PADB-logoLSSR - PepMap molecular information by study

Study ID 18361515
Species human
Disease healthy
Tissue / Source saliva
Compartment Parotid

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382492-.AVQLLESGGGLVQPGGSLR.L920.02 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386135-.DFMLTQPHSVSESPGK.T880.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003111-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003469-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384398-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387022-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387027-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387094-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387100-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387101-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387106-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479883-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387099-.DIQMTQSPSSLSA.S682.32 (observed)2 
BY629 PREDICTED: Similar to IG kappa chain V regionIPI00007852-.DIQMTQSPSSLSA.S682.32 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003111-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003111-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003111-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003469-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003469-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003469-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00161229-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00161229-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00161229-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384398-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384398-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384398-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387022-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387022-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387022-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387027-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387027-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387027-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387094-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387100-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387100-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387100-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387101-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387101-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387101-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V3 peptide delta score: 69.05
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V3 peptide delta score: 69.05
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V1 peptide delta score: 118.5
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961-.DIQMTQSPSSLSASVGDR.V1 peptide delta score: 118.5
A8273IGK, SDNK1, A30Ig kappa chainIPI00479883-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479883-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479883-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387099-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
BY629 PREDICTED: Similar to IG kappa chain V regionIPI00007852-.DIQMTQSPSSLSASVGDR.V1879.89 (observed)1 
BY629 PREDICTED: Similar to IG kappa chain V regionIPI00007852-.DIQMTQSPSSLSASVGDR.V940.21 (observed)2 
BY629 PREDICTED: Similar to IG kappa chain V regionIPI00007852-.DIQMTQSPSSLSASVGDR.V939.75 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387106-.DIQMTQSPSSLSATVGDR.V947.79 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387106-.DIQMTQSPSSLSATVGDR.V946.82 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00003470-.DIQMTQSPSSVSASVGDR.V933.26 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847-.DIQMTQSPSSVSASVGDR.V932.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847-.DIQMTQSPSSVSASVGDR.V933.26 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387024-.DIQMTQSPSTLSASVGDR.V947.22 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387024-.DIQMTQSPSTLSASVGDR.V631 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387024-.DIQMTQSPSTLSASVGDR.V948.24 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026-.DIQMTQSPSTLSASVGDR.V631 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026-.DIQMTQSPSTLSASVGDR.V948.24 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026-.DIQMTQSPSTLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026-.DIQMTQSPSTLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600-.DIQMTQSPSTLSASVGDR.V947.22 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600-.DIQMTQSPSTLSASVGDR.V631 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600-.DIQMTQSPSTLSASVGDR.V948.24 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024-.DIQMTQSPSTLSASVGDR.V947.22 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024-.DIQMTQSPSTLSASVGDR.V631 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024-.DIQMTQSPSTLSASVGDR.V948.24 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382499-.DVQLVESGGGLVK.P651.28 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382499-.DVQLVESGGGLVKPGGSLR.L934.52 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382499-.DVQLVESGGGLVKPGGSLR.L622.66 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382499-.DVQLVESGGGLVKPGGSLR.L934.5 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387105-.DVQMTQSPSSLSASVGDR.V933.01 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 98.58
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 50.08
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 118.6
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 58.82
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 44.79
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 162.2
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 98.62
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 69.96
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 82.36
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 98.58
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 50.08
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 118.6
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 58.82
