEDLQAKL 2 
A0135MAPT, MAPTL, MTBT1Microtubule-associated protein tauTAU_MOUSEKESPPQPPADDGAEEPGSETSDAKS 2 
A9629RPS1240S ribosomal protein S12RS12_MOUSEKESQAKDVIEEYFKC 2 
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_MOUSEKESQESADQSDVIDSQASSKA 2 
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50NHERF_MOUSEKESSREALVEPASESPRPALARS 3 
A3623LGMN, PRSC1Legumain precursorLGMN_MOUSEKESSYACYYDEERG 2 
A4745DBNL, CMAP, SH3P7Cervical SH3P7DBNL_MOUSEKESTSFQDVGPQAPVGSVYQKT 2 
A7236REXO2, SFN, SMFNOligoribonuclease, mitochondrial precursorORN_MOUSEKESTVTLQQAEYEFLSFVRQ 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKESVNAAFEMTLTEGNKL 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKESVNAAFEMTLTEGNKLEKR 2 
A2330EEA1, ZFYVE2Early endosome antigen 1EEA1_MOUSEKESVSLLEKERE 2 
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3CES3_MOUSEKESYPFLPTVIDGVVLPKA 2 
A498AHIST1H2BB, H2BFFHistone H2B.fH2B1B_MOUSEKESYSVYVYKV 2 
A3940STX7Syntaxin 7STX7_MOUSEKETDKYIKEFGSLPTTPSEQRQ 2 
A3940STX7Syntaxin 7STX7_MOUSEKETDKYIKEFGSLPTTPSEQRQ 3 
A383AEIF3J, EIF3S1, PRO0391Eukaryotic translation initiation factor 3 subunit 1IF31_MOUSEKETFGVNNTVYGIDAMNPSSRD 2 
A7495PPT1, PPTPalmitoyl-protein thioesterase 1 precursorPPT1_MOUSEKETIPLQESTLYTEDRL 2 
A3939STX12Syntaxin 12STX12_MOUSEKETNELLKELGSLPLPLSASEQRQ 3 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKETPFLSNPGTNLVFEDEISALQPEVDKL 2 
A4354NDUFAF2, NDUFA12L, MIMITINMimitin, mitochondrial precursorMIMIT_MOUSEKETSEELLPSPTATQVKG 2 
A7646CRYZCrystallin zetaQOR_MOUSEKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKG 3 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKETTIQGLDGLSERC 2 
A567BPLVAP, FELS, PV1PV1 proteinPLVAP_MOUSEKETVMQQLLTTRR 2 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorSCOT_MOUSEKETVTVLPGASFFSSDESFAMIRG 2 
A526CSNX5Sorting nexin 5SNX5_MOUSEKEVDDFFEQEKNFLINYYNRI 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKEVDEQMLNVQNKN 2 
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorECH1_MOUSEKEVDM*GLAADVGTLQRL 2 
A4354NDUFAF2, NDUFA12L, MIMITINMimitin, mitochondrial precursorMIMIT_MOUSEKEVDYEAGDIPTEWEAWIRR 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKEVEEDEYKAFYKS 2 
A883APRPF3, HPRP3, PRP3U4/U6 small nuclear ribonucleoprotein Prp3PRPF3_MOUSEKEVELTHRM*PTLKANIRA 2 
A3866EPB41L2Band 4.1-like protein 2E41L2_MOUSEKEVENEQTPVSEPEEEKGSQPGPPVERQ 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKEVEPEPTEEKDVDADEEDSRK 3 
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorUQCR1_MOUSEKEVESIGAHLNAYSTRE 2 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKEVGADFTIQVGKE 2 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKEVGADFTIQVGKETPQEIASKV 2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicMDHC_MOUSEKEVGVYEALKDDSWLKG 2 
A927KSDF2Stromal cell-derived factor 2 precursorSDF2_MOUSEKEVHGM*AQPSQNNYWKA 3 
A927KSDF2Stromal cell-derived factor 2 precursorSDF2_MOUSEKEVHGMAQPSQNNYWKA 3 
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_MOUSEKEVHKQVVDSAYEVIKL 3 
A8961PSMC5, SUG126S protease regulatory subunit 8PRS8_MOUSEKEVIELPVKHPELFEALGIAQPKG 3 
A1720DAB2, DOC2Disabled homolog 2DAB2_MOUSEKEVKEMFKDFQLRQ 2 
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformMYH11_MOUSEKEVLLQVEDERK 2 
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorNUMM_MOUSEKEVNENFAIDLIAQQPVNEVEHRI 3 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKEVPAGKYPFIVTADDGRQ 3 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKEVSVFGAVSELFTRK 2 
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorSAP_MOUSEKEVVDSYLPVILDMIKG 2 
A681AMECP2Methyl-CpG-binding protein 2MECP2_MOUSEKEVVKPLLVSTLGEKS 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEVYM*GNVIQGGEGQAPTRQ 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKEVYMGNVIQGGEGQAPTRQ 2 
A7110NAMPT, NAMPTL, PBEFNicotinamide phosphoribosyltransferaseNAMPT_MOUSEKEVYREHFQDDVFNERG 3 
A7110NAMPT, NAMPTL, PBEFNicotinamide phosphoribosyltransferaseNAMPT_MOUSEKEVYREHFQDDVFNERG 2 
A7241OTUB1, OTB1, OTU1Ubiquitin thiolesterase protein OTUB1OTUB1_MOUSEKEYAEDDNIYQQKI 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKEYDDNGEGITIFRPLHLANKFEDKT 3 
A3535DNAJA2, CPR3, HIRIP4DnaJ homolog subfamily A member 2DNJA2_MOUSEKEYHPDKNPNAGDKF 2 
A3946ABCD3, PMP70, PXMP1ATP-binding cassette, sub-family D, member 3ABCD3_MOUSEKEYLDNVQLGHILERE 2 
A3876ADD1, ADDAAlpha adducinADDA_MOUSEKEYQPHVIVSTTGPNPFNTLTDRE 3 
A5796ENPEPGlutamyl aminopeptidaseAMPE_MOUSEKEYSALSNMPEEKS 2 
A9137UFM1, BM-002, UPF0185Ubiquitin-fold modifier 1UFM1_MOUSEKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH 3 
A4814FLNB, FLN3, TAPFilamin-BFLNB_MOUSEKFADEHVPGSPFTVKI 2 
A0850VIMVimentinVIME_MOUSEKFADLSEAANRN 2 
A3542CCT8, CCTQT-complex protein 1, theta subunitTCPQ_MOUSEKFAEAFEAIPRA 2 
A5842ASS1, ASSArgininosuccinate synthaseASSY_MOUSEKFAELVYTGFWHSPECEFVRHCIQKS 3 
A5839AGA, GAN(4)-(beta)-N-acetylglucosaminyl-L-asparaginase precursorASPG_MOUSEKFAESMGFTNEDLSTKT 2 
A4158MLECMalectinK0152_MOUSEKFAEVYFAQSQQKV 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKFAFQAEVNRM 2 
A2536NCLNucleolinNUCL_MOUSEKFAISELFAKN 2 
A3714HSD11B1, HSD11, HSD11LCorticosteroid 11-beta-dehydrogenase, isozyme 1DHI1_MOUSEKFALDGFFSTIRT 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKFAM*EPEEFDSDTLRE 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKFAMEPEEFDSDTLRE 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKFAMEPEEFDSDTLREFVTAFKK 2 
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorPCCB_MOUSEKFANPFPAAVRG 2 
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorACDSB_MOUSEKFAQEHVAPLVSSMDENSKM 3 
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorACDSB_MOUSEKFAQEHVAPLVSSMDENSKM 2 
A6409EHHADH, ECHDPeroxisomal bifunctional enzymeECHP_MOUSEKFAQTVIGKPIEPRR 3 
A6409EHHADH, ECHDPeroxisomal bifunctional enzymeECHP_MOUSEKFAQTVIGKPIEPRR 2 
A313CRAB18, PNAS-32Ras-related protein Rab-18RAB18_MOUSEKFARKHSM*LFIEASAKT 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKFASEITPITISVKG 2 
A531DHEBP1, HBPHeme-binding protein 1HEBP1_MOUSEKFATVEVTDKPVDEALRE 2 
A531DHEBP1, HBPHeme-binding protein 1HEBP1_MOUSEKFATVEVTDKPVDEALRE 3 
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorAL4A1_MOUSEKFAVELEGEQPISVPPSTNHTVYRG 3 
A7127POR, CYPORNADPH-cytochrome P450 reductaseNCPR_MOUSEKFAVFGLGNKT 2 
A6640GPD1, GPD-C, GPDH-CGlycerol-3-phosphate dehydrogenase [NAD+], cytoplasmicGPDA_MOUSEKFCETTIGCKDPAQGQLLKD 3 
A5242VIL1, VILVillin 1VILI_MOUSEKFDALTM*HVQPQVAAQQKM 3 
A5242VIL1, VILVillin 1VILI_MOUSEKFDALTMHVQPQVAAQQKM 2 
A5242VIL1, VILVillin 1VILI_MOUSEKFDALTMHVQPQVAAQQKM 3 
A926KZNFX1Zinc finger, NFX1-type containing 1ZNFX1_MOUSEKFDDIRIYFDARI 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKFDEGRNNFEGEITKE 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKFDEGRNNFEGEITKEKL 2 
A0244PSMB4, PROS26Proteasome subunit beta type 4 precursorPSB4_MOUSEKFDGGVVIAADMLGSYGSLARF 2 
A5984CTSD, CPSDCathepsin D precursorCATD_MOUSEKFDGILGM*GYPHISVNNVLPVFDNLM*QQKL 3 
A5984CTSD, CPSDCathepsin D precursorCATD_MOUSEKFDGILGM*GYPHISVNNVLPVFDNLMQQKL 3 
A5984CTSD, CPSDCathepsin D precursorCATD_MOUSEKFDGILGMGYPHISVNNVLPVFDNLM*QQKL 3 
A5984CTSD, CPSDCathepsin D precursorCATD_MOUSEKFDGILGMGYPHISVNNVLPVFDNLMQQKL 3 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGDIB_MOUSEKFDLGQDVIDFTGHSLALYRT 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGDIB_MOUSEKFDLGQDVIDFTGHSLALYRT 3 
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialNUGM_MOUSEKFDLNSPWEAFPAYRQ 2 
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialNUGM_MOUSEKFDLNSPWEAFPAYRQPPESLKL 3 
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialNUGM_MOUSEKFDLNSPWEAFPAYRQPPESLKL 2 
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorGRPE1_MOUSEKFDPYEHEALFHTPVEGKE 3 
A4326GRPEL1, GREPEL1GrpE protein homolog 1, mitochondrial precursorGRPE1_MOUSEKFDPYEHEALFHTPVEGKEPGTVALVSKV 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKFDRGYISPYFINTSKG 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKFDRGYISPYFINTSKG 2 
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformRS4X_MOUSEKFDTGNLCMVTGGANLGRI 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKFDTQYPYGEKQDEFKRL 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKFDTQYPYGEKQDEFKRL 3 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKFDVSGYPTIKI 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKFDVSGYPTIKI 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase APPIA_MOUSEKFEDENFILKH 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_MOUSEKFEDGDLTLYQSNAILRH 2 
A9662MRPS11, RPMS11, HCC228S ribosomal protein S11, mitochondrial precursorRT11_MOUSEKFEDVPIAHIKA 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKFEELNMDLFRS 2 
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14UBP14_MOUSEKFEGVELNTDEPPMVFKA 2 
A0688AP1M1, CLTNMAdaptor-related protein complex 1, mu 1 subunitAP1M1_MOUSEKFEIPYFTTSGIQVRY 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKFENAFLSHVISQHQSLLGNIRS 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKFENAFLSHVISQHQSLLGNIRS 3 
A8958PSMC3, TBP126S protease regulatory subunit 6APRS6A_MOUSEKFENLGIQPPKGVLMYGPPGTGKT 2 
A526CSNX5Sorting nexin 5SNX5_MOUSEKFEQLSESAKEELINFKRK 3 
A0655MAPRE3, RP3, EBF3-LMicrotubule-associated protein RP/EB family member 3MARE3_MOUSEKFFDANYDGKDYNPLLARQ 3 
A0653MAPRE1Microtubule-associated protein RP/EB family member 1MARE1_MOUSEKFFDANYDGKEYDPVAARQ 2 
A7849SPCS2, SPC25Signal peptidase complex subunit 2SPCS2_MOUSEKFFDHSGTLVMDAYEPEISRL 2 
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorTRAP1_MOUSEKFFEDYGLFMRE 2 
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 1HS105_MOUSEKFFGKDVSTTLNADEAVARG 3 
A0819RDXRadixinRADI_MOUSEKFFPEDVSEELIQEITQRL 2 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKFFQEEVIPHHTEWEKA 3 
A5654ACADLAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursorACADL_MOUSEKFFQEEVIPHHTEWEKA 2 
A4183PEX19, HK33, PXFPeroxisomal biogenesis factor 19PEX19_MOUSEKFFQELFDSELASQATAEFEKA 2 
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorCOX7R_MOUSEKFFQKADGFHLKRG 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorDECR_MOUSEKFFQPVLKPM*LPPDAFQGKV 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorDECR_MOUSEKFFQPVLKPMLPPDAFQGKV 2 
A4651CDHR5, MUCDHL, MUPCDHCadherin-related family member 5MUCDL_MOUSEKFFSLEGVNYPALKL 2 
A9722SPAG9, HSS, MAPK8IP4C-Jun-amino-terminal kinase-interacting protein 4JIP4_MOUSEKFFVAVPGQVISPQSSSGGADLTADKA 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_MOUSEKFFVGGNWKM 2 
A7369PTGES2, PGES2Prostaglandin E synthase 2PGES2_MOUSEKFGAVEAAM*AKY 2 
A4180PCNPPEST proteolytic signal-containing nuclear proteinPCNP_MOUSEKFGFAIGSQTARK 2 
A5928BLVRA, BLVR, BVRBiliverdin reductase A precursorBIEA_MOUSEKFGFPAFSGISRL 2 
A5830AS3MT, CYT19Arsenite methyltransferaseAS3MT_MOUSEKFGFQAPNVTFLHGRI 2 
A5830AS3MT, CYT19Arsenite methyltransferaseAS3MT_MOUSEKFGFQAPNVTFLHGRI 3 
A1229FKBP5, AIG6, FKBP51FK506-binding protein 5FKBP5_MOUSEKFGIDPNAELMYEVTLKS 2 
A7725RNASET2, RNASE6PLRibonuclease 6 precursorRNT2_MOUSEKFGIKPSINYYQLADFKD 3 
A7725RNASET2, RNASE6PLRibonuclease 6 precursorRNT2_MOUSEKFGIKPSINYYQLADFKDALTRI 3 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1CMC1_MOUSEKFGLYLPKF 2 
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2CMC2_MOUSEKFGLYLPLFKPSASTSKV 2 
A6879LACTB, MRPL56, UNQ843/PRO1781Serine beta lactamase-like protein LACTB, mitochondrialLACTB_MOUSEKFGNAMLYGYQVGQFKN 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKFGVEQDVDM*VFASFIRK 2 
A5928BLVRA, BLVR, BVRBiliverdin reductase A precursorBIEA_MOUSEKFGVVVVGVGRA 2 
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalACOX1_MOUSEKFGYEEMDNGYLKM 2 
A5217TMOD3Ubiquitous tropomodulinTMOD3_MOUSEKFGYQFTQQGPRT 2 
A2536NCLNucleolinNUCL_MOUSEKFGYVDFESAEDLEKA 2 
A4767DNAH5, DNAHC5, HL1Ciliary dynein heavy chain 5DYH5_MOUSEKFHDKIYDRI 2 
A9722SPAG9, HSS, MAPK8IP4C-Jun-amino-terminal kinase-interacting protein 4JIP4_MOUSEKFIEFEDSQEQEKKDLQTRV 3 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKFIIHAPPGEFNEVFNDVRL 3 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKFIIHAPPGEFNEVFNDVRL 2 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEM*EPENPLFQPSPSM*NNLVAQKK 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEM*EPENPLFQPSPSMNNLVAQKKL 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEMEPENPLFQPSPSM*NNLVAQKK 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEMEPENPLFQPSPSMNNLVAQKK 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEMEPENPLFQPSPSMNNLVAQKK 2 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFILDGWHEMEPENPLFQPSPSMNNLVAQKKL 3 
A6877L2HGDHL-2-hydroxyglutarate dehydrogenase, mitochondrial precursorL2HDH_MOUSEKFIPEITISDVLRG 2 
A6718HERC2, KLF13E3 ubiquitin-protein ligase HERC2HERC2_MOUSEKFISDGSVNGWGWRF 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKFISDKDASVVGFFRD 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKFISDKDASVVGFFRD 3 
A4636CAPZA1F-actin capping protein alpha-1 subunitCAZA1_MOUSEKFITHAPPGEFNEVFNDVRL 2 
A4636CAPZA1F-actin capping protein alpha-1 subunitCAZA1_MOUSEKFITHAPPGEFNEVFNDVRL 3 
A155BUTP15U3 small nucleolar RNA-associated protein 15 homologUTP15_MOUSEKFIVLQELVEKE 1 
A2163DDRGK1DDRGK domain-containing protein 1CT116_MOUSEKFIYITPEELAAVANFIRQ 2 
A0430LMNB1, LMN2, LMNBLamin B1LMNB1_MOUSEKFKAEHDQLLLNYAKK 3 
A4832GAS2Growth-arrest-specific protein 2GAS2_MOUSEKFKESM*DANKPAKTLPLKK 2 
A4655CEP112, CCDC46Centrosomal protein of 112 kDaCCD46_MOUSEKFKGLM*PASLRQELEDTISSLKS 3 
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein AVAPA_MOUSEKFKGPFTDVVTTNLKL 3 
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein AVAPA_MOUSEKFKGPFTDVVTTNLKL 2 
A370ATUFMElongation factor Tu, mitochondrial precursorEFTU_MOUSEKFKKYEEIDNAPEERA 3 
A370ATUFMElongation factor Tu, mitochondrial precursorEFTU_MOUSEKFKKYEEIDNAPEERA 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKFKLEAPDADELPRS 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKFKLEAPDADELPRS 3 
A1954GSTM1, GST1Glutathione S-transferase Mu 1GSTM1_MOUSEKFKLGLDFPNLPYLIDGSHKI 2 
A1954GSTM1, GST1Glutathione S-transferase Mu 1GSTM1_MOUSEKFKLGLDFPNLPYLIDGSHKI 3 
A1954GSTM1, GST1Glutathione S-transferase Mu 1GSTM1_MOUSEKFKLGLDFPNLPYLIDGSHKITQSNAILRY 3 
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ARS3A_MOUSEKFKLITEDVQGKN 3 
A3536DNAJA1, DNAJ2, HDJ2DnaJ homolog subfamily A member 1DNJA1_MOUSEKFKQISQAYEVLADSKK 3 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1CMC1_MOUSEKFKSPSVAVAQPKA 3 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorALDH2_MOUSEKFKTIEEVVGRA 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKFLDAGHKLNFAVASRK 2 
A4447CLIC5, MST130, MSTP130Chloride intracellular channel protein 5CLIC5_MOUSEKFLDGDELTLADCNLLPKL 2 
A9577RPL9, RPL9P7, RPL9P860S ribosomal protein L9RL9_MOUSEKFLDGIYVSEKG 2 
A929BCYB5A, CYB5Cytochrome B5CYB5_MOUSEKFLEEHPGGEEVLRE 2 
A929BCYB5A, CYB5Cytochrome B5CYB5_MOUSEKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARE 3 
A8139UCHL3Ubiquitin carboxyl-terminal esterase L3UCHL3_MOUSEKFLEESVSM*SPEERA 2 
A8008TOP1DNA topoisomerase-1TOP1_MOUSEKFLEHKGPVFAPPYEPLPESVKF 3 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKFLETVELQISLKN 2 
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11M2OM_MOUSEKFLFGGLAGM*GATVFVQPLDLVKN 2 