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 44.79
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 162.2
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 98.62
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 69.96
A8273IGK, SDNK1, A30Ig kappa chainIPI00385252-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 82.36
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 98.58
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 50.08
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 118.6
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 58.82
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 44.79
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 162.2
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 98.62
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 69.96
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 82.36
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 98.58
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 50.08
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 118.6
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 58.82
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 44.79
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 162.2
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 98.62
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 69.96
A8273IGK, SDNK1, A30Ig kappa chainIPI00387118-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 82.36
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A2 peptide delta score: 98.58
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 50.08
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 58.82
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A3 peptide delta score: 44.79
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 162.2
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808-.EIVLTQSPGTLSLSPGER.A1 peptide delta score: 98.62
A8273IGK, SDNK1, A30Ig kappa chainIPI00384401-.EIVMTQSPATLSVSPGER.A951.38 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384401-.EIVMTQSPATLSVSPGER.A634.65 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820-.EIVMTQSPATLSVSPGER.A951.38 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820-.EIVMTQSPATLSVSPGER.A634.65 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549330-.EIVMTQSPATLSVSPGER.A951.38 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549330-.EIVMTQSPATLSVSPGER.A634.65 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387119-.EIVMTQSPVTLSVSPGER.A965.66 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382493-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382497-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A8363IGHM, IgIg mu chain CIPI00220120-.EVQLLESGGGLVQPGGSLR.L1897.02 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K1286.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K645.29 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K1286.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K645.29 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K1288.56 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVK.K644.6 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384407-.EVQLVESGAEVK.K1286.71 (observed)1 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384407-.EVQLVESGAEVK.K645.29 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384407-.EVQLVESGAEVK.K1288.56 (observed)1 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384407-.EVQLVESGAEVK.K644.6 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384409-.EVQLVESGAEVKK.P708.16 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384407-.EVQLVESGAEVKK.P708.16 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382500-.EVQLVESGGDLVQPGR.S842.53 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382500-.EVQLVESGGDLVQPGR.S841.44 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.77 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P1314.19 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVK.P657.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00442909-.EVQLVESGGGLVK.P657.77 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00783024-.EVQLVESGGGLVK.P657.77 (observed)2 
A8269IGHG2Ig gamma-2IPI00426051-.EVQLVESGGGLVK.P1314.19 (observed)1 
A8269IGHG2Ig gamma-2IPI00426051-.EVQLVESGGGLVK.P657.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00783024-.EVQLVESGGGLVKPGGSLR.L627.74 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00783024-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A8269IGHG2Ig gamma-2IPI00426051-.EVQLVESGGGLVKPGGSLR.L628.03 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00385683-.EVQLVESGGGLVQPGESLK.L963.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480-.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00384392-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479553-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479553-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
BL309 DUNQU1 protein isoform 1IPI00396930-.EVQLVESGGGLVQPGGSLR.L941.22 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384391-.EVQLVESGGGVVQPGGSLR.L934.85 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384391-.EVQLVESGGGVVQPGGSLR.L934.85 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384391-.EVQLVESGGGVVQPGGSLR.L934.92 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384391-.EVQLVESGGGVVQPGGSLR.L934.92 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866-.EVQLVESGGGVVR.P664.55 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00007899-.EVQLVESGGGVVR.P664.55 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866-.EVQLVESGGGVVRPGGSLR.I948.4 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866-.EVQLVESGGGVVRPGGSLR.I632.54 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866-.EVQLVESGGGVVRPGGSLR.I948.74 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866-.EVQLVESGGGVVRPGGSLR.I632.54 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00007899-.EVQLVESGGGVVRPGGSLR.I948.4 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00007899-.EVQLVESGGGVVRPGGSLR.I632.54 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00007899-.EVQLVESGGGVVRPGGSLR.I948.74 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00007899-.EVQLVESGGGVVRPGGSLR.I632.54 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382481-.EVQLVETGGGLIQPGGSLR.L955.87 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382481-.EVQLVETGGGLIQPGGSLR.L956.23 (observed)2 