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11M2OM_MOUSEKFLFGGLAGMGATVFVQPLDLVKN 2 
A6840CMPK1, CMPK, CMKCytidine monophosphate (UMP-CMP) kinase 1, cytosolicKCY_MOUSEKFLIDGFPRN 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKFLIPNASQPESKV 2 
A2591SSB, SS-B/LaLupus La proteinLA_MOUSEKFLKEQIKLDEGWVPLETMIKF 3 
A852BCOL4A3BP, CERT, STARD11Goodpasture antigen-binding proteinC43BP_MOUSEKFLKRFTSYVQEKT 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase ANDKA_MOUSEKFLQASEDLLKE 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase ANDKA_MOUSEKFLQASEDLLKEHYTDLKDRPFFTGLVKY 3 
A4323FKBP3, FKBP25FK506-binding protein 3FKBP3_MOUSEKFLQDHGSDSFLAEHKL 2 
A4323FKBP3, FKBP25FK506-binding protein 3FKBP3_MOUSEKFLQDHGSDSFLAEHKL 3 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKFLQDTIEEM*ALKN 2 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKFLQDTIEEMALKN 2 
A6813IVDIsovaleryl-CoA dehydrogenase, mitochondrial precursorIVD_MOUSEKFLQENLAPKA 2 
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_MOUSEKFLSDPQVHTVLVERS 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKFLSHWDHITRV 2 
A6354DDTD-dopachrome decarboxylaseDOPD_MOUSEKFLTEELSLDQDRI 2 
A6644GPX3, GPXPGlutathione peroxidase 3GPX3_MOUSEKFLVGPDGIPVM*RW 2 
A6644GPX3, GPXPGlutathione peroxidase 3GPX3_MOUSEKFLVGPDGIPVMRW 2 
A6642GPX1Glutathione peroxidase 1GPX1_MOUSEKFLVGPDGVPVRRY 2 
A5632AADAT, KAT2L-kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursorAADAT_MOUSEKFLYTVPNGNNPTGNSLTGDRK 2 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKFM*NPFNLPNLYQKL 2 
A5015NUDC, NPD011, MNUDC proteinNUDC_MOUSEKFMDQHPEMDFSKA 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKFMELLEPLSERK 2 
A1230PPID, CYP40, CYPD40 kDa peptidyl-prolyl cis-trans isomerasePPID_MOUSEKFMIQGGDFSNQNGTGGESIYGEKF 2 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKFMNPFNLPNLYQKL 2 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKFMNPFNLPNLYQKL 3 
A9538RPL10, DXS648E, QM60S ribosomal protein L10RL10_MOUSEKFNADEFEDM*VAEKR 2 
A9538RPL10, DXS648E, QM60S ribosomal protein L10RL10_MOUSEKFNADEFEDMVAEKR 2 
A9538RPL10, DXS648E, QM60S ribosomal protein L10RL10_MOUSEKFNADEFEDMVAEKRL 3 
A9538RPL10, DXS648E, QM60S ribosomal protein L10RL10_MOUSEKFNADEFEDMVAEKRL 2 
A0439PHB2, BAP, REAProhibitin 2PHB2_MOUSEKFNASQLITQRA 2 
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein MHNRPM_MOUSEKFNECGHVLYADIKM 2 
A3960MYO6Unconventional myosin-VIMYO6_MOUSEKFNEVVSALKDGKPEVNRQ 3 
A996ASF3A1, SAP114Splicing factor 3 subunit 1SF3A1_MOUSEKFNFLNPNDPYHAYYRH 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKFNGGGHINHTIFWTNLSPKG 2 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKFNGGGHINHTIFWTNLSPKG 3 
A099BTERF2IP, RAP1, PP8000Telomeric repeat binding factor 2 interacting protein 1TE2IP_MOUSEKFNLDLSTVTQALLKN 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKFNPETDFLTGKDGKK 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKFNPETDFLTGKDGKKF 2 
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2NDUAC_MOUSEKFNVSATPEQYVPYSTTRK 2 
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2NDUAC_MOUSEKFNVSATPEQYVPYSTTRKK 3 
A021BSMG7, SGA56M, EST1CSMG-7 homolog, nonsense mediated mRNA decay factor (C. elegans)SMG7_MOUSEKFPFPAASTNLQKA 2 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKFPGINYPVLTPNM*KG 2 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKFPGINYPVLTPNMKG 2 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKFPGINYPVLTPNMKGFEEAVAAGAKE 3 
A567BPLVAP, FELS, PV1PV1 proteinPLVAP_MOUSEKFQADVLSAWRD 2 
A4290DNAJB11, EDJ, ERJ3DnaJ homolog subfamily B member 11 precursorDNJBB_MOUSEKFQDLGAAYEVLSDSEKRK 3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_MOUSEKFQGLDLNEELYLGGYPDYGAIPKA 2 
A3994CHCHD6, CHCM1Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialCHCH6_MOUSEKFQQEQLAVQDEM*VRV 2 
A6913ALOX15, LOG15Arachidonate 15-lipoxygenaseLX12L_MOUSEKFREELAALDKEIEIRN 3 
A3938VAPB, UNQ484/PRO983Vesicle-associated membrane protein-associated protein B/CVAPB_MOUSEKFRGPFTDVVTTNLKL 3 
A3938VAPB, UNQ484/PRO983Vesicle-associated membrane protein-associated protein B/CVAPB_MOUSEKFRGPFTDVVTTNLKL 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorECHB_MOUSEKFRLNFLSPELPAVAEFSTNETM*GHSADRL 3 
A0804AKAP8, AKAP95A-kinase anchor protein 8AKAP8_MOUSEKFRSFEDEEIQKH 3 
A0092EPB41, E41PErythrocyte membrane protein band 4.141_MOUSEKFRYSGRTQAQTRQ 2 
A4446CLIC4Chloride intracellular channel protein 4CLIC4_MOUSEKFSAYIKNSRPEANEALERG 3 
A6009CBR1, CBR, CRNCarbonyl reductase [NADPH] 1DHCA_MOUSEKFSGDVVLAARD 2 
A0420ABLIM1, ABLIM, LIMAB1Actin-binding LIM protein 1ABLM1_MOUSEKFSKFPAAQAPDPNEIPKI 3 
A702BTMED9, GP25L2, HSGP25L2GTransmembrane EMP24 domain-containing protein 9TMED9_MOUSEKFSLFAGGMLRV 2 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKFSMVQVWPVRQ 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1PABP1_MOUSEKFSPAGPILSIRV 2 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorATPO_MOUSEKFSPLTANLM*NLLAENGRL 2 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorATPO_MOUSEKFSPLTANLMNLLAENGRL 2 
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialDNJA3_MOUSEKFSQLAEAYEVLSDEVKR 2 
A4302DNAJA3, HCA57, TID1DnaJ homolog subfamily A member 3, mitochondrialDNJA3_MOUSEKFSQLAEAYEVLSDEVKRK 2 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKFSSEELDKLWRE 2 
A0402ATP6V1D, VATD, ATP6MVacuolar ATP synthase subunit DVATD_MOUSEKFTAGDFSTTVIQNVNKA 2 
A0402ATP6V1D, VATD, ATP6MVacuolar ATP synthase subunit DVATD_MOUSEKFTAGDFSTTVIQNVNKAQVKI 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKFTASAGIQVVGDDLTVTNPKR 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKFTASAGIQVVGDDLTVTNPKRI 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFTENPKAGDEFVEKT 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKFTENPKAGDEFVEKT 2 
A4636CAPZA1F-actin capping protein alpha-1 subunitCAZA1_MOUSEKFTITPPSAQVVGVLKI 2 
A9548RPL22, RPL22L260S ribosomal protein L22RL22_MOUSEKFTLDCTHPVEDGIMDAANFEQFLQERI 3 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKFTVTPSTTQVVGILKI 2 
A3816RPS340S ribosomal protein S3RS3_MOUSEKFVDGLMIHSGDPVNYYVDTAVRH 3 
A0496GGT1, GGT, GTTGamma-glutamyltranspeptidase 1 precursorGGT1_MOUSEKFVDVSQVIRN 2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicMDHC_MOUSEKFVEGLPINDFSRE 2 
A599CTXN2, TRX2Thioredoxin, mitochondrial precursorTHIOM_MOUSEKFVGIKDEDQLEAFLKKL 3 
A0326VIL2, EZREzrinEZRI_MOUSEKFVIKPIDKKAPDFVFYAPRL 3 
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68DDX5_MOUSEKFVINYDYPNSSEDYIHRI 3 
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68DDX5_MOUSEKFVINYDYPNSSEDYIHRI 2 
A588AEIF5Eukaryotic translation initiation factor 5IF5_MOUSEKFVLCPECENPETDLHVNPKK 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKFVLSSGKFYGDLEKDKG 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKFVLSSGKFYGDLEKDKG 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKFVM*QEEFSRD 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKFVMQEEFSRD 2 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKFVNQLKGESRR 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGDIB_MOUSEKFVSISDLFVPKD 2 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKFVTGDIIQIINKD 2 
A6572GATM, AGATGlycine amidinotransferase, mitochondrial precursorGATM_MOUSEKFVTTEFEPCFDAADFIRA 2 
A8960PSMC2, MSS126S protease regulatory subunit 7PRS7_MOUSEKFVVDLSDQVAPTDIEEGM*RV 2 
A8960PSMC2, MSS126S protease regulatory subunit 7PRS7_MOUSEKFVVDLSDQVAPTDIEEGMRV 2 
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEKFWEVISDEHGIDPTGTYHGDSDLQLDRI 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKFWEVISDEHGIDPTGTYHGDSDLQLERI 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKFWEVISDEHGIDPTGTYHGDSDLQLERI 3 
A967ASNRPCU1 small nuclear ribonucleoprotein CRU1C_MOUSEKFYCDYCDTYLTHDSPSVRK 3 
A0654MAPRE2, RP1T-cell activation proteinMARE2_MOUSEKFYDANYDGKEYDPVEARQ 3 
A5416NAP1L1, NRPNucleosome assembly protein 1-like 1NP1L1_MOUSEKFYEEVHDLERK 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKFYGDLEKDKGLQTSQDARF 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKFYGDLEKDKGLQTSQDARF 2 
A9445PGRMC2, DG6, PMBPMembrane associated progesterone receptor component 2PGRC2_MOUSEKFYGPAGPYGIFAGRD 2 
A3464PGRMC1, HPR6.6, PGRMCMembrane associated progesterone receptor component 1PGRC1_MOUSEKFYGPEGPYGVFAGRD 2 
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7UCR6_MOUSEKFYLEPYLKE 2 
A0326VIL2, EZREzrinEZRI_MOUSEKFYPEDVAEELIQDITQKL 2 
A0808MSNMoesinMOES_MOUSEKFYPEDVSEELIQDITQRL 2 
A0289PPP5C, PPP5Serine/threonine protein phosphatase 5PPP5_MOUSEKFYSQAIELNPGNAIYYGNRS 2 
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4NDUA4_MOUSEKFYSVNVDYSKL 2 
A5981CATCatalaseCATA_MOUSEKFYTEDGNWDLVGNNTPIFFIRD 2 
A5981CATCatalaseCATA_MOUSEKFYTEDGNWDLVGNNTPIFFIRD 3 
A0148WASF1, SCAR1, WAVE1Wiskott-Aldrich syndrome protein family member 1WASF1_MOUSEKFYTNPSYFFDLWKE 2 
A3867EPB41L1Band 4.1-like protein 1E41L1_MOUSEKGAAAM*IPGPQTVATEIRS 2 
A3867EPB41L1Band 4.1-like protein 1E41L1_MOUSEKGAAAMIPGPQTVATEIRS 2 
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31BAP31_MOUSEKGAAEDGDKLDIGNTEMKL 2 
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31BAP31_MOUSEKGAAEDGDKLDIGNTEMKL 3 
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31BAP31_MOUSEKGAAEDGDKLDIGNTEMKLEENKS 3 
A647ALMCD1LIM and cysteine-rich domains protein 1LMCD1_MOUSEKGAAPVDSPVVYADRA 2 
A5399MTPNMyotrophinMTPN_MOUSEKGADKTVKGPDGLTALEATDNQAIKA 3 
A177BYB-1, YBX1, NSEP1Nuclease sensitive element binding protein 1YBOX1_MOUSEKGAEAANVTGPGGVPVQGSKY 2 
A8651AIMP1, EMAP2, SCYE1Multisynthetase complex auxiliary component p43MCA1_MOUSEKGAEADQIIEYLKQ 2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitPARK7_MOUSEKGAEEM*ETVIPVDVM*RR 2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitPARK7_MOUSEKGAEEM*ETVIPVDVMRR 2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitPARK7_MOUSEKGAEEMETVIPVDVMRR 2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitPARK7_MOUSEKGAEEMETVIPVDVMRRA 3 
A5981CATCatalaseCATA_MOUSEKGAGAFGYFEVTHDITRY 3 
A5981CATCatalaseCATA_MOUSEKGAGAFGYFEVTHDITRY 2 
A4814FLNB, FLN3, TAPFilamin-BFLNB_MOUSEKGAGKAPLIVQFSSPLPGEAVKD 3 
A4575ANXA4, PIG28, ANX4Annexin A4ANXA4_MOUSEKGAGTDEGCLIEILASRT 2 
A1422COL6A2Collagen alpha 2(VI) chain precursorCO6A2_MOUSEKGAKGNMGEPGEPGQKG 2 
A6521FOLH1, FOLH, NAALAD1Glutamate carboxypeptidase 2FOLH1_MOUSEKGALEPDRYVILGGHRD 3 
A6521FOLH1, FOLH, NAALAD1Glutamate carboxypeptidase 2FOLH1_MOUSEKGALEPDRYVILGGHRD 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKGALPLDTVTFYKV 2 
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialETFD_MOUSEKGAPLNTPVTEDRF 2 
A9542RPL15, EC4560S ribosomal protein L15RL15_MOUSEKGATYGKPVHHGVNQLKF 2 
A9542RPL15, EC4560S ribosomal protein L15RL15_MOUSEKGATYGKPVHHGVNQLKF 3 
A796BAFTPH, AFTHAftiphilinAFTIN_MOUSEKGAVASGHLQEPGTSVQTALLNRL 3 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1CAP1_MOUSEKGAVPYVQAFDSLLANPVAEYLKM 2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1CAP1_MOUSEKGAVPYVQAFDSLLANPVAEYLKM 3 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1CAP1_MOUSEKGAVPYVQAFDSLLANPVAEYLKM*SKEIGGDVQKH 3 
A4363PFDN2, PFD2, HSPC231Prefoldin subunit 2PFD2_MOUSEKGAVSAEQVIAGFNRL 2 
A5799METAP2, MNPEP, P67EIF2Methionine aminopeptidase 2AMPM2_MOUSEKGAVSAVQQELDKESGALVDEVAKQ 3 
A7526PSMB1, PSC5Proteasome subunit beta type 1PSB1_MOUSEKGAVYSFDPVGSYQRD 2 
A8023TREH, TREATrehalase precursorTREA_MOUSEKGAWFDYDLEKG 2 
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorBDH_MOUSEKGDAGVKELDSLKSDRL 3 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialNUBM_MOUSEKGDARPAEIDSLWEISKQ 3 
A374AEIF1B, GC20Eukaryotic translation initiation factor 1BEIF1B_MOUSEKGDDLLPAGTEDYIHIRI 2 
A8773FARP2, PLEKHC3FERM, RhoGEF and pleckstrin domain-containing protein 2FARP2_MOUSEKGDHQRIGDILLRNMRQ 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKGDQVSQNGLPAEQGSPRM 2 
A3991MTDH, AEG1, LYRICProtein LyricLYRIC_MOUSEKGDSDNSSSQVPPMLQDTDKPKS 3 
A1020PHYH, PAHXPhytanoyl-CoA 2-hydroxylasePAHX_MOUSEKGDTVFFHPLLIHGSGRN 2 
A1020PHYH, PAHXPhytanoyl-CoA 2-hydroxylasePAHX_MOUSEKGDTVFFHPLLIHGSGRN 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKGDVTTQVALQPALKF 2 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKGEATVSFDDPPSAKA 2 
A424AFHL1, SLIM1Skeletal muscle LIM-protein 1FHL1_MOUSEKGEDFYCVTCHETKFAKHCVKC 3 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicMDHC_MOUSEKGEFITTVQQRG 2 
A5866ATAD3AATPase family, AAA domain containing, protein 3AATAD3_MOUSEKGEGTGPPLPLPPAQPGAEGGGDRG 2 
A0787FKBP4, FKBP52FK506-binding protein 4FKBP4_MOUSEKGEHSIVYLKPSYAFGSVGKE 2 
A0787FKBP4, FKBP52FK506-binding protein 4FKBP4_MOUSEKGEHSIVYLKPSYAFGSVGKERF 3 
A4706COL11A2Collagen alpha 2(XI) chain precursorCOBA2_MOUSEKGEKGHPGLIGLIGPTGEQGEKG 2 
A6822AK1Adenylate kinase isoenzyme 1KAD1_MOUSEKGELVPLDTVLDM*LRD 2 
A6822AK1Adenylate kinase isoenzyme 1KAD1_MOUSEKGELVPLDTVLDMLRD 2 
A0369LDHBL-lactate dehydrogenase B chainLDHB_MOUSEKGEM*M*DLQHGSLFLQTPKI 3 
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_MOUSEKGEM*M*DLQHGSLFLQTPKI 3 
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorATP5J_MOUSEKGEMDTFPTFKFDDPKF 3 
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorATP5J_MOUSEKGEMDTFPTFKFDDPKF 2 
A0369LDHBL-lactate dehydrogenase B chainLDHB_MOUSEKGEMMDLQHGSLFLQTPKI 2 
A0370LDHA, PIG19L-lactate dehydrogenase A chainLDHA_MOUSEKGEMMDLQHGSLFLQTPKI 2 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKGENLSLVVHGPGDIRL 2 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKGENLSLVVHGPGDIRL 3 
A0710HNRPC, HNRNPCHeterogeneous nuclear ribonucleoproteins C1/C2HNRPC_MOUSEKGFAFVQYVNERN 2 
A740ALSM8, NAA38N-alpha-acetyltransferase 38, NatC auxiliary subunitLSM8_MOUSEKGFDQTINLILDESHERV 3 
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1AL1A1_MOUSEKGFFVQPTVFSNVTDEMRI 2 
A2536NCLNucleolinNUCL_MOUSEKGFGFVDFNSEEDAKA 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1PABP1_MOUSEKGFGFVSFERH 2 
A0029ANXA6, ANX6Annexin A6ANXA6_MOUSEKGFGSDKESILELITSRS 2 
A4577ANXA7, ANX7, SNXAnnexin A7ANXA7_MOUSEKGFGTDEQAIVDVVSNRS 2 
A1575DST, BPAG1, DMHDystoninBPA1_MOUSEKGFHSGEDSALITTAAARV 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKGFIGPGIDVPAPDM*STGERE 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKGFIGPGIDVPAPDMSTGERE 2 
A369ATSFMElongation factor Ts, mitochondrial precursorEFTS_MOUSEKGFLNSSELSELAAGPDREGSLKDQLALAIGKL 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKGFPTIYFSPANKK 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKGFPTIYFSPANKKL 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKGFQQILAGEYDHLPEQAFYM*VGPIEEAVAKA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKGFQQILAGEYDHLPEQAFYM*VGPIEEAVAKA 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKA 3 
A362AEBNA1BP2, EBP2EBNA1 binding protein 2EBP2_MOUSEKGFSDKLDFLEGDQKPVERS 3 
A1720DAB2, DOC2Disabled homolog 2DAB2_MOUSEKGFSSSNPSVVSQPASSDPHRS 3 
A3882LASP1, MLN50LIM and SH3 domain protein 1LASP1_MOUSEKGFSVVADTPELQRI 2 
A1201PTPRK, PTPKReceptor-type protein-tyrosine phosphatase kappa precursorPTPRK_MOUSEKGFWNPPLAPRK 2 
A1331EHD3, EHD2, PAST3EH-domain containing protein 3EHD3_MOUSEKGGAFEGTLQGPFGHGYGEGAGEGIDDAEWVVARD 3 
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalACOX1_MOUSEKGGDFLEGNIITGAQMSQVNSRI 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGGDQTTLLVLDKEAESIYSLARF 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKGGGEPKGELLEAIKRD 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKGGGEPKGELLEAIKRD 2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorTMM27_MOUSEKGGHINDGFLTEDERL 3 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorTMM27_MOUSEKGGHINDGFLTEDERL 2 
A5986CTSH, CPSBCathepsin H precursorCATH_MOUSEKGGLPSQAFEYILYNKG 2 
A968ASNRPA1U2 small nuclear ribonucleoprotein A'RU2A_MOUSEKGGPSAGDVEAIKNAIANASTLAEVERL 3 
A0693PACSIN3Protein kinase C and casein kinase substrate in neurons protein 3PACN3_MOUSEKGGRSPDEVTLTSIVPTRD 3 
A459ENICE-4, UBAP2L, NICE4Ubiquitin associated protein 2-likeUBP2L_MOUSEKGGSTTGSQFLEQFKT 2 
A1023LPPLipoma preferred partnerLPP_MOUSEKGGYPGPMGPPSIPPSFRPEDELEHLTKKM 3 
A4354NDUFAF2, NDUFA12L, MIMITINMimitin, mitochondrial precursorMIMIT_MOUSEKGHASAPYFGREEPSVAPTSTGKT 3 
A382AEIF3I, EIF3S2, TRIP1Eukaryotic translation initiation factor 3 subunit IIF32_MOUSEKGHFGPINSVAFHPDGKS 3 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3GBLP_MOUSEKGHNGWVTQIATTPQFPDMILSASRD 2 
A092CLMAN1, ERGIC53, F5F8DERGIC-53 protein precursorLMAN1_MOUSEKGHPDLQGQPADDIFESIGDRE 3 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKGHRIEEVPELPLVVEDKV 2 
A0461DDAH1, DDAHN(G),N(G)-dimethylarginine dimethylaminohydrolase 1DDAH1_MOUSEKGHVLLHRT 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKGHYTEGAELVDSVLDVVRK 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKGHYTEGAELVDSVLDVVRK 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKGHYTEGAELVDSVLDVVRKE 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainTBB2C_MOUSEKGHYTEGAELVDSVLDVVRKE 3 
A3545CCT6A, CCT6, CCTZT-complex protein 1, zeta subunitTCPZ_MOUSEKGIDPFSLDALAKE 2 
A384AEIF3K, EIF3S12, ARG134Eukaryotic translation initiation factor 3 subunit 11IF3C_MOUSEKGIDRYNPENLATLERY 2 
A3946ABCD3, PMP70, PXMP1ATP-binding cassette, sub-family D, member 3ABCD3_MOUSEKGIEGAQASPLVPGAGEIINTDNIIKF 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_MOUSEKGIGKGSSAADKVVAEIRR 3 
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein MHNRPM_MOUSEKGIGMGNLGPAGMGMEGIGFGINKI 2 
A7294PAPSS2, ATPSK2Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2PAPS2_MOUSEKGIHELFVPENKVDQIRA 2 
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitTCPD_MOUSEKGIHPTIISESFQKA 3 
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitTCPD_MOUSEKGIHPTIISESFQKA 2 
A368AGFM1, EFG, EFG1Elongation factor G 1, mitochondrial precursorEFG1_MOUSEKGIIDLIEERA 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKGIIDPTKVVRT 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKGILAADESTGSIAKR 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKGILAADESTGSIAKRL 2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKGILAADESVGTM*GNRL 2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKGILAADESVGTMGNRL 2 
A6688HAO2, HAOX2, GIG16Hydroxyacid oxidase 2HAOX2_MOUSEKGILTKEDAELAVKH 2 
A5986CTSH, CPSBCathepsin H precursorCATH_MOUSEKGIM*EEDSYPYIGKD 2 
A5418NAP1L4, NAP1L4b, NAP2Nucleosome assembly protein 1-like 4NP1L4_MOUSEKGIPEFWFTIFRN 2 
A5416NAP1L1, NRPNucleosome assembly protein 1-like 1NP1L1_MOUSEKGIPEFWLTVFKN 2 
A380AEIF3G, EIF3S4Eukaryotic translation initiation factor 3 subunit 4IF34_MOUSEKGIPLPTGDTSPEPELLPGDPLPPPKEVINGNIKT 3 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKGIQKFPGINYPVLTPNMKG 3 
A6736HMGCLHydroxymethylglutaryl-CoA lyase, mitochondrial precursorHMGCL_MOUSEKGIQKFPGINYPVLTPNMKG 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGIRPAINVGLSVSRV 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGIRPAINVGLSVSRV 3 
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorACADS_MOUSEKGISAFLVPM*PTPGLTLGKK 2 
A2344ACTN4Alpha-actinin 4ACTN4_MOUSEKGISQEQM*QEFRA 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKGITFDSGGISIKA 2 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNNTM_MOUSEKGITHIGYTDLPSRM 2 
A931BCYCS, CYCCytochrome CCYC_MOUSEKGITWGEDTLM*EYLENPKK 2 
A931BCYCS, CYCCytochrome CCYC_MOUSEKGITWGEDTLM*EYLENPKKY 2 
A931BCYCS, CYCCytochrome CCYC_MOUSEKGITWGEDTLMEYLENPKK 2 
A931BCYCS, CYCCytochrome CCYC_MOUSEKGITWGEDTLMEYLENPKKY 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKGIVDQSQQAYQEAFEISKK 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKGIVDQSQQAYQEAFEISKKE 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKGIVDQSQQAYQEAFEISKKE 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKGIVKDIIHDPGRG 2 
A3812RPL860S ribosomal protein L8RL8_MOUSEKGIVKDIIHDPGRGAPLAKV 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKGIVKDIIHDPGRGAPLAKV 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKGIVNEQFLLQRL 2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BALDOB_MOUSEKGIVVGIKLDQGGAPLAGTNKE 3 
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorLAMC1_MOUSEKGKAEQQTADQLLARA 2 
A3882LASP1, MLN50LIM and SH3 domain protein 1LASP1_MOUSEKGKGFSVVADTPELQRI 3 
A3882LASP1, MLN50LIM and SH3 domain protein 1LASP1_MOUSEKGKGFSVVADTPELQRI 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKGKLEAIITPPPAKK 2 
A528CSNX7Sorting nexin 7SNX7_MOUSEKGKLEEAHPTLIIPPLPEKF 3 
A7091MUTMethylmalonyl-CoA mutase, mitochondrialMUTA_MOUSEKGKNPEDLIWHTPEGISIKPLYSRA 3 
A1135PTBP1, PTBPolypyrimidine tract-binding protein 1PTBP1_MOUSEKGKNQAFIEMNTEEAANTMVNYYTSVAPVLRG 3 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKGKNSSVGLIQLNRPKA 3 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKGKPDVVVKEDEEYKR 3 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorTHIL_MOUSEKGKPDVVVKEDEEYKRV 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKGKQTMQVDEHARPQTTLEQLQKL 3 
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialCH10_MOUSEKGKSGEIEPVSVKVGDKV 3 
A6891GLO1Lactoylglutathione lyaseLGUL_MOUSEKGLAFIQDPDGYWIEILNPNKI 2 
A0496GGT1, GGT, GTTGamma-glutamyltranspeptidase 1 precursorGGT1_MOUSEKGLAIALDKK 2 
A9630RPS1340S ribosomal protein S13RS13_MOUSEKGLAPDLPEDLYHLIKK 2 
A9630RPS1340S ribosomal protein S13RS13_MOUSEKGLAPDLPEDLYHLIKKA 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKGLDPARVNVPVIGGHAGKT 3 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKGLDPYNM*LPPKA 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKGLDPYNMLPPKA 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKGLDPYNMLPPKAASGTKE 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorCOX5B_MOUSEKGLDPYNMLPPKAASGTKEDPNLVPSISNKR 3 
A1410COL6A1Collagen alpha 1(VI) chain precursorCO6A1_MOUSEKGLEELLIGGSHLKENKY 3 
A3967KIF5B, KNS, KNS1Kinesin family member 5BKINH_MOUSEKGLEETVAKELQTLHNLRK 3 
A7543PTGR2, ZADH1Prostaglandin reductase 2ZADH1_MOUSEKGLENM*GVAFQSMMTGGNVGKQ 2 
A7543PTGR2, ZADH1Prostaglandin reductase 2ZADH1_MOUSEKGLENMGVAFQSMMTGGNVGKQ 2 
A1021CSRP1, CSRP, CYRPCysteine-rich protein 1CSRP1_MOUSEKGLESTTLADKDGEIYCKGCYAKN 3 
A1021CSRP1, CSRP, CYRPCysteine-rich protein 1CSRP1_MOUSEKGLESTTLADKDGEIYCKGCYAKN 2 
A7311PCK1, PEPCK1Phosphoenolpyruvate carboxykinase, cytosolic [GTP]PPCKC_MOUSEKGLGGVNVEELFGISKE 2 
A5788AMACRAlpha-methylacyl-CoA racemaseAMACR_MOUSEKGLGLESEELPSQM*SSADWPEM*KK 2 
A5788AMACRAlpha-methylacyl-CoA racemaseAMACR_MOUSEKGLGLESEELPSQM*SSADWPEMKK 2 
A5788AMACRAlpha-methylacyl-CoA racemaseAMACR_MOUSEKGLGLESEELPSQMSSADWPEMKK 2 
A364ESYAP1, PRO3113Synapse associated protein 1SYAP1_MOUSEKGLGNYLYNFASAATKK 2 
A2120STRNStriatinSTRN_MOUSEKGLGPLAEAAAAGDGAAAAGAARA 2 
A4575ANXA4, PIG28, ANX4Annexin A4ANXA4_MOUSEKGLGTDEDAIIGILAYRN 2 
A4576ANXA5, ANX5, ENX2Annexin A5ANXA5_MOUSEKGLGTDEDSILNLLTSRS 2 
A0647ANXA1, ANX1, LPC1Annexin A1ANXA1_MOUSEKGLGTDEDTLIEILTTRS 2 
A7223OATOrnithine aminotransferase, mitochondrial precursorOAT_MOUSEKGLLNAIVIRE 2 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorETFA_MOUSEKGLLPEELTPLILETQKQ 2 
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70TOM70_MOUSEKGLLQLQWKQ 2 
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialKAD4_MOUSEKGLLVPDHVITRL 2 
A1201PTPRK, PTPKReceptor-type protein-tyrosine phosphatase kappa precursorPTPRK_MOUSEKGLNPGTLNILVRV 2 
A5524ATXN2, ATX2, SCA2Ataxin-2ATX2_MOUSEKGLPQPTISFDGIYANVRM 2 
A784BABCG2, ABCP, BCRPATP-binding cassette, sub-family G, member 2ABCG2_MOUSEKGLSGDVLINGAPQPAHFKC 2 
A1052SAE1, AOS1, SUA1SUMO-1 activating enzyme subunit 1ULE1A_MOUSEKGLTM*LDHEQVSPEDPGAQFLIQTGSVGRN 3 
A1052SAE1, AOS1, SUA1SUMO-1 activating enzyme subunit 1ULE1A_MOUSEKGLTMLDHEQVSPEDPGAQFLIQTGSVGRN 3 
A9630RPS1340S ribosomal protein S13RS13_MOUSEKGLTPSQIGVILRD 2 
A6640GPD1, GPD-C, GPDH-CGlycerol-3-phosphate dehydrogenase [NAD+], cytoplasmicGPDA_MOUSEKGLVDKFPLFTAVYKV 3 
A6640GPD1, GPD-C, GPDH-CGlycerol-3-phosphate dehydrogenase [NAD+], cytoplasmicGPDA_MOUSEKGLVDKFPLFTAVYKV 2 
A0204FLNA, FLN, FLN1Filamin AFLNA_MOUSEKGLVEPVDVVDNADGTQTVNYVPSRE 2 
A1325AP3M1Adapter-related protein complex 3 mu 1 subunitAP3M1_MOUSEKGLVNLQSGAPKPEENPNLNIQFKI 3 
A3688CSCitrate synthase, mitochondrial precursorCISY_MOUSEKGLVYETSVLDPDEGIRF 2 
A4574ANXA13, ANX13Annexin A13ANX13_MOUSEKGM*GTDEAAIIEVLSSRT 2 
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorCOX5A_MOUSEKGM*NTLVGYDLVPEPKI 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGM*SLNLEPDNVGVVVFGNDKL 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGM*SLNLEPDNVGVVVFGNDKLIKE 3 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorSCOT_MOUSEKGMGGAMDLVSSSKT 2 
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorCOX5A_MOUSEKGMNTLVGYDLVPEPKI 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGMSLNLEPDNVGVVVFGNDKL 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGMSLNLEPDNVGVVVFGNDKLIKE 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKGMSLNLEPDNVGVVVFGNDKLIKE 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_MOUSEKGNDISSGTVLSDYVGSGPPSGTGLHRY 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_MOUSEKGNDISSGTVLSDYVGSGPPSGTGLHRY 3 
A166CMYL9, MLC2, MRLC1Myosin regulatory light polypeptide 9MLRN_MOUSEKGNFNYVEFTRI 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKGNIYSLNEGYAKD 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKGNIYSLNEGYAKDFDPAINEYLQRK 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKGNIYSLNEGYAKDFDPAINEYLQRK 3 
A5399MTPNMyotrophinMTPN_MOUSEKGPDGLTALEATDNQAIKA 2 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialNUBM_MOUSEKGPDWILGEMKT 2 
A3918VCPTransitional endoplasmic reticulum ATPaseTERA_MOUSEKGPELLTM*WFGESEANVRE 2 
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein AVAPA_MOUSEKGPFTDVVTTNLKL 2 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorODPA_MOUSEKGPILM*ELQTYRY 2 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorODPA_MOUSEKGPILMELQTYRY 2 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorIDH3A_MOUSEKGPLKTPIAAGHPSM*NLLLRK 3 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorIDH3A_MOUSEKGPLKTPIAAGHPSMNLLLRK 3 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorIDH3A_MOUSEKGPLKTPIAAGHPSMNLLLRK 2 
A9634RPS1640S ribosomal protein S16RS16_MOUSEKGPLQSVQVFGRK 2 
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50NHERF_MOUSEKGPNGYGFNLHSDKSKPGQFIRA 3 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CGPC5C_MOUSEKGPSEGAYDVILPRA 2 
A0796AKAP2, PRKA2, PALM2-AKAP2A-kinase anchor protein 2AKAP2_MOUSEKGPSQPPTAAQPSGPVNMEETRPEGGYFSKY 3 
A0796AKAP2, PRKA2, PALM2-AKAP2A-kinase anchor protein 2AKAP2_MOUSEKGPSQPPTAAQPSGPVNMEETRPEGGYFSKY 2 
A4357NPM1, NPMNucleophosminNPM_MOUSEKGPSSVEDIKA 2 
A0990PPM1A, PPPM1AProtein phosphatase 1APP2CA_MOUSEKGPTEQLVSPEPEVHDIERS 3 
A8008TOP1DNA topoisomerase-1TOP1_MOUSEKGPVFAPPYEPLPESVKF 2 
A9648RPS2840S ribosomal protein S28RS28_MOUSEKGPVREGDVLTLLESERE 2 
A9648RPS2840S ribosomal protein S28RS28_MOUSEKGPVREGDVLTLLESERE 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKGQETSTNPIASIFAWSRG 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKGQGVYLGMPGCLPAYDALAGEFIKA 2 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKGQIGAPMPGKVIDIKV 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGQIIKDIEPGSPAEAAGLKN 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGQIIKDIEPGSPAEAAGLKN 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKS 3 
A7476ALPLAlkaline phosphatase, tissue-nonspecific isozyme precursorPPBT_MOUSEKGQLHHNTGEETRLEM*DKFPFVALSKT 3 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKGQLTIDQVFPYPSVLSEEQAQFLKE 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKGQLTIDQVFPYPSVLSEEQAQFLKE 3 
A9425OGFROpioid growth factor receptorOGFR_MOUSEKGQVGPEDPKGQVGPEDPKG 3 
A1925PFKLPhosphofructokinase, liverK6PL_MOUSEKGQVQEVGWHDVAGWLGRG 2 
A6804PPA1, IOPPP, PPInorganic pyrophosphataseIPYR_MOUSEKGQYISPFHDVPIYADKDVFHMVVEVPRW 3 
A786ANOP14, NOL14, RES4-25Nucleolar protein 14NOP14_MOUSEKGRAAFPGLDVLIYLKI 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKGRIPVNNRFQTKI 3 
A9550RPL2360S ribosomal protein L23/L17RL23_MOUSEKGRLNRLPAAGVGDMVMATVKK 3 
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ARS3A_MOUSEKGRVFEVSLADLQNDEVAFRKF 3 
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorBDH_MOUSEKGRVVNISSMLGRM 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKGSASSALELTEEELATAEAVRS 2 
A7164NMT, NMT1Glycylpeptide N-tetradecanoyltransferase 1NMT1_MOUSEKGSDMESTQDQPVKMTSLPAERI 3 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKGSDWLGDQDAIHYM*TEQAPASVVELENYGM*PFSRT 3 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKGSDWLGDQDAIHYM*TEQAPASVVELENYGMPFSRT 3 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKGSDWLGDQDAIHYMTEQAPASVVELENYGM*PFSRT 3 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRT 3 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKGSEEPPVFLEIHYM*GSPNATEAPLVFVGKG 3 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKGSEEPPVFLEIHYMGSPNATEAPLVFVGKG 2 
A127BTHRAP3, TRAP150Thyroid hormone receptor-associated protein 3TR150_MOUSEKGSESSKPWPDATTYGAGSASRA 3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorPDIA6_MOUSEKGSFSEQGINEFLRE 2 
A7235OPLAH5-oxoprolinase (ATP hydrolysing)OPLA_MOUSEKGSILDPSPEAAVVGGNVLTSQRV 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKGSLLIDSSTIDPSVSKE 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKGSLLIDSSTIDPSVSKELAKE 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKGSLLIDSSTIDPSVSKELAKE 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKGSLLIDSSTIDPSVSKELAKEVEKM 3 
A5242VIL1, VILVillin 1VILI_MOUSEKGSLNITTPGIQIWRI 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGSNGYGFYLRA 2 
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GIIF4G1_MOUSEKGSSGGSGAKPSDTASEATRPATLNRF 3 
A424AFHL1, SLIM1Skeletal muscle LIM-protein 1FHL1_MOUSEKGSSVVAYEGQSWHDYCFHCKK 2 
A0816ENAH, MENAEnabled protein homologENAH_MOUSEKGSTIETEQKEDRNEDAEPITAKA 3 
A9682MRPS36, DC47Mitochondrial 28S ribosomal protein S36RT36_MOUSEKGSTSPDLLM*HQGPPDTAEIIKS 2 
A9682MRPS36, DC47Mitochondrial 28S ribosomal protein S36RT36_MOUSEKGSTSPDLLMHQGPPDTAEIIKS 2 
A8649HRBL, AGFG2, RABRARF-GAP domain and FG repeats-containing protein 2HRBL_MOUSEKGSVSATPVQGSVPEGKPIRT 3 
A461CSAR1B, SARA2, SARBGTP-binding protein SAR1bSAR1B_MOUSEKGSVSLKELNARPLEVFM*CSVLKR 3 
A3549SSR1, TRAPATranslocon-associated protein, alpha subunit precursorSSRA_MOUSEKGTEDFIVESLDASFRY 2 
A0348FXYD2, ATP1C, ATP1G1Sodium/potassium-transporting ATPase gamma chainATNG_MOUSEKGTENPFEYDYETVRK 2 
A0348FXYD2, ATP1C, ATP1G1Sodium/potassium-transporting ATPase gamma chainATNG_MOUSEKGTENPFEYDYETVRKG 2 
A0097TLN1, TLNTalin 1TLN1_MOUSEKGTEWVDPEDPTVIAENELLGAAAAIEAAAKK 3 