A4960MAP7, E-MAP-115, EMAP115EnsconsinIPI00022628-.MAELGAGGDGHRGGDGAVR.S892.72 (observed)2 
A9708DOK6, DOK5LDocking protein 6IPI00400860-.MASNFNDIVKQGYVKIRSR.K1113.01 (observed)2 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAK.P1002.37 (observed)1 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAKPATPEIQEIVDK.V774.69 (observed)3 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAKPATPEIQEIVDK.V1162.11 (observed)2 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAKPATPEIQEIVDK.V1162.11 (observed)2 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAKPATPEIQEIVDK.V774.99 (observed)3 
A8399CSTA, STF1, STFACystatin AIPI00032325-.MIPGGLSEAKPATPEIQEIVDKVKPQLEEK.T1092.53 (observed)3 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047-.MLTELEK.A432.2 (observed)2 
A5232THBS2, TSP2Thrombospondin 2 precursorIPI00018769-.MVWRLVLLALWVWPSTQAGHQDK.D911.63 (observed)3 
A5232THBS2, TSP2Thrombospondin 2 precursorIPI00018769-.MVWRLVLLALWVWPSTQAGHQDK.D911.63 (observed)3 
A3905SYT7, PCANAP7Synaptotagmin-7IPI00012902-.MYRDPEAASPGAPSR.D802.37 (observed)2 
A1669KRT5Keratin, type II cytoskeletal 5IPI00009867-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A1669KRT5Keratin, type II cytoskeletal 5IPI00009867-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CIPI00299145-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BIPI00293665-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BIPI00293665-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AIPI00300725-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AIPI00300725-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AIPI00479403-.QNLEPLFEQYINNLR.R946.49 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00003939-.QSVLTQPPSVSAAPGQK.V847.28 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382421-.QSVLTQPPSVSAAPGQK.V847.28 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382488-.QVKLVQAGGGVVQPGR.S1592.84 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382488-.QVKLVQAGGGVVQPGR.S796.94 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382488-.QVKLVQAGGGVVQPGR.S1594.84 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382488-.QVKLVQAGGGVVQPGR.S798.43 (observed)2 
BK622VH6DJ, IGH, IGH@Myosin-reactive immunoglobulin heavy chain variable regionIPI00384395-.QVQLQQSGPGLVK.P690.9 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00382682-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00739205-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159-.QVQLVQSGAEVK.K1286.7 (observed)1 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00386140-.QVQLVQSGAEVK.K1286.7 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00470652-.QVQLVQSGAEVK.K1286.7 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L939.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L939.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L941.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L941.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998-.QVQLVQSGGGLVQPGGSLR.L3 
A5789PAMPeptidyl-glycine alpha-amidating monooxygenase precursorIPI00177543-.RTIPPEANIPIPVKSD.M873.71 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382436-.SELTQDPAVSVALGQTVR.I936.29 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382436-.SELTQDPAVSVALGQTVR.I936.29 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382436-.SELTQDPAVSVALGQTVR.I935.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382436-.SELTQDPAVSVALGQTVR.I935.88 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQ.G593.31 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQ.G593.31 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260-.SPPGKPQGPPPQ.G593.31 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQ.G593.31 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGG.N651.84 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260-.SPPGKPQGPPPQGG.N651.84 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGG.N651.84 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGN.Q707.86 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGN.Q707.86 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGN.Q707.86 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGNQ.P771.39 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGNQ.P771.39 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQ.P771.39 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGNQPQ.G884.44 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQ.G884.44 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQGPPPPPGK.P3 peptide delta score: 53.47
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQGPPPPPGK.P3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQGPPPPPGK.P1 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGNQPQGPPPPPGKP.Q864.44 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038-.SPPGKPQGPPPQGGNQPQGPPPPPGKP.Q864.44 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQGPPPPPGKP.Q864.44 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00410352-.SPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK.P4 peptide delta score: 55.99
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162-.SYELTQPPSVSVSPGQTAR.I668.4 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752-.SYELTQPPSVSVSPGQTAR.I668.4 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752-.SYELTQPPSVSVSPGQTAR.I668.4 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752-.SYELTQPPSVSVSPGQTAR.I668.4 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752-.SYELTQPPSVSVSPGQTARIT.C1108.91 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00384399-.SYELTQPSSVSVSPGQTAR.I997.56 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00384399-.SYELTQPSSVSVSPGQTAR.I997.43 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382442-.YVLSQPPSVSVAPGQTAR.I928.5 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00385985-.YVLTQPPSVSVAPGE.T773.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00385985-.YVLTQPPSVSVAPGETAR.L937.5 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00385985-.YVLTQPPSVSVAPGETAR.L936.5 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956A.AACQAAGATVHPWR.S748.01 (observed)2 
A593CTCN1, TC1Transcobalamin I precursorIPI00299729A.AAQVLPALMGK.T1099.63 (observed)1 
A9713FCGBPIgG Fc binding proteinIPI00242956A.ACQAAGVAVKPWR.T707.51 (observed)2 
A6853KLK1, KALLIKREINKallikrein 1IPI00304808A.AHCISDNYQLWLGR.H866.41 (observed)2 
A1741HBA1, HBA2, HBZHemoglobin subunit alphaIPI00410714A.AHLPAEFTPAVHASLDK.F902.67 (observed)2 
A017D Hypothetical proteinIPI00414884A.APEPHPSPSLEQANQ.-800.88 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.APSVTLFPPSSEELQANK.A958.73 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.ASSYLSLTPEQWK.S755.79 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.ASSYLSLTPEQWK.S1509.76 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.ASSYLSLTPEQWK.S754.88 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.ASSYLSLTPEQWK.S755.79 (observed)2 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.AVDSGVMGISSDQVR.L761.19 (observed)2 
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorIPI00022974A.AVVDVIRELGICPDDAAVIPIK.N1182.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.CEVTHQGLSSPVTK.S1542.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.CEVTHQGLSSPVTK.S772.02 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.CEVTHQGLSSPVTK.S771.93 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.CLVQGFFPQEPLSVTWSESGQGVTAR.N961.11 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.71 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.CLVQGFFPQEPLSVTWSESGQGVTAR.N960.58 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.CLVQGFFPQEPLSVTWSESGQGVTAR.N1441.01 (observed)2 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292A.CTCVPPHPQTAFCNSDLVIR.A791.03 (observed)3 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292A.CTCVPPHPQTAFCNSDLVIR.A1186.55 (observed)2 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292A.CTCVPPHPQTAFCNSDLVIR.A1186.44 (observed)2 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292A.CTCVPPHPQTAFCNSDLVIR.A791.14 (observed)3 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorIPI00010796A.DAPEEEDHVLVLR.K760.88 (observed)2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorIPI00010796A.DAPEEEDHVLVLR.K761.99 (observed)2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230A.DDEVDVDGTVEEDLGK.S867.69 (observed)2 
A033DUNQ472, AVLV472, UNQ472/PRO839Uncharacterized protein C5orf46IPI00410155A.DDKPDKPDDKPDDSGK.D885.9 (observed)2 
A033DUNQ472, AVLV472, UNQ472/PRO839Uncharacterized protein C5orf46IPI00410155A.DDKPDKPDDKPDDSGKDPKPDFPK.F899.32 (observed)3 
A033DUNQ472, AVLV472, UNQ472/PRO839Uncharacterized protein C5orf46IPI00410155A.DDKPDKPDDKPDDSGKDPKPDFPK.F1348.13 (observed)2 
A033DUNQ472, AVLV472, UNQ472/PRO839Uncharacterized protein C5orf46IPI00410155A.DDKPDKPDDKPDDSGKDPKPDFPK.F899.08 (observed)3 
A8405CST1Cystatin-SNIPI00305477A.DLNDEWVQR.A587.7 (observed)2 
A8405CST1Cystatin-SNIPI00305477A.DLNDEWVQR.A1176.07 (observed)1 
A8406CST4Cystatin S precursorIPI00032294A.DLNDEWVQR.A587.7 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.DLNDEWVQR.A1176.07 (observed)1 
A8406CST4Cystatin S precursorIPI00032294A.DLNDEWVQRALHFAISEYNKATEDEYYR.R1160.18 (observed)3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697A.DLPSLAADFVESK.D696.16 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.DLPSLAADFVESK.D696.16 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.DLQVLKPEPELVYEDLR.G1029.31 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.DLQVLKPEPELVYEDLR.G1029.31 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.DLQVLKPEPELVYEDLR.G1028.31 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.DLQVLKPEPELVYEDLR.G1028.31 (observed)2 
A1467FGAFibrinogen alpha/alpha-E chain precursorIPI00021885A.DSGEGDFLAEGGGVR.G733.17 (observed)2 
A1467FGAFibrinogen alpha/alpha-E chain precursorIPI00021885A.DSGEGDFLAEGGGVR.G733.17 (observed)2 
A8832HTN3, HIS2, CGNL1Histatin 3 precursorIPI00012026A.DSHAKRHHGYKR.K746.39 (observed)2 
A8832HTN3, HIS2, CGNL1Histatin 3 precursorIPI00012026A.DSHAKRHHGYKRKFHEK.H720.48 (observed)3 
A9071STATHStatherin precursorIPI00550456A.DSSEEYGYGPYQPVPEQPLYPQPYQPQYQQYTF.-1329.25 (observed)3 
A9071STATHStatherin precursorIPI00550456A.DSSEEYGYGPYQPVPEQPLYPQPYQPQYQQYTF.-1993.89 (observed)2 
A9071STATHStatherin precursorIPI00550456A.DSSEEYGYGPYQPVPEQPLYPQPYQPQYQQYTF.-1329.25 (observed)3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00448734A.EDMAMYYCAR.Y654.9 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EDPFIAIHAESK.L678.38 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EDPFIAIHAESK.L678.34 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EDPFIAIHAESK.L1356.77 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESK.L678.38 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESK.L678.34 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESK.L1356.77 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESK.L678.34 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESK.L1356.77 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EDPFIAIHAESK.L678.38 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EDPFIAIHAESK.L678.34 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EDPFIAIHAESK.L1356.77 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EDPFIAIHAESKL.-735.71 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESKL.-735.71 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EDPFIAIHAESKL.-735.71 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EDPFIAIHAESKL.-735.71 (observed)2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362A.EEEDKKEDVGTVVGIDLGTTYSCVGVFK.N1025.72 (observed)3 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215A.EELPNYLVTLPAR.L758.63 (observed)2 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215A.EELPNYLVTLPAR.L757.85 (observed)2 
A104CMCFD2, SDNSFNeural stem cell derived neuronal survival proteinIPI00328680A.EEPAASFSQPGSMGLDK.N875.4 (observed)2 
A104CMCFD2, SDNSFNeural stem cell derived neuronal survival proteinIPI00328680A.EEPAASFSQPGSMGLDK.N876.19 (observed)2 
A5210TFF3, ITF, TFITrefoil factor 3 precursorIPI00018909A.EEYVGLSANQCAVPAK.D867.91 (observed)2 
A5210TFF3, ITF, TFITrefoil factor 3 precursorIPI00018909A.EEYVGLSANQCAVPAKDR.V1004.39 (observed)2 