A0097TLN1, TLNTalin 1TLN1_MOUSEKGTEWVDPEDPTVIAENELLGAAAAIEAAAKK 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKGTGASGSFKLNKK 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKGTGASGSFKLNKKA 2 
A6478FBP2Fructose-1,6-bisphosphatase isozyme 2F16P2_MOUSEKGTGELTQLLNSMLTAIKA 2 
A9772ARL1ADP-ribosylation factor-like protein 1ARL1_MOUSEKGTGLDEAMEWLVETLKS 2 
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorTMEDA_MOUSEKGTGRIPDQLVILDM*KH 3 
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorTMEDA_MOUSEKGTGRIPDQLVILDMKH 3 
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorTMEDA_MOUSEKGTGRIPDQLVILDMKH 2 
A8385ANXA3, ANX3Annexin A3ANXA3_MOUSEKGTGTDEDALIEILTTRS 2 
A9769API5, MIG8, AAC11Apoptosis inhibitor 5API5_MOUSEKGTLGGLFSQILQGEDIVRE 2 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKGTPLDTEVPLERV 2 
A5707ACYP2, ACYPAcylphosphatase 2, muscle type isozymeACYP2_MOUSEKGTVTGQVQGPEEKV 2 
A5707ACYP2, ACYPAcylphosphatase 2, muscle type isozymeACYP2_MOUSEKGTVTGQVQGPEEKVDAMKS 2 
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_MOUSEKGTWEKPGDAAPMGYDFWYQPRH 2 
A463CSELENBP1, SBPSelenium-binding protein 1SBP1_MOUSEKGTWEKPGDAAPMGYDFWYQPRH 3 
A0647ANXA1, ANX1, LPC1Annexin A1ANXA1_MOUSEKGVDEATIIDILTKRT 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2ANXA2_MOUSEKGVDEVTIVNILTNRS 2 
A7646CRYZCrystallin zetaQOR_MOUSEKGVDVIIEM*LANENLSNDLKL 2 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKGVEVTVGHEQEEGGKWPYAGTAEAIKA 3 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKGVEVTVGHEQEEGGKWPYAGTAEAIKA 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKGVFNSGLKGGVHLTKDPKV 2 
A5653ACAD9Acyl-CoA dehydrogenase family member 9, mitochondrial precursorACAD9_MOUSEKGVFPFPEVSQHELSEINQFVGPLEKF 3 
A468AH1F0, H1FVHistone H1.0H10_MOUSEKGVGASGSFRL 2 
A993BG3BP2Ras-GTPase-activating protein binding protein 2G3B2_MOUSEKGVGGKLPNFGFVVFDDSEPVQRI 3 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKGVGIISEGNETVEDIAARL 2 
A6497FAHD1, YISKLFumarylacetoacetate hydrolase domain containing protein 1FAHD1_MOUSEKGVGPVKENDEIEAGIDGVVSM*RF 3 
A6497FAHD1, YISKLFumarylacetoacetate hydrolase domain containing protein 1FAHD1_MOUSEKGVGPVKENDEIEAGIDGVVSMRF 3 
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitTCPE_MOUSEKGVIVDKDFSHPQM*PKK 3 
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitTCPE_MOUSEKGVIVDKDFSHPQMPKK 3 
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitTCPE_MOUSEKGVIVDKDFSHPQMPKK 2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKGVKIDKTDYMVGSYGPRA 3 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialKAD3_MOUSEKGVLETFSGTETNKIWPHVYSFLQTKV 3 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseAMPL_MOUSEKGVLFASGQNLARH 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKGVLFGVPGAFTPGCSKT 2 
A3623LGMN, PRSC1Legumain precursorLGMN_MOUSEKGVLKDYTGEDVTPENFLAVLRG 2 
A3623LGMN, PRSC1Legumain precursorLGMN_MOUSEKGVLKDYTGEDVTPENFLAVLRG 3 
A6325DHX30, DDX30, MLAA-43Putative ATP-dependent RNA helicase DHX30DHX30_MOUSEKGVLMAGLYPNLIQVRQ 2 
A400ETPD52L2, HD54Tumor protein D54TPD54_MOUSEKGVLSDFMTDVPVDPGVVHRT 3 
A207DCRIP2, CRP2Cysteine-rich protein 2CRIP2_MOUSEKGVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVRT 3 
A207DCRIP2, CRP2Cysteine-rich protein 2CRIP2_MOUSEKGVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVRT 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKGVNLPGAAVDLPAVSEKD 2 
A8627H2-K1, H2-K, H2-K1(b)H-2 class I histocompatibility antigen, K-B alpha chainHA1D_MOUSEKGVNYALAPGSQTSDLSLPDGKV 2 
A4537TRPV4, VRL2, VROACVanilloid receptor-like channel 2TRPV4_MOUSEKGVPNPIDLLESTLYESSVVPGPKK 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKGVSQAVEHINKTIAPALVSKK 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKGVTIASGGVLPNIHPELLAKK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKGVTIASGGVLPNIHPELLAKK 3 
A9532PCBP2Poly(rC)-binding protein 2PCBP2_MOUSEKGVTIPYRPKPSSSPVIFAGGQDRY 3 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKGVVDSDDLPLNVSRE 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKGVVNILPGSGSLVGQRL 2 
A8416CASTCalpain inhibitorICAL_MOUSEKGVVPEDAVETLAGSLGTRE 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKGVVPLAGTNGETTTQGLDGLSERC 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGVYLTDIM*PQGVAM*KA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGVYLTDIM*PQGVAMKA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKGVYLTDIMPQGVAMKA 2 
A7064MSRAPeptide methionine sulfoxide reductaseMSRA_MOUSEKGVYSTQVGFAGGHTRN 3 
A0098VCLVinculinVINC_MOUSEKGWLRDPNASPGDAGEQAIRQ 3 
A7646CRYZCrystallin zetaQOR_MOUSEKGWVKPVIGSEYPLEKA 2 
A7646CRYZCrystallin zetaQOR_MOUSEKGWVKPVIGSEYPLEKA 3 
A3960MYO6Unconventional myosin-VIMYO6_MOUSEKGWWYAHFDGPWIARQ 2 
A6409EHHADH, ECHDPeroxisomal bifunctional enzymeECHP_MOUSEKGWYQYDKPLGRI 2 
A028AOSTF1Osteoclast stimulating factor 1OSTF1_MOUSEKGYADIVQLLLAKG 2 
A2589RALY, HNRPCL2, P542RNA-binding protein RalyRALY_MOUSEKGYAFVQYANERH 2 
A5337FXR1Fragile X mental retardation syndrome related protein 1FXR1_MOUSEKGYATDESTVSSVQGSRS 2 
A2600RNPS1, LDC2, rnps1RNA-binding protein with serine-rich domain 1RNPS1_MOUSEKGYAYVEFENPDEAEKA 2 
A5302CSRP2, LMO5, SMLIMCysteine- and glycine-rich protein 2CSRP2_MOUSEKGYGYGQGAGTLNMDRG 2 
A1021CSRP1, CSRP, CYRPCysteine-rich protein 1CSRP1_MOUSEKGYGYGQGAGTLSTDKGESLGIKH 2 
A1021CSRP1, CSRP, CYRPCysteine-rich protein 1CSRP1_MOUSEKGYGYGQGAGTLSTDKGESLGIKH 3 
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorIPYR2_MOUSEKGYIWNYGALPQTWEDPHLRD 2 
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorIPYR2_MOUSEKGYIWNYGALPQTWEDPHLRD 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKGYLGPEQLPDCLKGCDVVVIPAGVPRK 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKGYLGPEQLPDCLKGCDVVVIPAGVPRK 3 
A6311HSD17B8, FABGL, HKE6Estradiol 17 beta-dehydrogenase 8DHB8_MOUSEKHAAFQADVSQGPAARR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKHALIIYDDLSKQ 2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKHALSAGYRH 2 
A268COSBPL3, ORP3, OSBP3Oxysterol binding protein-related protein 3OSBL3_MOUSEKHALSSALAQNTDLKERL 3 
A4146TMPO, LAP2Thymopoietin, isoform alphaLAP2B_MOUSEKHASSILPITEFSDITRR 2 
A497AHIST1H2BA, TSH2B, STBPHistone H2B, testisH2B1A_MOUSEKHAVSEGTKA 2 
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_MOUSEKHAVTEAEIQQLKRK 3 
A5965CA3Carbonic anhydrase 3CAH3_MOUSEKHDPSLQPWSASYDPGSAKT 3 
A5965CA3Carbonic anhydrase 3CAH3_MOUSEKHDPSLQPWSASYDPGSAKT 2 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKHDSGDQDISVVSEYISKM 3 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKHDSGDQDISVVSEYISKM 2 
A9680MRPS34Mitochondrial 28S ribosomal protein S34RT34_MOUSEKHEEEAFTAFTAKPEDRL 3 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4PA2G4_MOUSEKHELLQPFNVLYEKE 2 
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein AVAPA_MOUSEKHEQILVLDPPSDLKF 2 
A4710CFL2Cofilin 2COF2_MOUSEKHEWQVNGLDDIKDRS 3 
A9019RHOA, ARHA, ARH12Transforming protein RhoARHOA_MOUSEKHFCPNVPIILVGNKKD 3 
A5078PHLDB2, LL5B, LL5betaPleckstrin homology-like domain family B member 2PHLB2_MOUSEKHFEDLEFQQLEHESRL 3 
A7542PTGR1, LTB4DHProstaglandin reductase 1LTB4D_MOUSEKHFEGFPTDGNFELKT 2 
A3542CCT8, CCTQT-complex protein 1, theta subunitTCPQ_MOUSEKHFSGLEEAVYRN 3 
A3542CCT8, CCTQT-complex protein 1, theta subunitTCPQ_MOUSEKHFSGLEEAVYRN 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHFSVEGQLEFRA 2 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKHFTEFVPLRT 2 
A8956PSMC6, SUG226S protease regulatory subunit S10BPRS10_MOUSEKHGEIDYEAIVKL 2 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorGLU2B_MOUSEKHGGSPTSLGTWGSWAGPDHDKFSAMKY 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKHGGTIPVVPTAEFQDRI 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKHGGTIPVVPTAEFQDRI 3 
A150CMup1Major urinary protein 1MUP1_MOUSEKHGILRENIIDLSNANRC 3 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitTCPB_MOUSEKHGINCFINRQ 2 
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68DDX5_MOUSEKHGKAPILIATDVASRG 3 
A835DPROSCProline synthetase co-transcribed bacterial homolog proteinPROSC_MOUSEKHGLLPSETIAVVEHIKA 2 
A835DPROSCProline synthetase co-transcribed bacterial homolog proteinPROSC_MOUSEKHGLLPSETIAVVEHIKA 3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKHGRSPAQILLRW 3 
A9547RPL2160S ribosomal protein L21RL21_MOUSEKHGVVPLATYMRI 2 
A9547RPL2160S ribosomal protein L21RL21_MOUSEKHGVVPLATYMRI 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKHGVYNPNKI 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKHGVYNPNKIFGVTTLDIVRA 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKHGVYNPNKIFGVTTLDIVRA 3 
A6276DDX46Probable ATP-dependent RNA helicase DDX46DDX46_MOUSEKHGYEKPTPIQTQAIPAIMSGRD 3 
A9633RPS15A40S ribosomal protein S15aRS15A_MOUSEKHGYIGEFEIIDDHRA 3 
A9633RPS15A40S ribosomal protein S15aRS15A_MOUSEKHGYIGEFEIIDDHRA 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKHGYPLILYDVFPDVCKEFKE 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKHHAAYVNNLNATEEKY 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorSODM_MOUSEKHHAAYVNNLNATEEKYHEALAKG 3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKHHPEDVEPALRK 3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKHHPEDVEPALRKT 3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]AK1A1_MOUSEKHHPEDVEPALRKT 2 
A3965TPM1, TMSATropomyosin 1 alpha chainTPM1_MOUSEKHIAEDADRK 2 
A7519PSMA2, HC3, PSC3Proteasome subunit alpha type 2PSA2_MOUSEKHIGLVYSGM*GPDYRV 2 
A7519PSMA2, HC3, PSC3Proteasome subunit alpha type 2PSA2_MOUSEKHIGLVYSGMGPDYRV 2 
A955BENTH, CLINT1, EPN4Clathrin interactor 1EPN4_MOUSEKHIHITQATETTTTRH 3 
A4684CGI-99, CLE7UPF0568 protein C14ORF166CN166_MOUSEKHILGFDTGDAVLNEAAQILRL 3 
A1222RPL5, MSTP03060S ribosomal protein L5RL5_MOUSEKHIMGQNVADYMRY 2 
A1222RPL5, MSTP03060S ribosomal protein L5RL5_MOUSEKHIMGQNVADYMRY 3 
A3990CASKIN1Cask-interacting protein 1CSKI1_MOUSEKHKEAIGPDGEVVNRRR 2 
A9637RPS1940S ribosomal protein S19RS19_MOUSEKHKELAPYDENWFYTRA 3 
A9637RPS1940S ribosomal protein S19RS19_MOUSEKHKELAPYDENWFYTRA 2 
A3928SCFD1, STXBP1L2, FKSG23SEC1 family domain containing protein 1SCFD1_MOUSEKHKGSPFPEVAESVQQELESYRA 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKHKSDFGKFVLSSGKF 2 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorHSP47_MOUSEKHLAGLGLTEAIDKNKA 3 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorHSP47_MOUSEKHLAGLGLTEAIDKNKADLSRM 3 
A0694PACSIN2Protein kinase C and casein kinase substrate in neurons protein 2PACN2_MOUSEKHLDLSNVASYKT 2 
A8015TPMTThiopurine S-methyltransferaseTPMT_MOUSEKHLDTFLKGQSGLRV 3 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1PGAM1_MOUSEKHLEGLSEEAIMELNLPTGIPIVYELDKN 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHLEINPDHPIVETLRQ 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHLEINPDHPIVETLRQ 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHLEINPDHSIIETLRQ 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHLEINPDHSIIETLRQ 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKHLGLPVFNTVKE 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKHLGLPVFNTVKE 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKHLGLPVFNTVKEAKE 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKHLGLPVFNTVKEAKE 2 
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorATPG_MOUSEKHLIIGVSSDRG 2 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseDHPR_MOUSEKHLKEGGLLTLAGAKA 3 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseDHPR_MOUSEKHLKEGGLLTLAGAKA 2 
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorPCCB_MOUSEKHLLGDTNYAWPTAEIAVMGAKG 3 
A0779ANP32A, LANP, MAPMAcidic leucine-rich nuclear phosphoprotein 32 family member AAN32A_MOUSEKHLNLSGNKI 2 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialKAD3_MOUSEKHLSSGDLLRQNMLQGTEIGVLAKT 3 
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorPRDX3_MOUSEKHLSVNDLPVGRS 3 
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorPRDX3_MOUSEKHLSVNDLPVGRS 2 
A0235ACTR2, ARP2Actin-like protein 2ARP2_MOUSEKHLWDYTFGPEKL 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKHM*M*AFIEQEANEKA 3 
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1BPNT1_MOUSEKHM*NSAGVLAALRN 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKHMMAFIEQEANEKA 2 
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1BPNT1_MOUSEKHMNSAGVLAALRN 2 
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1BPNT1_MOUSEKHMNSAGVLAALRN 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHNDDEQYAWESSAGGSFTVRT 3 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKHNEETGDNVGPLIIKK 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKHNEETGDNVGPLIIKKK 3 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1CJ070_MOUSEKHNEETGDNVGPLIIKKK 2 
A7064MSRAPeptide methionine sulfoxide reductaseMSRA_MOUSEKHNFGPITTDIRE 2 
A7064MSRAPeptide methionine sulfoxide reductaseMSRA_MOUSEKHNFGPITTDIRE 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKHNQLPLVIEFTEQTAPKI 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKHNQLPLVIEFTEQTAPKI 3 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKHPDASVNFSEFSKKC 3 
A1668RPS1040S ribosomal protein S10RS10_MOUSEKHPELADKNVPNLHVMKA 3 
A4446CLIC4Chloride intracellular channel protein 4CLIC4_MOUSEKHPESNTAGMDIFAKF 2 
A520CSNX2, TRG9Sorting nexin 2SNX2_MOUSEKHPTLLQDPDLRQ 2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKHQAFEAELHANADRI 3 
A6483FAHFumarylacetoacetaseFAAA_MOUSEKHQHVFDETTLNNFM*GLGQAAWKE 3 
A6483FAHFumarylacetoacetaseFAAA_MOUSEKHQHVFDETTLNNFM*GLGQAAWKE 2 
A6483FAHFumarylacetoacetaseFAAA_MOUSEKHQHVFDETTLNNFMGLGQAAWKE 2 
A6483FAHFumarylacetoacetaseFAAA_MOUSEKHQHVFDETTLNNFMGLGQAAWKE 3 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKHQILEQAVEDYAETVHQLSKT 3 
A1107TWF1, PTK9Protein tyrosine kinase 9TWF1_MOUSEKHQTLQGVAFPISRD 3 
A1107TWF1, PTK9Protein tyrosine kinase 9TWF1_MOUSEKHQTLQGVAFPISRD 2 
A643CTF, PRO1400Serotransferrin precursorTRFE_MOUSEKHQTVLDNTEGKNPAEWAKN 3 
A643CTF, PRO1400Serotransferrin precursorTRFE_MOUSEKHQTVLDNTEGKNPAEWAKN 2 
A5275BANF1, BAF, BCRG1Barrier-to-autointegration factorBAF_MOUSEKHRDFVAEPMGEKPVGSLAGIGDVLSKR 3 
A4447CLIC5, MST130, MSTP130Chloride intracellular channel protein 5CLIC5_MOUSEKHRESNTAGIDIFSKF 3 
A4447CLIC5, MST130, MSTP130Chloride intracellular channel protein 5CLIC5_MOUSEKHRESNTAGIDIFSKF 2 
A8735CRYM, THBPMu-crystallin homologCRYM_MOUSEKHRGFLGVMPAYSAAEDALTTKL 2 
A9541RPL1260S ribosomal protein L12RL12_MOUSEKHSGNITFDEIVNIARQ 3 
A9541RPL1260S ribosomal protein L12RL12_MOUSEKHSGNITFDEIVNIARQ 2 
A9900EPS8L2, EPS8R2, PP13181Epidermal growth factor receptor kinase substrate 8-like protein 2ES8L2_MOUSEKHSLSSESQAPEDIAPPGSSPHANRG 3 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitETFB_MOUSEKHSM*NPFCEIAVEEAVRL 2 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKHSQAVEELADQLEQTKRV 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHSQFIGYPITLFVEKE 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHSQFIGYPITLFVEKE 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHSQFIGYPITLFVEKERD 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKHSQFIGYPITLFVEKERD 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHSQFIGYPITLYLEKE 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHSQFIGYPITLYLEKE 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHSQFIGYPITLYLEKERE 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKHSQFIGYPITLYLEKERE 2 
A597AILF3, DRBF, MPHOSPH4Interleukin enhancer-binding factor 3ILF3_MOUSEKHSSVYPTQEELEAVQNMVSHTERA 3 
A7040MMABCob(I)alamin adenosyltransferase, mitochondrial precursorMMAB_MOUSEKHTAFQEGPVLELERW 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase APPIA_MOUSEKHTGPGILSMANAGPNTNGSQFFICTAKT 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase APPIA_MOUSEKHTGPGILSMANAGPNTNGSQFFICTAKT 3 
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HHNRH1_MOUSEKHTGPNSPDTANDGFVRL 3 
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorIPYR2_MOUSEKHVAGHYISPFHDIPLKA 3 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKHVESIGDPEHISRN 3 
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3XDDX3X_MOUSEKHVINFDLPSDIEEYVHRI 3 
A6934LYPLAL1Lysophospholipase-like 1LYPL1_MOUSEKHVLNQDLTFQHIKI 3 
A6213CRYL1, CRYLambda-crystallin homologCRYL1_MOUSEKHVLSTFGPVPEFSGATVERV 3 
A6213CRYL1, CRYLambda-crystallin homologCRYL1_MOUSEKHVLSTFGPVPEFSGATVERV 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKHVNGQDQIVPGLYACGEAACASVHGANRL 3 
A0089CTNNA1Alpha-1 cateninCTN1_MOUSEKHVNPVQALSEFKA 2 
A514BLRRC8D, LRRC5, UNQ213/PRO239Leucine-rich repeat-containing 8 family, member DLRC8D_MOUSEKHVSTSSDEGSPSASTPMINKT 3 
A8077TXNDC17, TXNL5Thioredoxin domain-containing protein 17TXNL5_MOUSEKHVTEDCVFIYCQVGDKPYWKDPNNDFRQ 3 
A7149MME, EPNNeprilysinNEP_MOUSEKHVVEDLIAQIRE 2 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorODO1_MOUSEKHWLDSPWPGFFTLDGQPRS 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_MOUSEKHWPFM*VVNDAGRPKV 3 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_MOUSEKHWPFM*VVNDAGRPKV 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_MOUSEKHWPFMVVNDAGRPKV 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_MOUSEKHWPFMVVNDAGRPKV 3 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HS70A_MOUSEKHWPFQVVNDGDKPKV 3 
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorPPIB_MOUSEKHYGPGWVSMANAGKD 2 
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorPPIB_MOUSEKHYGPGWVSMANAGKD 3 
A2188SMARCE1, BAF57SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily E, member 1SMCE1_MOUSEKIAAEIAQAEEQARK 2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKIAALQAFADQLIAVDHYAKG 3 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKIAALQAFADQLIAVDHYAKG 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorENPL_MOUSEKIADEKYNDTFWKEFGTNIKL 3 
A0452CANXCalnexin precursorCALX_MOUSEKIADPDAVKPDDWDEDAPSKI 3 
A5318DRG1, NEDD3Developmentally regulated GTP-binding protein 1DRG1_MOUSEKIAEIEAEMART 2 
A9636RPS18, D6S218E40S ribosomal protein S18RS18_MOUSEKIAFAITAIKG 2 
A5763ALDH3A2, ALDH10, FALDHFatty aldehyde dehydrogenaseAL3A2_MOUSEKIAFGGEMDEATRY 2 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKIAGAGLLFVGGGIGGTILYAKW 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKIAGNMGLAMKL 2 
A9635RPS17, RPS17L40S ribosomal protein S17RS17_MOUSEKIAGYVTHLMKR 2 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKIAILDIEPQTLKT 2 
A5796ENPEPGlutamyl aminopeptidaseAMPE_MOUSEKIAIPDFGTGAMENWGLVTYRE 2 
A0819RDXRadixinRADI_MOUSEKIALLEEAKK 2 
A0326VIL2, EZREzrinEZRI_MOUSEKIALLEEARR 2 
A0464BAG1, HBAG-1, HAPBAG family molecular chaperone regulator 1BAG1_MOUSEKIANHLQELNKELSGIQQGFLAKE 3 
A0326VIL2, EZREzrinEZRI_MOUSEKIAQDLEMYGINYFEIKN 2 
A0808MSNMoesinMOES_MOUSEKIAQDLEMYGVNYFSIKN 2 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKIAQLEEQLDNETKE 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorAT5F1_MOUSEKIAQLEEVKQSSMKQ 3 
A256ERPRD1B, CREPTRegulation of nuclear pre-mRNA domain containing 1BCT077_MOUSEKIASLPQEVQDVSLLEKI 2 
A9850COPS4, CSN4COP9 signalosome complex subunit 4CSN4_MOUSEKIASQMITEGRM 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKIASTLKDNDPPIAVAKI 3 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKIASTLKDNDPPIAVAKI 2 
A8960PSMC2, MSS126S protease regulatory subunit 7PRS7_MOUSEKIATEKDFLEAVNKVIKS 3 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKIDATSASM*LASKF 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKIDATSASMLASKF 2 
A8694CALUCalumenin precursorCALU_MOUSEKIDDDKDGFVTVDELKG 2 
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KHNRPK_MOUSEKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ 3 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKIDGASPLDKVCLIGCGFSTGYGSAVKV 2 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKIDGASPLDKVCLIGCGFSTGYGSAVKV 3 
A4202RAD23BUV excision repair protein RAD23 homolog BRD23B_MOUSEKIDIDPEETVKA 2 
A6552ABAT, GABAT4-aminobutyrate aminotransferase, mitochondrial precursorGABT_MOUSEKIDIPSFDWPIAPFPRL 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKIDKLMIEMDGTENKS 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKIDKLMIEMDGTENKS 2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKIDKTDYM*VGSYGPRA 2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKIDKTDYM*VGSYGPRA 3 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKIDKTDYMVGSYGPRA 3 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKIDKTDYMVGSYGPRA 2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GDIR_MOUSEKIDKTDYMVGSYGPRA 1 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKIDNSQVESGSLEDDWDFLPPKK 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKIDNSQVESGSLEDDWDFLPPKKI 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKIDNSQVESGSLEDDWDFLPPKKI 3 
A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chainADHX_MOUSEKIDPSAPLDKVCLLGCGISTGYGAAVNTAKV 3 
A3971OPA1Optic atrophy 1 gene proteinOPA1_MOUSEKIDQLQEELLHTQLKY 3 
A3971OPA1Optic atrophy 1 gene proteinOPA1_MOUSEKIDQLQEELLHTQLKY 2 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1ROA2_MOUSEKIDTIEIITDRQ 2 
A0211RAB3IP, RABIN8, HRABIN3ARAB3A-interacting proteinRAB3I_MOUSEKIDVLQAEVAALKT 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIDVSVEAASGGKA 2 
A4201RAD23AUV excision repair protein RAD23 homolog ARD23A_MOUSEKIEAEKGRDAFPVAGQKL 3 
A9654RPS940S ribosomal protein S9RS9_MOUSEKIEDFLERR 2 
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitNACAM_MOUSEKIEDLSQQAQLAAAEKF 2 
A4447CLIC5, MST130, MSTP130Chloride intracellular channel protein 5CLIC5_MOUSEKIEEFLEETLTPEKYPKL 2 
A9572RPL3860S ribosomal protein L38RL38_MOUSEKIEEIKDFLLTARR 2 
A2037CHD4Chromodomain-helicase-DNA-binding protein 4CHD4_MOUSEKIEENSLKEEESTEGEKEVKS 3 
A218CNDUFS5NADH dehydrogenase [ubiquinone] iron-sulfur protein 5NIPM_MOUSEKIEFDDFEECLLRY 2 
A7094MYLK, MLCK, MLCK1Myosin light chain kinase, smooth muscleMYLK_MOUSEKIEGYPDPEVVWFKD 2 
A7094MYLK, MLCK, MLCK1Myosin light chain kinase, smooth muscleMYLK_MOUSEKIEGYPDPEVVWFKDDQSIRE 2 
A1379HMGB2, HMG2High mobility group protein B2HMGB2_MOUSEKIEHPGLSIGDTAKK 3 
A7470ACP1Red cell acid phosphatase 1, isozyme F/SPPAC_MOUSEKIELLGSYDPQKQ 2 
A2330EEA1, ZFYVE2Early endosome antigen 1EEA1_MOUSEKIELNSVKGEVSQAQNTLKQ 3 
A7554GART, PGFT, PRGSTrifunctional purine biosynthetic protein adenosine-3PUR2_MOUSEKIELVVVGPEAPLAAGIVGDLTSAGVRC 2 
A3969DCTN4Dynactin 4DCTN4_MOUSEKIEPAQAVAEVEPLPEDYYTRPVNLTEVTTLQQRL 3 
A0653MAPRE1Microtubule-associated protein RP/EB family member 1MARE1_MOUSEKIEQLCSGAAYCQFMDMLFPGSIALKKV 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKIESDAQEPAEPEDDLDIM*LGNKK 2 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKIESDAQEPAEPEDDLDIMLGNKK 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKIETELRDICNDVLSLLEKF 2 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKIETIEVMEDRQ 2 
A286CPITPNBPhosphatidylinositol transfer protein betaPIPNB_MOUSEKIETWHKPDLGTLENVHGLDPNTWKT 3 
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1ROA1_MOUSEKIEVIEIMTDRG 2 
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 1HS105_MOUSEKIEVPLHSLMAQTQLKA 3 
A6688HAO2, HAOX2, GIG16Hydroxyacid oxidase 2HAOX2_MOUSEKIEVYM*DGGVRT 2 
A6688HAO2, HAOX2, GIG16Hydroxyacid oxidase 2HAOX2_MOUSEKIEVYMDGGVRT 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKIEWLESHQDADIEDFKA 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKIEWLESHQDADIEDFKA 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKIEWLESHQDADIEDFKAKK 3 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorIDH3A_MOUSEKIFDAAKAPIQWEERN 2 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorIDH3A_MOUSEKIFDAAKAPIQWEERN 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKIFDIDEAEEAIKDVKI 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKIFDIDEAEEAIKDVKI 2 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorPDIA6_MOUSEKIFGANKNKPEDYQGGRT 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKIFGVTTLDIVRA 1 
A3696MDH2Malate dehydrogenase, mitochondrial precursorMDHM_MOUSEKIFGVTTLDIVRA 2 
A652CTXNL1, TRP32, TXLThioredoxin-like protein 1TXNL1_MOUSEKIFINLPRS 2 
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5UBP5_MOUSEKIFQNAPTDPTQDFSTQVAKL 2 
A459ENICE-4, UBAP2L, NICE4Ubiquitin associated protein 2-likeUBP2L_MOUSEKIFTASNVSSVPLPAENVTITAGQRI 2 
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1ROA1_MOUSEKIFVGGIKEDTEEHHLRD 3 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1ROA2_MOUSEKIFVGGIKEDTEEHHLRD 3 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKIFVGGIKEDTEEYNLRD 2 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKIFVGGIKEDTEEYNLRD 3 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKIFVGGIKEDTEEYNLRDYFEKY 3 
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/BROAA_MOUSEKIFVGGLNPEATEEKI 2 
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D0HNRPD_MOUSEKIFVGGLSPDTPEEKI 2 
A512CSNX1Sorting nexin 1SNX1_MOUSEKIGDGMNAYVAYKV 2 
A1258CRKLv-CRK sarcoma virus CT10 oncogene homolog (avian)-likeCRKL_MOUSEKIGDQEFDHLPALLEFYKI 3 
A7121CYB5R3, DIA1, B5RDiaphoraseNCB5R_MOUSEKIGDTIEFRG 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKIGEHTPSALAIM*ENANVLARY 3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKIGEHTPSALAIMENANVLARY 3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_MOUSEKIGEHTPSALAIMENANVLARY 2 
A7904SUOXSulfite oxidase, mitochondrial precursorSUOX_MOUSEKIGELNPEDSMSPSVEASDPYADDPIRH 2 
A313ESH3BGRLSH3 domain-binding glutamic acid-rich-like proteinSH3L1_MOUSEKIGFEEKDIAANEENRKW 3 
A0326VIL2, EZREzrinEZRI_MOUSEKIGFPWSEIRN 2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKIGFTGSTEVGKH 2 
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_MOUSEKIGGHGAEYGAEALERM 3 
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_MOUSEKIGGHGAEYGAEALERM 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKIGGIFAFKV 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKIGGIGTVPVGRV 2 
A0131INADL, PATJ, HINADLINAD-like proteinINADL_MOUSEKIGGTNVQGMTSEQVAQVLRN 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKIGIEIIKRA 2 
A7070MTAP, MSAP, mtapS-methyl-5-thioadenosine phosphorylaseMTAP_MOUSEKIGIIGGTGLDDPEILEGRT 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKIGIMPGHIHKKG 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIGKFPFAANSRA 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIGKFPFAANSRA 2 
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11NDUAB_MOUSEKIGKLEGWELFPTPKV 2 
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11NDUAB_MOUSEKIGKLEGWELFPTPKV 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_MOUSEKIGLFGGAGVGKT 2 
A8191VPS29, DC7, DC15Vacuolar protein sorting 29VPS29_MOUSEKIGLIHGHQVIPWGDMASLALLQRQ 3 
A5964CA2Carbonic anhydrase 2CAH2_MOUSEKIGPASQGLQKV 2 
A1308BLMHBleomycin hydrolaseBLMH_MOUSEKIGPITPLQFYKE 2 
A3816RPS340S ribosomal protein S3RS3_MOUSEKIGPKKPLPDHVSIVEPKD 3 
A3816RPS340S ribosomal protein S3RS3_MOUSEKIGPKKPLPDHVSIVEPKD 2 
A9541RPL1260S ribosomal protein L12RL12_MOUSEKIGPLGLSPKK 2 
A3961MYH10, SmembMyosin-10MYH10_MOUSEKIGQLEEQLEQEAKE 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14RS14_MOUSEKIGRIEDVTPIPSDSTRR 3 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14RS14_MOUSEKIGRIEDVTPIPSDSTRR 2 
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorACDSB_MOUSEKIGTIYEGASNIQLNTIAKH 2 
A1320SNAP29Synaptosomal-associated protein 29SNP29_MOUSEKIGVASSEELVRQ 2 
A7445PMM2Phosphomannomutase 2PMM2_MOUSEKIGVVGGSDFEKLQEQLGNDVVEKY 3 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKIGYNPDTVAFVPISGWNGDNM*LEPSANMPWFKG 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKIGYNPDTVAFVPISGWNGDNMLEPSANM*PWFKG 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKG 3 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKG 2 
A6718HERC2, KLF13E3 ubiquitin-protein ligase HERC2HERC2_MOUSEKIHGLILLGRIRA 2 
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GIIF4G1_MOUSEKIHNAENIQPGEQKYEYKS 3 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1PHP14_MOUSEKIHVYGYSMGYGRA 2 
A1258CRKLv-CRK sarcoma virus CT10 oncogene homolog (avian)-likeCRKL_MOUSEKIHYLDTTTLIEPAPRY 2 
A0240CRKAdapter molecule CRKCRK_MOUSEKIHYLDTTTLIEPVARS 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKIIAEGANGPTTPEADKI 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKIIAEGANGPTTPEADKIFLERN 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKIIAEGANGPTTPEADKIFLERN 2 
A6805PPA2, HSPC124, SID6-306Inorganic pyrophosphatase 2, mitochondrial precursorIPYR2_MOUSEKIIAINVNDPEAEKFHDIDDVKKF 3 
A5621NT5E, NT5, NTE5'-nucleotidase precursor5NTD_MOUSEKIIALGHSGFEMDKLIAQKV 3 
A7223OATOrnithine aminotransferase, mitochondrial precursorOAT_MOUSEKIIDAM*KSQVDKL 2 
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorMCCA_MOUSEKIIEEAPAPGINPEVRR 2 
A4363PFDN2, PFD2, HSPC231Prefoldin subunit 2PFD2_MOUSEKIIETLSQQLQAKG 2 
A1370CBX5, HP1AChromobox protein homolog 5CBX5_MOUSEKIIGATDSCGDLMFLMKW 2 
A887APTRF, FKSG13Polymerase I and transcript release factorPTRF_MOUSEKIIGAVDQIQLTQAQLEERQ 2 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorPDCD8_MOUSEKIIKDGEQHEDLNEVAKL 3 
A8161UGT2B17UDP-glucuronosyltransferase 2B17 precursor, microsomalUDB5_MOUSEKIILDELVQRG 2 
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KHNRPK_MOUSEKIILDLISESPIKGRA 2 
A1215GANAB, G2ANNeutral alpha-glucosidase ABGANAB_MOUSEKIILTAQPFRLDLLEDRS 3 
A8960PSMC2, MSS126S protease regulatory subunit 7PRS7_MOUSEKIINADSEDPKYIINVKQ 2 
A9988MANF, ARMET, ARPMesencephalic astrocyte-derived neurotrophic factorARMET_MOUSEKIINEVSKPLAHHIPVEKI 3 
A2002STX8Syntaxin 8STX8_MOUSEKIIQEQDAGLDALSSIISRQ 2 
A5939BPNT1, PIP3'(2'),5'-Bisphosphate nucleotidase 1BPNT1_MOUSEKIIQLIEGKA 2 
A3807RPLP060S acidic ribosomal protein P0RLA0_MOUSEKIIQLLDDYPKC 2 
A0015DLG1, SAP97Disks large homolog 1DLG1_MOUSEKIITGGAAAQDGRL 2 
A6497FAHD1, YISKLFumarylacetoacetate hydrolase domain containing protein 1FAHD1_MOUSEKIITLEEGDLILTGTPKG 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3GBLP_MOUSEKIIVDELKQEVISTSSKA 3 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3GBLP_MOUSEKIIVDELKQEVISTSSKA 2 
A041BRBM17, SPF45Splicing factor 45SPF45_MOUSEKIIVGDATEKGEAQDASKK 2 
A7263PAFAH1B2, PAFAHBPlatelet-activating factor acetylhydrolase IB beta subunitPA1B2_MOUSEKIIVLGLLPRG 2 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKIKADYAQLLEDM*QNAFRS 3 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKIKADYAQLLEDMQNAFRS 3 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA1_MOUSEKIKADYAQLLEDMQNAFRS 2 
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_MOUSEKIKAVPQLQGYLRS 3 
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_MOUSEKIKAVPQLQGYLRS 2 
A0779ANP32A, LANP, MAPMAcidic leucine-rich nuclear phosphoprotein 32 family member AAN32A_MOUSEKIKDLSTIEPLKK 3 