A9905FAM3B, PRED44, UNQ320/PRO365Protein FAM3B precursorIPI00067738A.ELIPDAPLSSAAYSIR.S851.45 (observed)2 
A9905FAM3B, PRED44, UNQ320/PRO365Protein FAM3B precursorIPI00067738A.ELIPDAPLSSAAYSIR.S851.45 (observed)2 
A8269IGHG2Ig gamma-2IPI00426051A.ENTAVYYCAR.S623.78 (observed)2 
A8269IGHG2Ig gamma-2IPI00426051A.ENTAVYYCAR.S623.78 (observed)2 
A8269IGHG2Ig gamma-2IPI00426051A.ENTAVYYCAR.S623.78 (observed)2 
A2402PRB4Basic salivary proline-rich protein 4IPI00019482A.ESSSEDVSQEESLFLISGKPEGR.R837.01 (observed)3 
A2402PRB4Basic salivary proline-rich protein 4IPI00019482A.ESSSEDVSQEESLFLISGKPEGR.R1256.43 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.EVENDEMPADLPSLAADFVESK.D1203.53 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EYMNHLIDIGVAGFR.L867.43 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EYMNHLIDIGVAGFR.L578.76 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.EYMNHLIDIGVAGFR.L868.94 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EYMNHLIDIGVAGFR.L867.43 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EYMNHLIDIGVAGFR.L578.76 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EYMNHLIDIGVAGFR.L868.94 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EYMNHLIDIGVAGFR.L578.76 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.EYMNHLIDIGVAGFR.L868.94 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EYMNHLIDIGVAGFR.L867.43 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EYMNHLIDIGVAGFR.L578.76 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.EYMNHLIDIGVAGFR.L868.94 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373A.FAECHALVDSTAYLAACAQDLCR.C1322.09 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.FAQYLQQCPFEDHVK.L955.36 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.FAQYLQQCPFEDHVK.L955.77 (observed)2 
A6042CPCeruloplasmin precursorIPI00017601A.FFHGQALTNK.N581.33 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.FHDNEETFLK.K1279.56 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.FHDNEETFLK.K640.27 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.FHDNEETFLKK.Y704.27 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.FLEGVQCEVQLVESGGGLVKPGGSLR.L905.06 (observed)3 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729A.FQALGSLNDLQFFR.Y827.93 (observed)2 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.FTALLTTQTQVQR.E754.25 (observed)2 
A8459PRH1, PRH2Salivary acidic proline-rich phosphoprotein 1/2 precursorIPI00440162A.GDGNQDDGPQQGPPQQGGQQQQGPPPPQGK.P1007.79 (observed)3 
A8459PRH1, PRH2Salivary acidic proline-rich phosphoprotein 1/2 precursorIPI00440162A.GDGNQDDGPQQGPPQQGGQQQQGPPPPQGK.P1007.96 (observed)3 
A8459PRH1, PRH2Salivary acidic proline-rich phosphoprotein 1/2 precursorIPI00796909A.GDGNQDDGPQQGPPQQGGQQQQGPPPPQGK.P1007.79 (observed)3 
A8459PRH1, PRH2Salivary acidic proline-rich phosphoprotein 1/2 precursorIPI00796909A.GDGNQDDGPQQGPPQQGGQQQQGPPPPQGK.P1007.96 (observed)3 
A8459PRH1, PRH2Salivary acidic proline-rich phosphoprotein 1/2 precursorIPI00796909A.GDGNQDDGPQQGPPQQGGQQQQGPPPPQGK.P1007.96 (observed)3 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00790669A.GDVAFVK.H735.4 (observed)1 
A643CTF, PRO1400Serotransferrin precursorIPI00022463A.GDVAFVK.H735.4 (observed)1 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275A.GDVAFVK.H735.4 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GGASILTFWDAR.L647.54 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GGASILTFWDAR.L1294.72 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GGASILTFWDAR.L647.54 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GGASILTFWDAR.L647.54 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GGASILTFWDAR.L1294.72 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GGASILTFWDAR.L647.54 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GGASILTFWDAR.L1294.72 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GGASILTFWDAR.L647.54 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GGASILTFWDAR.L647.54 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GGASILTFWDAR.L1294.72 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GGASILTFWDAR.L647.54 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373A.GGAVCEQPLGLECR.A773.07 (observed)2 
A1494FGG, PRO2061Fibrinogen gamma chain precursorIPI00021891A.GGDAGDAFDGFDFGDDPSDK.F1003.43 (observed)2 
A1494FGG, PRO2061Fibrinogen gamma chain precursorIPI00021891A.GGDAGDAFDGFDFGDDPSDK.F1003.43 (observed)2 
A3850KRT4, CYK4Keratin, type II cytoskeletal 4IPI00742691A.GGFGAGFGTGGFGGGFGGSFSGK.G986.42 (observed)2 
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalIPI00021304A.GGGGGFGAAGGFGGR.G591.08 (observed)2 
A8402CST5Cystatin D precursorIPI00002851A.GGIHATDLNDK.S571.24 (observed)2 
A8402CST5Cystatin D precursorIPI00002851A.GGIHATDLNDK.S1142.79 (observed)1 
A8402CST5Cystatin D precursorIPI00002851A.GGIHATDLNDK.S570.28 (observed)2 
A8402CST5Cystatin D precursorIPI00002851A.GGIHATDLNDK.S1140.81 (observed)1 
A795ANPDC1Neural proliferation differentiation and control protein-1 precursorIPI00299699A.GHPDVAACPGSLDCALK.R883.91 (observed)2 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.GKMYGPGGGK.Y953.48 (observed)1 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.GKMYGPGGGKYFSTTEDYDHEITGLR.V960.14 (observed)3 
A826DPRB2Salivary proline-rich protein 2IPI00385294A.GNPQGAPPQGGNKPQGPPSPPGK.P1083.56 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.GNPQGPSPQGGNKPQGPPPPPGK.P1096.29 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.GNPQGPSPQGGNKPQGPPPPPGK.P1096.29 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260A.GNPQGPSPQGGNKPQGPPPPPGK.P1096.29 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GSKPFIYQEVIDLGGEPIK.S697.21 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GSKPFIYQEVIDLGGEPIK.S1046.02 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GSKPFIYQEVIDLGGEPIK.S1045.82 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GSKPFIYQEVIDLGGEPIK.S697.21 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GSKPFIYQEVIDLGGEPIK.S1046.02 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GSKPFIYQEVIDLGGEPIK.S1045.82 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GSKPFIYQEVIDLGGEPIK.S1045.82 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GSKPFIYQEVIDLGGEPIK.S697.21 