A8654ANP32EAcidic (leucine-rich) nuclear phosphoprotein 32 family member EAN32E_MOUSEKIKDLSTVEALQNLKN 3 
A8654ANP32EAcidic (leucine-rich) nuclear phosphoprotein 32 family member EAN32E_MOUSEKIKDLSTVEALQNLKN 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKIKDPDAAKPEDWDERA 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKIKDPDAAKPEDWDERA 3 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKIKGEHPGLSIGDVAKK 3 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKIKGEHPGLSIGDVAKK 2 
A3985AHCYL2S-Adenosylhomocysteine hydrolase-like 2SAHH3_MOUSEKIKGIVEESVTGVHRL 3 
A1379HMGB2, HMG2High mobility group protein B2HMGB2_MOUSEKIKIEHPGLSIGDTAKK 3 
A1379HMGB2, HMG2High mobility group protein B2HMGB2_MOUSEKIKIEHPGLSIGDTAKKL 3 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKIKNEVDSTLTFRR 2 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKIKNEVDSTLTFRR 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLM*SQEVPEDWDKQ 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLM*SQEVPEDWDKQPVKV 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLMSQEVPEDWDKQ 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLMSQEVPEDWDKQ 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLMSQEVPEDWDKQPVKV 3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorPDIA1_MOUSEKIKPHLMSQEVPEDWDKQPVKV 2 
A6962ME1NADP-dependent malic enzymeMAOX_MOUSEKIKPTALIGVAAIGGAFTEQILKD 3 
A652CTXNL1, TRP32, TXLThioredoxin-like protein 1TXNL1_MOUSEKIKQHLENDPGSNEDADIPKG 3 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chain4F2_MOUSEKIKVAEDETEAGVKF 3 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKIKVSNTLESRL 2 
A6940DMGDHDimethylglycine dehydrogenase, mitochondrialM2GD_MOUSEKILAGLYNPGDGHIDPYSLTM*ALAAGARK 3 
A6940DMGDHDimethylglycine dehydrogenase, mitochondrialM2GD_MOUSEKILAGLYNPGDGHIDPYSLTMALAAGARK 3 
A7989TKT, TKT1TransketolaseTKT_MOUSEKILATPPQEDAPSVDIANIRM 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKILDQGEDFPASEM*ARI 2 
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_MOUSEKILDQGEDFPASEMARI 2 
A4711COL15A1Collagen alpha 1(XV) chain precursorCOFA1_MOUSEKILDQKAYSCANRLIVLCIENSFMTDTRK 3 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKILDSVGIEADDDRL 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKILDSVGIEADDDRLNKV 3 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKILDSVGIEADDDRLNKV 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKILDSVGIEADDDRLNKVISELNGKN 3 
A6094COQ3, UG0215E05Hexaprenyldihydroxybenzoate methyltransferase, mitochondrialCOQ3_MOUSEKILDVGCGGGLLTEPLGRL 2 
A0464BAG1, HBAG-1, HAPBAG family molecular chaperone regulator 1BAG1_MOUSEKILEEIDTMVLPEQFKD 2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitTCPB_MOUSEKILIANTGMDTDKIKI 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKILIRPLYSNPPLNGARI 3 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKILIRPLYSNPPLNGARI 2 
A0850VIMVimentinVIME_MOUSEKILLAELEQLKG 2 
A0850VIMVimentinVIME_MOUSEKILLAELEQLKGQGKS 2 
A6551GPIGlucose-6-phosphate isomeraseG6PI_MOUSEKILLANFLAQTEALM*KG 2 
A6551GPIGlucose-6-phosphate isomeraseG6PI_MOUSEKILLANFLAQTEALMKG 2 
A6009CBR1, CBR, CRNCarbonyl reductase [NADPH] 1DHCA_MOUSEKILLNACCPGWVRT 2 
A5777ALG5, HSPC149Dolichyl-phosphate beta-glucosyltransferaseALG5_MOUSEKILM*ADADGATKFPDVEKLEKG 3 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorPDCD8_MOUSEKILPQYLSNWTM*EKV 2 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorPDCD8_MOUSEKILPQYLSNWTMEKV 2 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorNUAM_MOUSEKILQDIASGRH 2 
A566DIWS1, IWS1LProtein IWS1 homologIWS1_MOUSEKILQELPSVSQETLKH 2 
A6575GCNT1, NACGT2Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferaseGCNT1_MOUSEKILQGDPEEIQKV 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAM*LGDFVNM*VEKG 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAM*LGDFVNM*VEKG 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAM*LGDFVNMVEKG 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAM*LGDFVNMVEKG 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAMLGDFVNM*VEKG 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAMLGDFVNM*VEKG 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAMLGDFVNMVEKG 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKILQSSSEVGYDAMLGDFVNMVEKG 2 
A1971GSTZ1, MAAIGlutathione S-transferase zeta 1MAAI_MOUSEKILQSTAGKYCVGDEVSM*ADVCLVPQVANAERF 3 
A1971GSTZ1, MAAIGlutathione S-transferase zeta 1MAAI_MOUSEKILQSTAGKYCVGDEVSMADVCLVPQVANAERF 3 
A4202RAD23BUV excision repair protein RAD23 homolog BRD23B_MOUSEKILSDDTALKEYKI 2 
A5632AADAT, KAT2L-kynurenine/alpha-aminoadipate aminotransferase, mitochondrial precursorAADAT_MOUSEKILSQWKPEDSKDPTKK 3 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKILSSDDYGKDLTSVMRL 2 
A3205TPM3Tropomyosin alpha 3 chainTPM3_MOUSEKILTDKLKEAETRA 3 
A9544RPL1860S ribosomal protein L18RL18_MOUSEKILTFDQLALESPKG 2 
A9544RPL1860S ribosomal protein L18RL18_MOUSEKILTFDQLALESPKGRG 2 
A8165GDH, ugd, UGDHUDP-glucose 6-dehydrogenaseUGDH_MOUSEKILTTNTWSSELSKL 2 
A8023TREH, TREATrehalase precursorTREA_MOUSEKILTYQYGIPTSLRN 2 
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6MYL6_MOUSEKILYSQCGDVM*RA 2 
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6MYL6_MOUSEKILYSQCGDVMRA 2 
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorSQRD_MOUSEKIM*YLSEAYFRK 2 
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorPCCB_MOUSEKIMDQAITVGAPVIGLNDSGGARI 2 
A3714HSD11B1, HSD11, HSD11LCorticosteroid 11-beta-dehydrogenase, isozyme 1DHI1_MOUSEKIMEFFSLRY 2 
A5615HAAO3-hydroxyanthranilate 3,4-dioxygenase3HAO_MOUSEKIMFVGGPNTRK 2 
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursorCC47_MOUSEKIMQEEGQPLKLPDTKR 2 
A346BCCDC47, GK001, MSTP041Coiled-coil domain-containing protein 47 precursorCC47_MOUSEKIMQEEGQPLKLPDTKRT 2 
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorSQRD_MOUSEKIMYLSEAYFRK 2 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKINEAFDLLRS 2 
A554AHNRPUL1, HNRNPUL1, E1BAP5Heterogeneous nuclear ribonucleoprotein U-like protein 1HNRL1_MOUSEKINEEISVKH 2 
A364AEDF1, EDF-1EDF-1 proteinEDF1_MOUSEKINEKPQVIADYESGRA 3 
A364AEDF1, EDF-1EDF-1 proteinEDF1_MOUSEKINEKPQVIADYESGRA 2 
A1107TWF1, PTK9Protein tyrosine kinase 9TWF1_MOUSEKINEVQTDVSVDTKH 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorSUCB2_MOUSEKINFDDNAEFRQ 2 
A3700PECR, PRO1004Peroxisomal trans 2-enoyl CoA reductasePECR_MOUSEKINFLVNNGGGQFM*APVEDITAKG 2 
A1881TJP2, X104, ZO2Tight junction protein ZO-2ZO2_MOUSEKINGTVTENM*SLTDARK 2 
A0086TJP1, ZO1Tight junction protein ZO-1ZO1_MOUSEKINGTVTENMSLTDAKT 2 
A1881TJP2, X104, ZO2Tight junction protein ZO-2ZO2_MOUSEKINGTVTENMSLTDARK 2 
A1264KIF17, KIF3XKinesin-like protein KIF17KIF17_MOUSEKINLSLSALGNVISALVDGRC 3 
A1250UBE2V2, MMS2, UEV2Enterocyte differentiation promoting factorUB2V2_MOUSEKINM*NGINNSSGM*VDARS 2 
A7375PGM1Phosphoglucomutase 1PGM1_MOUSEKINQDPQVM*LAPLISIALKV 2 
A7375PGM1Phosphoglucomutase 1PGM1_MOUSEKINQDPQVMLAPLISIALKV 2 
A0323RAP1A, KREV1Ras-related protein Rap-1ARAP1A_MOUSEKINVNEIFYDLVRQ 3 
A0323RAP1A, KREV1Ras-related protein Rap-1ARAP1A_MOUSEKINVNEIFYDLVRQ 1 
A0323RAP1A, KREV1Ras-related protein Rap-1ARAP1A_MOUSEKINVNEIFYDLVRQ 2 
A7233OLA1, GTPBP9, PTD004OBG-like ATPase 1PTD4_MOUSEKIPAFLNVVDIAGLVKG 2 
A9636RPS18, D6S218E40S ribosomal protein S18RS18_MOUSEKIPDWFLNRQ 2 
A6997MEP1AMeprin A alpha-subunit precursorMEP1A_MOUSEKIPEFNTIIGQLPDFSAIDLIRL 3 
A6997MEP1AMeprin A alpha-subunit precursorMEP1A_MOUSEKIPEFNTIIGQLPDFSAIDLIRL 2 
A556DIFI35, IFP35Interferon-induced 35 kDa proteinIN35_MOUSEKIPFSVPEVPLVFQGQTKQ 2 
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorMCCA_MOUSEKIPLSQEEIPLQGHAFEARI 3 
A3485SLC4A4, NBC, NBC1Solute carrier family 4, sodium bicarbonate cotransporter, member 4S4A4_MOUSEKIPMDIMEQQPFLSDNKPLDRE 3 
A3485SLC4A4, NBC, NBC1Solute carrier family 4, sodium bicarbonate cotransporter, member 4S4A4_MOUSEKIPMDIMEQQPFLSDNKPLDRERS 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIPNIYAIGDVVAGPM*LAHKA 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIPNIYAIGDVVAGPM*LAHKA 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIPNIYAIGDVVAGPMLAHKA 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKIPNIYAIGDVVAGPMLAHKA 2 
A0452CANXCalnexin precursorCALX_MOUSEKIPNPDFFEDLEPFKM 2 
A4744DAG1Dystroglycan precursorDAG1_MOUSEKIPSDTFYDNEDTTTDKLKL 3 
A4744DAG1Dystroglycan precursorDAG1_MOUSEKIPSDTFYDNEDTTTDKLKL 2 
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitNDUB7_MOUSEKIPSFPPDLGFPERKE 3 
A281CPEX14Peroxisomal membrane protein PEX14PEX14_MOUSEKIPSWQIPVKS 2 
A0387ATP5H, My032ATP synthase D chain, mitochondrialATP5H_MOUSEKIPVPEDKYTALVDQEEKE 3 
A0387ATP5H, My032ATP synthase D chain, mitochondrialATP5H_MOUSEKIPVPEDKYTALVDQEEKEDVKS 3 
A4814FLNB, FLN3, TAPFilamin-BFLNB_MOUSEKIPYLPITNFNQNWQDGKA 2 
A6629GNPDA1, GNPI, HLNGlucosamine-6-phosphate isomeraseGNPI_MOUSEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRT 3 
A2330EEA1, ZFYVE2Early endosome antigen 1EEA1_MOUSEKIQAGEGETAVLNQLQEKN 2 
A5224TPM4Tropomyosin alpha 4 chainTPM4_MOUSEKIQALQQQADDAEDRA 2 
A7040MMABCob(I)alamin adenosyltransferase, mitochondrial precursorMMAB_MOUSEKIQCMLQDVGSALATPRS 2 
A8959PSMC4, MIP224, TBP726S protease regulatory subunit 6BPRS6B_MOUSEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRY 3 
A0933NR3C1, GRLGlucocorticoid receptorGCR_MOUSEKIQDTGDTILSSPSSVALPQVKT 2 
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorRM12_MOUSEKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQ 2 
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorRM12_MOUSEKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKE 3 
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorRM12_MOUSEKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKERT 3 
A0363RAB2A, RAB2Ras-related protein Rab-2ARAB2A_MOUSEKIQEGVFDINNEANGIKI 2 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKIQEYNVLLDTLSRA 2 
A1711LRPAP1, A2MRAPAlpha-2-macroglobulin receptor-associated protein precursorAMRP_MOUSEKIQEYNVLLDTLSRA 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEM*QGDEM*TRI 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEM*QGDEM*TRI 2 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEM*QGDEMTRI 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEMQGDEM*TRI 2 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEMQGDEM*TRI 3 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIDHC_MOUSEKIQGGSVVEMQGDEMTRI 2 
A681CHDLBP, HBP, VGLVigilinVIGLN_MOUSEKIQIPRPDDPSNQIKI 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKIQLINNMLDKV 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKIQM*SNLMNQARL 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKIQMSNLM*NQARL 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKIQMSNLMNQARL 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKIQMSNLMNQARL 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKIQQLVKEFFNGKEPSRG 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKIQQLVKEFFNGKEPSRG 3 
A1490ITGAV, MSK8, VNRAIntegrin alpha-V precursorITAV_MOUSEKIQSSNSFDNVSPVVSYKV 2 
A639ALGALS3, MAC2, GALIGGalectin-3LEG3_MOUSEKIQVLVEADHFKV 3 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKIRELETQISELQEDLESERA 3 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKIRETGERPSNEEIMRF 3 
A2542HNRNPAB, HNRPAB, ABBP1Heterogeneous nuclear ribonucleoprotein A/BROAA_MOUSEKIREYFGQFGEIEAIELPIDPKL 3 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitETFB_MOUSEKIRVKPDKSGVVTDGVKH 3 
A5705HCBP1, ACY3, ASPA2Aspartoacylase 2ACY3_MOUSEKIRVTVPALLRL 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKIRYESLTDPSKL 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKIRYESLTDPSKLDSGKE 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKISALQSAGVVVSM*SPAQLGTTIYKE 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKISALQSAGVVVSM*SPAQLGTTIYKEFEKR 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKISALQSAGVVVSMSPAQLGTTIYKEFEKR 3 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorSUCA_MOUSEKISALQSAGVVVSMSPAQLGTTIYKEFEKR 2 
A5108RAI14, NORPEGAnkycorbinRAI14_MOUSEKISALTGHLANKEAEVAKL 3 
A0755PEA15Astrocytic phosphoprotein PEA-15PEA15_MOUSEKISEEEELDTKL 2 
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3CES3_MOUSEKISENM*IPVVAEKY 2 
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3CES3_MOUSEKISENMIPVVAEKY 2 
A070CKIF5A, NKHC1Neuronal kinesin heavy chainKIF5A_MOUSEKISFLENNLEQLTKV 2 
A7869ALDH5A1, SSADHSuccinate semialdehyde dehydrogenase, mitochondrial precursorSSDH_MOUSEKISFTGSTATGKI 2 
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1AL9A1_MOUSEKISFTGSVPTGVKI 2 
A267ACAND1, TIP120, TIP120ACullin-associated NEDD8-dissociated protein 1CAND1_MOUSEKISGSILNELIGLVRS 2 
A8738CACYBP, S100A6BP, SIPCalcyclin binding proteinCYBP_MOUSEKISNYGWDQSDKFVKI 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKISQLYGDLKH 2 
A3823RPS840S ribosomal protein S8RS8_MOUSEKISSLLEEQFQQGKL 3 
A3823RPS840S ribosomal protein S8RS8_MOUSEKISSLLEEQFQQGKL 1 
A3823RPS840S ribosomal protein S8RS8_MOUSEKISSLLEEQFQQGKL 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKISSVQSIVPALEIANAHRK 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKISSVQSIVPALEIANAHRK 3 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKISSVSEVM*KDSKLPVAQSQKT 3 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKISSVSEVMKDSKLPVAQSQKT 3 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinIMMT_MOUSEKISSVSEVMKDSKLPVAQSQKT 2 
A5086LCP1, PLS2Plastin-2PLSL_MOUSEKISTSLPVLDLIDAIQPGSINYDLLKT 2 
A1093CD47, MER6Leukocyte surface antigen CD47 precursorCD47_MOUSEKISVSDLINGIASLKM 2 
A4756DSG2, CDHF5Desmoglein 2 precursorDSG2_MOUSEKITATDADDPETLNAKV 2 
A623CTMED10, TMP21Transmembrane EMP24 domain-containing protein 10 precursorTMEDA_MOUSEKITDSAGHILYAKEDATKG 3 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKITEEPM*GITLKL 2 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKITEEPMGITLKL 2 
A4236SURF-1, SURF1Surfeit locus protein 1SURF1_MOUSEKITGADPIFIDADFHSTAPGGPIGGQTRV 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKITGKNQVTATKADGSTQVIDTKN 3 
A154ATINAGL1, GIS5, LCN7Tubulointerstitial nephritis antigen-related protein precursorTINAL_MOUSEKITGWGEETLPDGRT 2 
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorNUMM_MOUSEKITHTGQVYDEKDYRRV 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_MOUSEKITKFENAFLSHVISQHQSLLGNIRS 3 
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GIIF4G1_MOUSEKITKPGSIDSNNQLFAPGGRL 3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_MOUSEKITLPVDFVTADKFDENAKT 2 
A668AMATR3Matrin 3MATR3_MOUSEKITPENLPQILLQLKR 2 
A3940STX7Syntaxin 7STX7_MOUSEKITQCSVEIQRT 2 
A7767SLC27A2, ACSVL1, FACVL1Very long-chain acyl-CoA synthetaseS27A2_MOUSEKITQLTPFIGYAGGKT 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKITSEELHYFVQNHFTSARM 3 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialUQCR2_MOUSEKITSEELHYFVQNHFTSARM 2 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKITSLAQLNAANHDAAIFPGGFGAAKN 3 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKITSLAQLNAANHDAAIFPGGFGAAKN 2 
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicHYES_MOUSEKITTEEEIEFYIQQFKK 2 
A9548RPL22, RPL22L260S ribosomal protein L22RL22_MOUSEKITVTSEVPFSKRY 2 
A0369LDHBL-lactate dehydrogenase B chainLDHB_MOUSEKIVADKDYSVTANSKI 2 
A0369LDHBL-lactate dehydrogenase B chainLDHB_MOUSEKIVADKDYSVTANSKI 3 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKIVEAAENEYQTAISENYQTMSDTTFKA 2 
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZA2_MOUSEKIVEAAENEYQTAISENYQTMSDTTFKA 3 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKIVEIPFNSTNKYQLSIHKNPNASEPKH 3 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKIVGDLAQFMVQNGLSRA 2 
A0973EIF4E, EIF4EL1, EIF4FEukaryotic translation initiation factor 4EIF4E_MOUSEKIVIGYQSHADTATKS 2 
A9653RPS740S ribosomal protein S7RS7_MOUSEKIVKPNGEKPDEFESGISQALLELEMNSDLKA 3 
A7879SULT1C2, SULT1C1Sulfotransferase 1C2ST1C2_MOUSEKIVLETSFEKM 2 
A0439PHB2, BAP, REAProhibitin 2PHB2_MOUSEKIVQAEGEAEAAKM 3 
A0439PHB2, BAP, REAProhibitin 2PHB2_MOUSEKIVQAEGEAEAAKM 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_MOUSEKIVSNASCTTNCLAPLAKV 1 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_MOUSEKIVSNASCTTNCLAPLAKV 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_MOUSEKIVSSNDVGHDEYSTQSLVKK 2 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorODPX_MOUSEKIVVEEGAKN 2 
A0369LDHBL-lactate dehydrogenase B chainLDHB_MOUSEKIVVVTAGVRQ 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKIVYGHLDDPANQEIERG 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKIVYGHLDDPANQEIERG 3 
A3803EEF1D, EF1DElongation factor 1-deltaEF1D_MOUSEKIWFDKFKYDDAERR 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_MOUSEKIWHHTFYNELRV 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_MOUSEKIWHHTFYNELRV 3 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKIWISNGGLADIFTVFAKT 2 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialKAD3_MOUSEKIWPHVYSFLQTKV 2 
A3520SEPT7, CDC10Septin-7SEPT7_MOUSEKIYEFPETDDEEENKLVKK 2 
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2SPFH2_MOUSEKIYFGKDIPNMFM*DSAGGLGKQ 3 
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2SPFH2_MOUSEKIYFGKDIPNMFMDSAGGLGKQ 2 
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2SPFH2_MOUSEKIYFGKDIPNMFMDSAGGLGKQ 3 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKIYPLPHMYVIKD 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKIYQIYEGTAQIQRL 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorACADM_MOUSEKIYQIYEGTAQIQRL 2 
A310CRAB14Ras-related protein Rab-14RAB14_MOUSEKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRL 3 
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGSHR_MOUSEKIYSTAFTPMYHAVTTRK 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKIYVDDGLISLQVKE 2 
A7912DARS, PIG40Aspartyl-tRNA synthetaseSYD_MOUSEKIYVISLAEPRL 2 
A3524SEPT11, SEP11Septin-11SEP11_MOUSEKKAAAQLLQSQAQQSGAQQTKK 3 
A4938LAD1, LADLadinin 1LAD1_MOUSEKKAAVSEQPQTTGGSQATTREPRG 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKKADCTITMADSDLLALMTGKM 2 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKKADIGVAMGIVGSDVSKQ 3 
A0340ATP1A1Sodium/potassium-transporting ATPase alpha-1 chain precursorAT1A1_MOUSEKKADIGVAMGIVGSDVSKQ 2 
A1668RPS1040S ribosomal protein S10RS10_MOUSEKKAEAGAGSATEFQFRG 3 
A1668RPS1040S ribosomal protein S10RS10_MOUSEKKAEAGAGSATEFQFRG 2 
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1SNIP_MOUSEKKAESEELEVQKPQVKL 3 
A6464ESDS-formylglutathione hydrolaseESTD_MOUSEKKAFSGYLGPDESKWKA 3 
A9559RPL3, rpl3, ASC-160S ribosomal protein L3RL3_MOUSEKKAHLMEIQVNGGTVAEKL 3 
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2NDUA2_MOUSEKKAHPNLPILIRE 3 
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2NDUA2_MOUSEKKAHPNLPILIRE 2 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKKALAAAGYDVEKN 3 
A470AHIST1H1C, H1F2Histone H1.2H12_MOUSEKKALAAAGYDVEKNNSRI 3 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKKANLQIDQINTDLNLERS 3 
A0326VIL2, EZREzrinEZRI_MOUSEKKAPDFVFYAPRL 2 
A0326VIL2, EZREzrinEZRI_MOUSEKKAPDFVFYAPRL 3 
A4537TRPV4, VRL2, VROACVanilloid receptor-like channel 2TRPV4_MOUSEKKAPMDSLFDYGTYRH 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKKAQLNIGNVLPVGTM*PEGTIVCCLEEKPGDRG 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRG 3 
A3812RPL860S ribosomal protein L8RL8_MOUSEKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKL 3 
A2585PPIE, CYP33Peptidyl-prolyl cis-trans isomerase EPPIE_MOUSEKKARSNPQVYMDIKI 1 
A3965TPM1, TMSATropomyosin 1 alpha chainTPM1_MOUSEKKATDAEADVASLNRR 3 
A6605GKGlycerol kinaseGLPK_MOUSEKKAVLGPLVGAVDQGTSSTRF 3 
A6605GKGlycerol kinaseGLPK_MOUSEKKAVLGPLVGAVDQGTSSTRF 2 
A031BSNRPAU1 small nuclear ribonucleoprotein ASNRPA_MOUSEKKAVQGGAAAPVVGAVQPVPGMPPMPQAPRI 3 
A3662PCPyruvate carboxylase, mitochondrial precursorPYC_MOUSEKKAYVEANQMLGDLIKV 2 
A882APRPF6Pre-mRNA-processing factor 6PRP6_MOUSEKKCPHSTPLWLLLSRL 2 
A4644CD2APCD2-associated proteinCD2AP_MOUSEKKDASYSSKPSLSTPSSASKV 3 
A0897KHDRBS1, SAM68, P62KH domain-containing, RNA-binding, signal transduction associated protein 1SAM68_MOUSEKKDDEENYLDLFSHKN 3 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKKDESQEGKQQYLQSIEDRE 3 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorDHSB_MOUSEKKDESQEGKQQYLQSIEDRE 2 
A1585NID1, NIDNidogen-1NID1_MOUSEKKDESQVPAVVGFSKG 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKDFSSVFQYLRE 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKDFSSVFQYLRE 2 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1S12A1_MOUSEKKDGNISSIQSMHVGEFNQKL 3 
A7164NMT, NMT1Glycylpeptide N-tetradecanoyltransferase 1NMT1_MOUSEKKDIPVVHQLLSRY 3 
A0402ATP6V1D, VATD, ATP6MVacuolar ATP synthase subunit DVATD_MOUSEKKDNVAGVTLPVFEHYHEGTDSYELTGLARG 3 
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_MOUSEKKDVDEAYMNKVELESRL 3 
A4313DNAJC7, TPR2, TTC2DNAJ (HSP40) homolog, subfamily C, member 7DNJC7_MOUSEKKDYNEAYNYYTKA 2 
A2127DYNC1I2, DNCI2, DNCIC2Dynein intermediate chain 2, cytosolicDC1I2_MOUSEKKEAAVSVQEESDLEKK 3 
A8936PLAA, PLAPPhospholipase A-2-activating proteinPLAP_MOUSEKKEALTFDQANPTQILGKL 2 
A8936PLAA, PLAPPhospholipase A-2-activating proteinPLAP_MOUSEKKEALTFDQANPTQILGKL 3 
A7933SARS, SERSSeryl-tRNA synthetase, cytoplasmicSYS_MOUSEKKEAVGDDESVPENVLNFDDLTADALAALKV 3 
A0999CFL1, CFLCofilin, non-muscle isoformCOF1_MOUSEKKEDLVFIFWAPENAPLKS 2 
A4158MLECMalectinK0152_MOUSEKKEEEEEEEEYDEGSNLKRQ 3 
A4314DNAJC8, SPF31, HSPC315DnaJ homolog subfamily C member 8DNJC8_MOUSEKKEGKPTNVEEDDPELFKQ 3 
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorUCRI_MOUSEKKEIDQEAAVEVSQLRDPQHDLDRV 3 
A5337FXR1Fragile X mental retardation syndrome related protein 1FXR1_MOUSEKKEISEGDEVEVYSRA 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKELEEIVQPIISKL 2 
A530CSlco1a1Solute carrier organic anion transporter family member 1A1SO1A1_MOUSEKKELQDNVDVTKYEKV 3 
A7203NUDT12Peroxisomal NADH pyrophosphatase NUDT12NUD12_MOUSEKKEM*ISELHSSAAEGNVAKL 3 
A1390EHD4, HCA10, HCA11EH-domain containing protein 4EHD4_MOUSEKKEMVTSKLPNSVLGKI 3 
A0492STIP1Stress-induced-phosphoprotein 1STIP1_MOUSEKKEPKPEPMEEDLPENKK 3 
A586AEIF4G3Eukaryotic translation initiation factor 4 gamma, 3IF4G3_MOUSEKKEQAGQMPETAAGEPTPEPPRT 3 
A801BAP3B1, ADTB3AAdapter-related protein complex 3 beta 1 subunitAP3B1_MOUSEKKEQGTLTGM*NETSATLIAAPQNFTPSMILQKV 3 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1FTHFD_MOUSEKKETAMINWDQPAEAIHNWIRG 3 
A2043CHD9, KISH2, PRIC320Chromodomain Helicase DNA binding protein 9CHD9_MOUSEKKEVSPGVM*LDIEEFFVKY 2 
A0858RIPK1, RIP, RIP1Receptor-interacting serine/threonine protein kinase 1RIPK1_MOUSEKKEYPDQSPVLQRM 2 
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorACDSB_MOUSEKKFAQEHVAPLVSSM*DENSKM 3 
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorACDSB_MOUSEKKFAQEHVAPLVSSMDENSKM 3 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaGDIB_MOUSEKKFDLGQDVIDFTGHSLALYRT 3 
A1044RANBP2, NUP358Ran-binding protein 2RBP2_MOUSEKKFEDSQQNIIKLQNGHTSLAAELSKD 3 
A0655MAPRE3, RP3, EBF3-LMicrotubule-associated protein RP/EB family member 3MARE3_MOUSEKKFFDANYDGKDYNPLLARQ 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKFISDKDASVVGFFRD 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKFISDKDASVVGFFRD 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKKFKLEAPDADELPRS 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKFLDAGHKLNFAVASRK 3 
A5015NUDC, NPD011, MNUDC proteinNUDC_MOUSEKKFMDQHPEMDFSKA 3 
A4750DSTN, ACTDP, DSNDestrinDEST_MOUSEKKFPGIKHEYQANGPEDLNRT 3 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKKFPLDPLITHVLPFEKI 3 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKKFPLDPLITHVLPFEKI 2 
A5725Adh1Alcohol dehydrogenase 1ADH1_MOUSEKKFPLDPLITHVLPFEKINEAFDLLRS 3 
A3994CHCHD6, CHCM1Coiled-coil-helix-coiled-coil-helix domain-containing protein 6, mitochondrialCHCH6_MOUSEKKFQQEQLAVQDEMVRV 3 
A6795INMT, INMT-FAM188BIndolethylamine N-methyltransferaseINMT_MOUSEKKFSGVYLEKEVVEKA 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialHCDH_MOUSEKKFTENPKAGDEFVEKT 3 
A588AEIF5Eukaryotic translation initiation factor 5IF5_MOUSEKKFVLCPECENPETDLHVNPKK 3 
A0654MAPRE2, RP1T-cell activation proteinMARE2_MOUSEKKFYDANYDGKEYDPVEARQ 3 
A846BBCAP31, BAP31, DXS1357EB-cell receptor-associated protein 31BAP31_MOUSEKKGAAEDGDKLDIGNTEMKL 3 
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13F10A1_MOUSEKKGAAIEALNDGELQKA 2 
A5108RAI14, NORPEGAnkycorbinRAI14_MOUSEKKGADLSLVDSLGHNALHYSKL 3 
A0367RPL13, BBC160S ribosomal protein L13RL13_MOUSEKKGDSSAEELKLATQLTGPVM*PIRN 3 
A0367RPL13, BBC160S ribosomal protein L13RL13_MOUSEKKGDSSAEELKLATQLTGPVMPIRN 3 
A0367RPL13, BBC160S ribosomal protein L13RL13_MOUSEKKGDSSAEELKLATQLTGPVMPIRN 2 
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_MOUSEKKGEKDIPGLTDTTVPRR 3 
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_MOUSEKKGEKDIPGLTDTTVPRR 2 
A3544CCT3, CCTG, TRIC5T-complex protein 1, gamma subunitTCPG_MOUSEKKGESQTDIEITREEDFTRI 3 
A0432PRDX6, AOP2Peroxiredoxin 6PRDX6_MOUSEKKGESVMVVPTLSEEEAKQ 2 
A0432PRDX6, AOP2Peroxiredoxin 6PRDX6_MOUSEKKGESVMVVPTLSEEEAKQ 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKKGFIGPGIDVPAPDM*STGERE 3 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKKGFIGPGIDVPAPDM*STGERE 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKKGFIGPGIDVPAPDMSTGERE 2 
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_MOUSEKKGFIGPGIDVPAPDMSTGERE 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKKGGKEFVEAVLELRK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1H2AY_MOUSEKKGGKEFVEAVLELRK 3 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKKGIVDQSQQAYQEAFEISKK 2 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKKGIVDQSQQAYQEAFEISKK 3 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKKGIVDQSQQAYQEAFEISKKE 3 
A0361YWHAZ14-3-3 protein zeta/delta1433Z_MOUSEKKGIVDQSQQAYQEAFEISKKE 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorACADV_MOUSEKKGIVNEQFLLQRL 2 
A9630RPS1340S ribosomal protein S13RS13_MOUSEKKGLTPSQIGVILRD 3 
A9630RPS1340S ribosomal protein S13RS13_MOUSEKKGLTPSQIGVILRD 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKGNIYSLNEGYAKD 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKGNIYSLNEGYAKD 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKGNIYSLNEGYAKDFDPAINEYLQRK 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKGNIYSLNEGYAKDFDPAINEYLQRK 2 
A7340PDIA4, ERP70, ERP72Protein disulfide isomerase A4 precursorPDIA4_MOUSEKKGQAVDYDGSRTQEEIVAKV 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKGSLLIDSSTIDPSVSKE 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKGSLLIDSSTIDPSVSKE 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKGSLLIDSSTIDPSVSKELAKE 3 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor3HIDH_MOUSEKKGSLLIDSSTIDPSVSKELAKE 2 
A643CTF, PRO1400Serotransferrin precursorTRFE_MOUSEKKGTDFQLNQLEGKK 3 
A643CTF, PRO1400Serotransferrin precursorTRFE_MOUSEKKGTDFQLNQLEGKK 2 
A9662MRPS11, RPMS11, HCC228S ribosomal protein S11, mitochondrial precursorRT11_MOUSEKKGTGIAAQTAGIAAAAKA 2 
A9662MRPS11, RPMS11, HCC228S ribosomal protein S11, mitochondrial precursorRT11_MOUSEKKGTGIAAQTAGIAAAAKA 3 
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorTRAP1_MOUSEKKGTITIQDTGIGMTQEELVSNLGTIARS 3 
A6009CBR1, CBR, CRNCarbonyl reductase [NADPH] 1DHCA_MOUSEKKGVHAEEGWPNSAYGVTKI 3 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialKAD3_MOUSEKKGVLETFSGTETNKIWPHVYSFLQTKV 3 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKKGVLFGVPGAFTPGCSKT 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKKGVLFGVPGAFTPGCSKT 3 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKKGVNLPGAAVDLPAVSEKD 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeKPYM_MOUSEKKGVNLPGAAVDLPAVSEKDIQDLKF 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIM*PQGVAM*KA 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIM*PQGVAM*KA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIM*PQGVAMKA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIM*PQGVAMKA 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIMPQGVAM*KA 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIMPQGVAM*KA 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIMPQGVAMKA 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKGVYLTDIMPQGVAMKA 2 
A3567PSMA4, HC9, PSC9Proteasome subunit alpha type 4PSA4_MOUSEKKHEEEEAKAERE 3 
A1481HINT1, HINT, PKCI1Histidine triad nucleotide-binding protein 1HINT1_MOUSEKKHISQISVADDDDESLLGHLMIVGKK 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKKHLEINPDHPIVETLRQ 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKKHLEINPDHPIVETLRQ 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKKHLEINPDHSIIETLRQ 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKKHLEINPDHSIIETLRQ 3 
A7979ACAA2Acetyl-CoA acyltransferase 2THIM_MOUSEKKHNFTPLARV 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKKHPDASVNFSEFSKK 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKKHPDASVNFSEFSKKC 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKKHSQFIGYPITLFVEKE 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaHS90A_MOUSEKKHSQFIGYPITLFVEKERD 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKKHSQFIGYPITLYLEKE 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKKHSQFIGYPITLYLEKE 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1HS90B_MOUSEKKHSQFIGYPITLYLEKERE 3 
A6551GPIGlucose-6-phosphate isomeraseG6PI_MOUSEKKIEPELEGSSAVTSHDSSTNGLISFIKQ 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKKIFDIDEAEEAIKDVKI 2 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKKIFDIDEAEEAIKDVKI 3 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKKIFVGGIKEDTEEYNLRD 2 
A2547HNRPA3, HNRNPA3, BX1Heterogeneous nuclear ribonucleoprotein A3ROA3_MOUSEKKIFVGGIKEDTEEYNLRD 3 
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D0HNRPD_MOUSEKKIFVGGLSPDTPEEKI 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_MOUSEKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKG 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKKIKDPDAAKPEDWDERA 3 
A979BFABP1, FABPLFatty acid-binding protein, liverFABPL_MOUSEKKIKLTITYGPKV 2 
A7989TKT, TKT1TransketolaseTKT_MOUSEKKILATPPQEDAPSVDIANIRM 3 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKKILDSVGIEADDDRLNKV 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_MOUSEKKILDSVGIEADDDRLNKV 3 
A009ANCLNNicalin precursorNCLN_MOUSEKKINLADDVLAWEHERF 3 
A1559LAMA4, LAMA4*-1Laminin alpha-4 chain precursorLAMA4_MOUSEKKIPFTDIYIGGAPQEVLQSRT 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKIPIVSSM*AEPLVAGPDEKG 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKIPIVSSM*AEPLVAGPDEKG 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKIPIVSSMAEPLVAGPDEKG 2 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKIPIVSSMAEPLVAGPDEKG 3 