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GSKPFIYQEVIDLGGEPIK.S1046.02 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GSKPFIYQEVIDLGGEPIK.S1045.82 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.GSSVAVLCPYNR.K1322.95 (observed)1 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.GTSNLSETEPPLWK.E780.85 (observed)2 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.GTSNLSETEPPLWK.E779.93 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GTSSTCGSYFNPGSR.D789.42 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GTSSTCGSYFNPGSR.D788.83 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTSSTCGSYFNPGSR.D1577.67 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTSSTCGSYFNPGSR.D789.42 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTSSTCGSYFNPGSR.D788.83 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTSSTCGSYFNPGSR.D788.83 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTSSTCGSYFNPGSR.D1577.67 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTSSTCGSYFNPGSR.D789.42 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTSSTCGSYFNPGSR.D1577.67 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTSSTCGSYFNPGSR.D788.83 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GTYCDVISGDK.I1214.51 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.GTYCDVISGDK.I608.1 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTYCDVISGDK.I1214.51 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTYCDVISGDK.I608.1 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTYCDVISGDK.I1214.51 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.GTYCDVISGDK.I608.1 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTYCDVISGDK.I1214.51 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.GTYCDVISGDK.I608.1 (observed)2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102A.GVASLLTTAEVVVTEIPKEEK.D1107.42 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.HFSISNSAEDPFIAIHAESK.L733.94 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.HFSISNSAEDPFIAIHAESK.L1100.57 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.HFSISNSAEDPFIAIHAESK.L734 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESK.L733.94 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESK.L1100.57 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESK.L734 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESK.L1100.57 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESK.L734 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HFSISNSAEDPFIAIHAESK.L733.94 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HFSISNSAEDPFIAIHAESK.L1100.57 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HFSISNSAEDPFIAIHAESK.L734 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.HFSISNSAEDPFIAIHAESKL.-771.16 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESKL.-771.16 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HFSISNSAEDPFIAIHAESKL.-771.16 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HFSISNSAEDPFIAIHAESKL.-771.16 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.HPYGFTR.V878.4 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HPYGFTR.V878.4 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HPYGFTR.V877.43 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.HPYGFTR.V877.43 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HPYGFTR.V878.4 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.HPYGFTR.V877.43 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00382682A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00739205A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00009792A.HSQVQLVQSGAEVK.K755.18 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.ICYGFSPWGQGTLVTVSSASPTSPK.V1314.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.IDYWGQGTLVTVSSASPTSPK.V1097.85 (observed)2 
A9820CCL28, SCYA28Small inducible cytokine A28 precursorIPI00016593A.ILPIASSCCTEVSHHISR.R1034.24 (observed)2 
A9820CCL28, SCYA28Small inducible cytokine A28 precursorIPI00016593A.ILPIASSCCTEVSHHISR.R1033.45 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFR.E859.64 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFR.E859.64 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFREIENK.A1166.46 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFREIENK.A777.94 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFREIENK.A1166.46 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.KADAAPDEKVLDSGFREIENK.A777.94 (observed)3 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729A.KAYLEEECPATLR.K789.98 (observed)2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729A.KAYLEEECPATLR.K790.08 (observed)2 
A7433PLOD1, LLH, PLODProcollagen-lysine,2-oxoglutarate 5-dioxygenase 1 precursorIPI00027192A.KGDAKPEDNLLVLTVATK.E956.54 (observed)2 
A4665CEACAM5, CEACarcinoembryonic antigen-related cell adhesion molecule 5IPI00027486A.KLTIESTPFNVAEGK.E817.89 (observed)2 
A4666CEA, CEACAM6, NCACarcinoembryonic antigen-related cell adhesion molecule 6 precursorIPI00027412A.KLTIESTPFNVAEGK.E817.89 (observed)2 
A1176APOEApolipoprotein E precursorIPI00021842A.KVEQAVETEPEPELR.Q878.01 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.KYICENQDSISSK.L786.49 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.LASSSKEENRIIPGGIYDADLNDEWVQR.A1059.04 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382A.LAWSPQEEDR.I616.12 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382A.LAWSPQEEDR.I616.12 (observed)2 
A8402CST5Cystatin D precursorIPI00002851A.LDFAISEYNK.V1199.59 (observed)1 
A8402CST5Cystatin D precursorIPI00002851A.LDFAISEYNK.V600.3 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LEDLLLGSEANLTCTLTGLR.D1095.11 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111A.LEESNYELEGK.I655.3 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111A.LEESNYELEGK.I655.3 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111A.LEESNYELEGK.I655.3 (observed)2 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.LGGNTQEVTLQPGEYITK.V974 (observed)2 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.LGGNTQEVTLQPGEYITK.V974.08 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.LGKDYVRSKIAEYMNHLIDIGVAGFR.I988.3 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.LGKDYVRSKIAEYMNHLIDIGVAGFR.I988.45 (observed)3 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729A.LGSLNDLQFFR.Y1309.69 (observed)1 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729A.LGSLNDLQFFR.Y654.98 (observed)2 