A9732PDZK1, CAP70, NHERF3PDZ domain containing-protein 1PDZK1_MOUSEKKIPIVSSMAEPLVAGPDEKGETSAESEHDAHPAKD 3 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKKIQMSNLMNQARL 2 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEKKIQMSNLMNQARL 3 
A8766SPFH2, ERLIN2, UNQ2441/PRO5003/PRO9924Erlin-2SPFH2_MOUSEKKISEIEDAAFLARE 2 
A8971PSME1, IFI5111Proteasome activator complex subunit 1PSME1_MOUSEKKISELDAFLKEPALNEANLSNLKA 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKKISSVQSIVPALEIANAHRK 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorCH60_MOUSEKKISSVQSIVPALEIANAHRK 3 
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorCLPX_MOUSEKKIYNYLDKYVVGQSFAKK 2 
A310CRAB14Ras-related protein Rab-14RAB14_MOUSEKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRL 3 
A3524SEPT11, SEP11Septin-11SEP11_MOUSEKKKAAAQLLQSQAQQSGAQQTKK 3 
A6459CES3, UNQ869/PRO1887, UNQ869Carboxylesterase 3CES3_MOUSEKKKDLFQDLMADVVFGVPSVIVSRS 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKKELEEIVQPIISKL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKKELEEIVQPIISKL 3 
A1319EHD1, PAST, PAST1EH-domain containing protein 1EHD1_MOUSEKKKELVNNLGEIYQKI 3 
A0808MSNMoesinMOES_MOUSEKKKESEAVEWQQKA 2 
A7989TKT, TKT1TransketolaseTKT_MOUSEKKKILATPPQEDAPSVDIANIRM 3 
A1350EIF2S2, EIF2BEukaryotic translation initiation factor 2 subunit 2IF2B_MOUSEKKKPFMLDEEGDAQTEETQPSETKE 3 
A9546RPL1960S ribosomal protein L19RL19_MOUSEKKKVWLDPNETNEIANANSRQ 3 
A356CRAB11FIP5, GAF1, RIP11Rab11 interacting protein Rip11RFIP5_MOUSEKKKYDLESASAILPSSALEDPELGSLGKM 3 
A5112RMDN1, FAM82B, CGI-90Regulator of microtubule dynamics protein 1FA82B_MOUSEKKLAAFWLVKA 2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseCPGL1_MOUSEKKLAEWVAIQSVSAWPEKRG 3 
A7773AHCY, SAHHAdenosylhomocysteinaseSAHH_MOUSEKKLDEAVAEAHLGKLNVKL 3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKLDILSNDLVINM*LKS 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKLDILSNDLVINMLKS 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_MOUSEKKLDILSNDLVINMLKS 3 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorATPO_MOUSEKKLDQVEKELLRV 3 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorATPO_MOUSEKKLDQVEKELLRV 2 
A9086CCDC44, TACO1, PRO0477Translational activator of Cytochrome C oxidase 1CCD44_MOUSEKKLDSLGLCPVSCSMEFIPHSKV 3 
A3808RPL4, RPL160S ribosomal protein L4RL4_MOUSEKKLEAAATALATKS 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKKLEEEGEQFVKK 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKKLEEEGEQFVKK 2 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKKLEEEGEQFVKKI 3 
A7161SCP2Nonspecific lipid-transfer protein, mitochondrial precursorNLTP_MOUSEKKLEEEGEQFVKKI 2 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKKLEEGGPVYSPPAQVVVRK 2 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKKLEEGGPVYSPPAQVVVRK 3 
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialLETM1_MOUSEKKLEEGGPVYSPPAQVVVRKS 3 
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1VDAC1_MOUSEKKLETAVNLAWTAGNSNTRF 2 
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1VDAC1_MOUSEKKLETAVNLAWTAGNSNTRF 3 
A887APTRF, FKSG13Polymerase I and transcript release factorPTRF_MOUSEKKLEVNEAELLRR 2 
A895BARCN1, COPDCoatomer delta subunitCOPD_MOUSEKKLFTAESLIGLKNPEKS 3 
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1ROA1_MOUSEKKLFVGGIKEDTEEHHLRD 3 
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1ROA1_MOUSEKKLFVGGIKEDTEEHHLRD 2 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1ROA2_MOUSEKKLFVGGIKEDTEEHHLRD 3 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1ROA2_MOUSEKKLFVGGIKEDTEEHHLRD 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKKLGEM*WNNTAADDKQPYEKK 3 
A2173HMGB3, HMG2A, HMG4High mobility group protein B3HMGB3_MOUSEKKLGEMWNNLSDNEKQPYVTKA 3 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKKLGEMWNNTAADDKQPYEKK 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1HMGB1_MOUSEKKLGEMWNNTAADDKQPYEKK 3 
A7947TALH, TALDO1, TALTransaldolaseTALDO_MOUSEKKLGGPQEEQIKNAIDKL 3 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitTCPB_MOUSEKKLGGSLADSYLDEGFLLDKKI 3 
A788ANOP56, NOL5ANucleolar protein Nop56NOP56_MOUSEKKLKPQENGMEDPPVSLPKS 3 
A9941IGBP1, IBP1Immunoglobulin-binding protein 1IGBP1_MOUSEKKLLEDVEVATEPTGSRT 3 
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_MOUSEKKLLMMAGIDDCYTSARGCTATLGNFAKA 3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKLNCQVIGASVDSHFCHLAWINTPKK 3 
A8826GUCA2BUroguanylin precursorGUC2B_MOUSEKKLNELEEKEMSNPQPRR 3 
A369CRRBP1Ribosome-binding protein 1RRBP1_MOUSEKKLQEQLGKAEDGSSSKE 2 
A701CVPS4B, SKD1, VPS42Vacuolar sorting protein 4bVPS4B_MOUSEKKLQNQLQGAIVIERPNVKW 3 
A5800CD13, ANPEP, APNAminopeptidase NAMPN_MOUSEKKLQNQLQTDLSVIPVINRA 2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_MOUSEKKLSDDNTIGQEEIQQRL 3 
A999ASF3B1, SAP155Splicing factor 3B subunit 1SF3B1_MOUSEKKLSSWDQAETPGHTPSLRW 3 
A4398TIMM10, TIM10Mitochondrial import inner membrane translocase subunit TIM10TIM10_MOUSEKKLTELSM*QDEELMKRV 3 
A4398TIMM10, TIM10Mitochondrial import inner membrane translocase subunit TIM10TIM10_MOUSEKKLTELSMQDEELMKRV 2 
A4398TIMM10, TIM10Mitochondrial import inner membrane translocase subunit TIM10TIM10_MOUSEKKLTELSMQDEELMKRV 3 
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1RAC1_MOUSEKKLTPITYPQGLAM*AKE 2 
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1RAC1_MOUSEKKLTPITYPQGLAMAKE 2 
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1RAC1_MOUSEKKLTPITYPQGLAMAKE 3 
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorRM12_MOUSEKKLVESLPQEIKA 3 
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorRM12_MOUSEKKLVESLPQEIKA 2 
A1130POLR2, POLR2A, RPB1DNA-directed RNA polymerase II subunit RPB1RPB1_MOUSEKKLVIVNGDDPLSRQ 2 
A7646CRYZCrystallin zetaQOR_MOUSEKKLVLQNGAHEVFNHKE 2 
A7646CRYZCrystallin zetaQOR_MOUSEKKLVLQNGAHEVFNHKEANYIDKI 3 
A1846ADAM10, KUZ, MADMADAM 10 precursorADA10_MOUSEKKM*APSTCASTGSLQWSKQ 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKKM*NLGVGAYRDDNGKPYVLPSVRK 3 
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorBDH_MOUSEKKM*WDDLPEVVRK 2 
A519CSNX18, SH3PXD3B, SNAG1Sorting nexin 18SNX18_MOUSEKKMDDSALQLNHTANEFARK 3 
A3985AHCYL2S-Adenosylhomocysteine hydrolase-like 2SAHH3_MOUSEKKMDEYVASLHLPTFDAHLTELTDEQAKY 3 
A6670GSTT2BGlutathione S-transferase theta-2BGSTT2_MOUSEKKMLPVPPPEVHASMQLRI 3 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKKMNLGVGAYRDDNGKPYVLPSVRK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorAATM_MOUSEKKMNLGVGAYRDDNGKPYVLPSVRK 3 
A6502FBL, FIB1, FLRNFibrillarinFBRL_MOUSEKKMQQENMKPQEQLTLEPYERD 3 
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorBDH_MOUSEKKMWDDLPEVVRK 2 
A6879LACTB, MRPL56, UNQ843/PRO1781Serine beta lactamase-like protein LACTB, mitochondrialLACTB_MOUSEKKNDFEQGELYLKEKF 3 
A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1IREB1_MOUSEKKNDIENILNWNVMQHKN 3 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorSCOT_MOUSEKKNGLTLIELWEGLTVDDIKKS 3 
A0117NSFVesicle-fusing ATPaseNSF_MOUSEKKNIDSNPYDTDKM 2 
A857BCALB1, CAB27CalbindinCALB1_MOUSEKKNIMALSDGGKLYRT 3 
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_MOUSEKKNKEEAAEYAKL 2 
A7280PAK2Serine/threonine-protein kinase PAK 2PAK2_MOUSEKKNPQAVLDVLKF 2 
A7280PAK2Serine/threonine-protein kinase PAK 2PAK2_MOUSEKKNPQAVLDVLKF 3 
A339ADEKDEK oncogene (DNA binding)DEK_MOUSEKKNVGQFSGFPFEKG 2 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKKPEDWDEEMDGEWEPPVIQNPEYKG 3 
A1609CALR, CRTCCalreticulin precursorCRTC_MOUSEKKPEDWDEEMDGEWEPPVIQNPEYKG 2 
A8370Serpina1bAlpha-1-antitrypsin 1-2A1AT2_MOUSEKKPFDPENTEEAEFHVDKS 3 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorDHSA_MOUSEKKPFGEHWRK 2 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKKPIGLCCIAPVLAAKV 3 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorES1_MOUSEKKPIGLCCIAPVLAAKV 2 
A3816RPS340S ribosomal protein S3RS3_MOUSEKKPLPDHVSIVEPKD 3 
A6321SORD, SORDLSorbitol dehydrogenaseDHSO_MOUSEKKPMVLGHEAAGTVTKV 3 
A795DPDZD11, PDZK11, HSPC227PDZ domain containing protein 11PDK11_MOUSEKKPPGAQLGFNIRG 3 
A369CRRBP1Ribosome-binding protein 1RRBP1_MOUSEKKPPTLEPSMDIVLKL 2 
A2142CORO1C, CRNN4, CRN2Coronin 1CCOR1C_MOUSEKKPTDTASVQNEAKLDEILKEIKS 3 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKKPVIAAVNGYALGGGCELAM*M*CDIIYAGEKA 3 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorECHM_MOUSEKKPVIAAVNGYALGGGCELAMMCDIIYAGEKA 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKQAGPASVPLRTEEEFKK 3 
A3961MYH10, SmembMyosin-10MYH10_MOUSEKKQELEEILHDLESRV 3 
A9843COMMD1, MURR1COMM domain-containing protein 1COMD1_MOUSEKKQGGITSEQAAVISKF 3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPM*NIPLISDPKRT 3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPM*NIPLISDPKRT 2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPMNIPLISDPKR 3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPMNIPLISDPKR 2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPMNIPLISDPKRT 2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_MOUSEKKQGGLGPMNIPLISDPKRT 3 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKKQGLLPLTFADPSDYNKI 3 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKKQGLLPLTFADPSDYNKI 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorACON_MOUSEKKQGLLPLTFADPSDYNKIHPVDKL 3 
A2536NCLNucleolinNUCL_MOUSEKKQKVEGSEPTTPFNLFIGNLNPNKS 3 
A0819RDXRadixinRADI_MOUSEKKQLQALSSELAQARD 2 
A0819RDXRadixinRADI_MOUSEKKQLQALSSELAQARD 3 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLCX033_MOUSEKKQLVRPDQLPIYTAPPLHSKY 2 
A0243EIF3A, EIF3S10Eukaryotic translation initiation factor 3 subunit 10IF3A_MOUSEKKQPALDVLYDVMKS 2 
A9543RPL17, RPL17P960S ribosomal protein L17RL17_MOUSEKKSAEFLLHM*LKN 3 
A9543RPL17, RPL17P960S ribosomal protein L17RL17_MOUSEKKSAEFLLHMLKN 2 
A9543RPL17, RPL17P960S ribosomal protein L17RL17_MOUSEKKSAEFLLHMLKN 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorDLDH_MOUSEKKSDGKIDVSVEAASGGKA 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKSDIDEIVLVGGSTRI 2 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKKSEEDGKEYHFISTEEM*TKN 3 
A1921MPP1, DXS552E, EMP55Palmitoylated membrane protein 1EM55_MOUSEKKSEEDGKEYHFISTEEMTKN 3 
A4285CLPXATP-dependent Clp protease ATP-binding subunit ClpX-like, mitochondrial precursorCLPX_MOUSEKKSIIKEPESAAEAVKL 3 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorGLU2B_MOUSEKKSLEDQVETLRA 3 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorGLU2B_MOUSEKKSLEDQVETLRA 2 
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalACOX1_MOUSEKKSPLNKTEVHQSYYKH 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKSQIFSTASDNQPTVTIKV 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKSQIFSTASDNQPTVTIKV 2 
A287CPITPNM1, DRES9, NIR2Membrane-associated phosphatidylinositol transfer protein 1PITM1_MOUSEKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKV 3 
A468AH1F0, H1FVHistone H1.0H10_MOUSEKKSTDHPKYSDM*IVAAIQAEKN 3 
A468AH1F0, H1FVHistone H1.0H10_MOUSEKKSTDHPKYSDMIVAAIQAEKN 2 
A468AH1F0, H1FVHistone H1.0H10_MOUSEKKSTDHPKYSDMIVAAIQAEKN 3 
A1575DST, BPAG1, DMHDystoninBPA1_MOUSEKKTAEVLLDAKGSLLPAKN 3 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorNNTM_MOUSEKKTCDALQAKVRE 2 
A5815APEX1, APE, APEXDNA-(apurinic or apyrimidinic site) lyaseAPEX1_MOUSEKKTEKEAAGEGPVLYEDPPDQKT 3 
A7223OATOrnithine aminotransferase, mitochondrial precursorOAT_MOUSEKKTEQGPPSSEYIFERE 2 
A7223OATOrnithine aminotransferase, mitochondrial precursorOAT_MOUSEKKTEQGPPSSEYIFERE 3 
A0217FUS, TLS, FUS-CHOPRNA-binding protein FUSFUS_MOUSEKKTGQPMINLYTDRETGKL 3 
A0784DYNC1LI1, DNCLI1Dynein light intermediate chain 1, cytosolicDC1L1_MOUSEKKTGSPGGPGVGGSPGGGAAGASPSLPPSAKK 3 
A7978Acaa1a3-ketoacyl-CoA thiolase A, peroxisomalTHIKA_MOUSEKKTITVSQDEGVRPSTTMQGLAKL 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKTKPYIQVDIGGGQTKT 3 
A0808MSNMoesinMOES_MOUSEKKTQEQLASEMAELTARI 2 
A0808MSNMoesinMOES_MOUSEKKTQEQLASEMAELTARI 3 
A648CTTR, PALB, TBPATransthyretin precursorTTHY_MOUSEKKTSEGSWEPFASGKT 2 
A7067MST4, RP6-213H19.1, STK3Serine/threonine protein kinase MASKMST4_MOUSEKKTSYLTELIDRF 3 
A7067MST4, RP6-213H19.1, STK3Serine/threonine protein kinase MASKMST4_MOUSEKKTSYLTELIDRF 2 
A567CSTX3, STX3ASyntaxin 3STX3_MOUSEKKTTDEELEEM*LESGNPAIFTSGIIDSQISKQ 3 
A567CSTX3, STX3ASyntaxin 3STX3_MOUSEKKTTDEELEEMLESGNPAIFTSGIIDSQISKQ 3 
A3533HSPH1, HSP105, HSP110Heat shock 105kDa/110kDa protein 1HS105_MOUSEKKVDQPPEAKKPKI 2 
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_MOUSEKKVEAQLQELQVKF 3 
A1381CBX3, CCDC32Chromobox protein homolog 3CBX3_MOUSEKKVEEAEPEEFVVEKV 3 
A1381CBX3, CCDC32Chromobox protein homolog 3CBX3_MOUSEKKVEEAEPEEFVVEKV 2 
A584AEIF4G1, EIF4GI, EIF4GEukaryotic translation initiation factor 4GIIF4G1_MOUSEKKVEYTLGEESEAPGQRT 3 
A5250WDR1, PNAS-29WD-repeat containing protein 1WDR1_MOUSEKKVFASLPQVERG 3 
A016CHbb-b1, Hbbt1Hemoglobin subunit beta-1HBB1_MOUSEKKVITAFNDGLNHLDSLKG 3 
A3971OPA1Optic atrophy 1 gene proteinOPA1_MOUSEKKVKLLTGKR 2 
A4687CNN3Calponin 3CNN3_MOUSEKKVNESSLNWPQLENIGNFIKA 2 
A4687CNN3Calponin 3CNN3_MOUSEKKVNESSLNWPQLENIGNFIKA 3 
A4685CNN1Calponin H1, smooth muscleCNN1_MOUSEKKVNESTQNWHQLENIGNFIKA 3 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialPRDX5_MOUSEKKVNLAELFKG 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_MOUSEKKVNVVEQEKIDKL 3 
A7522PSMA6, PROS27Proteasome subunit alpha type 6PSA6_MOUSEKKVPDKLLDSSTVTHLFKI 2 
A7522PSMA6, PROS27Proteasome subunit alpha type 6PSA6_MOUSEKKVPDKLLDSSTVTHLFKI 3 
A176CMYO5BMyosin VbMYO5B_MOUSEKKVQDLEAAQALAQSDRRH 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKVTHAVVTVPAYFNDAQRQ 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GRP78_MOUSEKKVTHAVVTVPAYFNDAQRQ 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorDECR_MOUSEKKVTKEEWDIIEGLIRK 3 
A8828PDAP1, HASPP2828 kDa heat- and acid-stable phosphoproteinHAP28_MOUSEKKVTQLDLDGPKELSRR 3 
A5800CD13, ANPEP, APNAminopeptidase NAMPN_MOUSEKKVVATTQMQAADARK 3 
A315CRAB1B, rab1bRas-related protein Rab-1BRAB1B_MOUSEKKVVDNTTAKEFADSLGVPFLETSAKN 3 
A314CRAB1A, RAB1Ras-related protein Rab-1ARAB1A_MOUSEKKVVDYTTAKEFADSLGIPFLETSAKN 3 
A9546RPL1960S ribosomal protein L19RL19_MOUSEKKVWLDPNETNEIANANSRQ 3 
A9546RPL1960S ribosomal protein L19RL19_MOUSEKKVWLDPNETNEIANANSRQ 2 
A0254AP2M1, CLAPM1AP-2 complex subunit muAP2M1_MOUSEKKWARPPISMNFEVPFAPSGLKV 3 
A7863SQRDL, CGI-44, PRO1975Sulfide:quinone oxidoreductase, mitochondrial precursorSQRD_MOUSEKKYADALQEIIRE 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKKYDAFLASESLIKQ 2 
A3813RPL10A, NEDD660S ribosomal protein L10aRL10A_MOUSEKKYDAFLASESLIKQ 3 
A356CRAB11FIP5, GAF1, RIP11Rab11 interacting protein Rip11RFIP5_MOUSEKKYDLESASAILPSSALEDPELGSLGKM 3 
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorCOQ5_MOUSEKKYDLMNDMMSLGIHRA 2 
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorCOQ5_MOUSEKKYDLMNDMMSLGIHRA 3 
A370ATUFMElongation factor Tu, mitochondrial precursorEFTU_MOUSEKKYEEIDNAPEERA 3 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKYEGGRELNDFISYLQRE 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorPDIA3_MOUSEKKYEGGRELNDFISYLQRE 3 
A0387ATP5H, My032ATP synthase D chain, mitochondrialATP5H_MOUSEKKYNALKIPVPEDKY 2 
A0387ATP5H, My032ATP synthase D chain, mitochondrialATP5H_MOUSEKKYNALKIPVPEDKY 3 
A5634AAS