A8405CST1Cystatin-SNIPI00305477A.LHFAISEYNK.A1221.73 (observed)1 
A8405CST1Cystatin-SNIPI00305477A.LHFAISEYNK.A611.05 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.LHFAISEYNK.A1221.73 (observed)1 
A8406CST4Cystatin S precursorIPI00032294A.LHFAISEYNK.A611.05 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.LHFAISEYNKATEDEYYR.R1126.25 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382A.LHFVISEYNK.A1249.53 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158A.LHRPDVYLLPPAR.E773.86 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158A.LHRPDVYLLPPAR.E773.86 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038A.LLQDNIADAVACAK.R1502.77 (observed)1 
A6935LYZ, LZMLysozyme C precursorIPI00019038A.LLQDNIADAVACAK.R752.21 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038A.LLQDNIADAVACAK.R750.84 (observed)2 
A162ATNFSF13, APRIL, TALL2Tumor necrosis factor ligand superfamily member 13IPI00027239A.LLTQQTELQSLR.R716.41 (observed)2 
A162ATNFSF13, APRIL, TALL2Tumor necrosis factor ligand superfamily member 13IPI00027239A.LLTQQTELQSLR.R716.41 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.LNELVTLTCLAR.G1402.77 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.LNELVTLTCLAR.G1402.77 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.LNELVTLTCLAR.G701.39 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.LNELVTLTCLAR.G701.45 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.LNELVTLTCLAR.G701.45 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.LNELVTLTCLAR.G701.45 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.LNELVTLTCLAR.G701.45 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LNELVTLTCLAR.G1402.77 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LNELVTLTCLAR.G701.39 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LNELVTLTCLAR.G701.45 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LNELVTLTCLAR.G701.45 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.LNELVTLTCLAR.G701.39 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.LNELVTLTCLAR.G701.45 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.39 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.39 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.39 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.45 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.45 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.LNELVTLTCLAR.G701.45 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.LPLAFTQK.T917.55 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.LPLAFTQK.T917.55 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.LPLAFTQK.T917.55 (observed)1 
A096CLRRC26, CAPCLeucine-rich repeat-containing protein 26 precursorIPI00374551A.LPPGAFAGAGALQR.L663.08 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.LQSGNSQESVTEQDSK.D868.69 (observed)2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654A.LQVTVPHFLDWSGEALQPTR.I1147.6 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.LVFVDNHDNQR.G679.18 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.LVFVDNHDNQR.G1356.82 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.LVFVDNHDNQR.G679.18 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.LVFVDNHDNQR.G679.18 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.LVFVDNHDNQR.G1356.82 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.LVFVDNHDNQR.G679.18 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.LVFVDNHDNQR.G1356.82 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.LVFVDNHDNQR.G679.18 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.LVFVDNHDNQR.G679.18 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.LVFVDNHDNQR.G1356.82 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.LVFVDNHDNQR.G679.18 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.LVLIAFAQYLQQCPFEDHVK.L1210.08 (observed)2 
A5065PCDH1Protocadherin 1 precursorIPI00000024A.LVQVSDR.D408.44 (observed)2 
A5065PCDH1Protocadherin 1 precursorIPI00000024A.LVQVSDR.D408.44 (observed)2 
A5065PCDH1Protocadherin 1 precursorIPI00000024A.LVQVSDR.D408.44 (observed)2 
A5065PCDH1Protocadherin 1 precursorIPI00000024A.LVQVSDR.D408.44 (observed)2 
A5066PCDH7, BHPCDHProtocadherin 7 precursorIPI00001893A.LVQVSDR.D408.44 (observed)2 
A5066PCDH7, BHPCDHProtocadherin 7 precursorIPI00001893A.LVQVSDR.D408.44 (observed)2 
A5066PCDH7, BHPCDHProtocadherin 7 precursorIPI00001893A.LVQVSDR.D408.44 (observed)2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439A.LVVDNGSGMCK.A1179.55 (observed)1 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00790669A.MAPNHAVVSR.M541.8 (observed)2 
A677BTMEM63ATransmembrane protein 63AIPI00006006A.MMDSPFLELWQSK.A806.61 (observed)2 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.NEDKDPAFTALLTTQTQVQR.E759.35 (observed)3 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.NEDKDPAFTALLTTQTQVQR.E1140.14 (observed)2 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.NEDKDPAFTALLTTQTQVQR.E1139.78 (observed)2 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.NEDKDPAFTALLTTQTQVQREIVNKHNELR.R877.71 (observed)4 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386137A.NFMLTQPHSVSESPGK.T879.42 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386839A.NFMLTQPHSVSESPGK.T879.42 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386839A.NFMLTQPHSVSESPGK.T879.43 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00419442A.NFMLTQPHSVSESPGK.T879.42 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00419442A.NFMLTQPHSVSESPGK.T879.43 (observed)2 
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorIPI00012503A.NIPLLLYPQDGPR.S747.91 (observed)2 
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorIPI00012503A.NIPLLLYPQDGPR.S747.91 (observed)2 
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorIPI00012503A.NIPLLLYPQDGPR.S747.91 (observed)2 
A0497SDCBP, MDA9, SYCLSyntenin 1IPI00299086A.NPANPAILSEASAPIPHDGNLYPR.L1258.88 (observed)2 
A0497SDCBP, MDA9, SYCLSyntenin 1IPI00479018A.NPANPAILSEASAPIPHDGNLYPR.L1258.88 (observed)2 
A9890DNER, BET, UNQ262/PRO299Delta-Notch-like EGF repeat-containing transmembrane proteinIPI00333140A.NPVPAAPLSAPGPCAAQPCR.N1016.29 (observed)2 
A096CLRRC26, CAPCLeucine-rich repeat-containing protein 26 precursorIPI00374551A.NQLEALAPGTFAPLR.A798.93 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038A.NWMCLAK.W922.43 (observed)1 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798A.PCASCPDNCDDGLCTNGCK.Y1100.83 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.PDGLAVLAAFVEVK.N1428.81 (observed)1 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.PDGLAVLAAFVEVK.N1429.79 (observed)1 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.PDGLAVLAAFVEVK.N715.46 (observed)2 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.PDNEQNILWGLPLQYGWQYR.T1245.61 (observed)2 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.PDTELGSSEYSK.A1313.59 (observed)1 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.PDTELGSSEYSK.A657.75 (observed)2 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.PDTELGSSEYSK.A1313.74 (observed)1 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439A.PEEHPVLLTEAPLNPK.A892.46 (observed)2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440A.PEEHPVLLTEAPLNPK.A892.46 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.PELLFFAK.R482.27 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.PELLFFAK.R964.55 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.PELLFFAK.R964.53 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384938A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00423463A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448938A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784828A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00807531A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00472345A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610A.PELLGGPSVFLFPPKPK.D911.89 (observed)2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654A.PEPLELTLPVELLADTR.V953.58 (observed)2 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.PFISDFTAFQNVVLVLLNMLDNVDK.S1427.75 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAQFGQGSGPIVLDDVR.C963.62 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C1957.96 (observed)1 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110A.PGNAWFGQGSGPIALDDVR.C978.99 (observed)2 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.PNFVMSAAHCVANVNVR.A944.15 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.PPAGQPQGPPRPPQGGR.P846.94 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260A.PPAGQPQGPPRPPQGGR.P846.94 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.PPAGQPQGPPRPPQGGRPSRPPQ.-1178.12 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.PPAGQPQGPPRPPQGGRPSRPPQ.-786.19 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.PPAGQPQGPPRPPQGGRPSRPPQ.-1178.12 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.PPAGQPQGPPRPPQGGRPSRPPQ.-786.19 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260A.PPAGQPQGPPRPPQGGRPSRPPQ.-1178.12 (observed)2 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260A.PPAGQPQGPPRPPQGGRPSRPPQ.-786.19 (observed)3 
A826DPRB2Salivary proline-rich protein 2IPI00248922A.PPAGQPQGPPRPPQGGRPSRPPQ.-1178.12 (observed)2 
A826DPRB2Salivary proline-rich protein 2IPI00248922A.PPAGQPQGPPRPPQGGRPSRPPQ.-786.19 (observed)3 
A826DPRB2Salivary proline-rich protein 2IPI00385294A.PPQGGNKPQGPPSPPGK.P820.11 (observed)2 
A826DPRB2Salivary proline-rich protein 2IPI00385294A.PPQGGNKPQGPPSPPGKPQGPPPQGGNQPQGPPPPPGK.P1217.76 (observed)3 
A826DPRB2Salivary proline-rich protein 2IPI00385294A.PPQGGNKPQGPPSPPGKPQGPPPQGGNQPQGPPPPPGK.P1217.76 (observed)3 
A329ESMR3B, PBII, PRL3Submaxillary gland androgen-regulated protein 3 homolog B precursorIPI00023011A.PPQPFGPGFVPPPPPPPYGPGR.I1126.08 (observed)2 
A329ESMR3B, PBII, PRL3Submaxillary gland androgen-regulated protein 3 homolog B precursorIPI00023011A.PPQPFGPGFVPPPPPPPYGPGR.I1126.08 (observed)2 
A8400CSTB, CST6, STFBCystatin BIPI00021828A.PSATQPATAETQHIADQVR.S1010.5 (observed)2 
A8400CSTB, CST6, STFBCystatin BIPI00021828A.PSATQPATAETQHIADQVR.S673.81 (observed)3 
A8400CSTB, CST6, STFBCystatin BIPI00021828A.PSATQPATAETQHIADQVR.S1010.5 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.PSVFIFPPSDEQLK.S801.92 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.PSVFIFPPSDEQLK.S1603.83 (observed)1 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.PVAQFVNWIDSIIQR.S893.49 (observed)2 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.PVAQFVNWIDSIIQR.S1786.97 (observed)1 
A329ESMR3B, PBII, PRL3Submaxillary gland androgen-regulated protein 3 homolog B precursorIPI00023011A.PYGPGIFPPPPPQP.-730.95 (observed)2 
A329ESMR3B, PBII, PRL3Submaxillary gland androgen-regulated protein 3 homolog B precursorIPI00023011A.PYGPGIFPPPPPQP.-730.88 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QDAPDGLAVLAAFVEVK.N872.49 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QDAPDGLAVLAAFVEVK.N872.2 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QHVSDWTYSEGALDEAHWPQHYPACGGQR.Q1690.72 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QHVSDWTYSEGALDEAHWPQHYPACGGQR.Q1127.15 (observed)3 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QHVSDWTYSEGALDEAHWPQHYPACGGQR.Q845.61 (observed)4 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.QNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGK.P1348.98 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00023038A.QNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGK.P1348.98 (observed)3 
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorIPI00399260A.QNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGK.P1348.98 (observed)3 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.QQMHFHWGGASSEISGSEHTVDGIR.H918.27 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00658130A.QSALTQPR.S2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00658130A.QSALTQPR.S2 
A827DPRB3Basic salivary proline-rich protein 3IPI00006699A.QSLNEDVSQEESPSVISGKPEGR.P1236.08 (observed)2 
A827DPRB3Basic salivary proline-rich protein 3IPI00006699A.QSLNEDVSQEESPSVISGKPEGR.P1236.29 (observed)2 
A827DPRB3Basic salivary proline-rich protein 3IPI00006699A.QSLNEDVSQEESPSVISGKPEGR.P825.12 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00555945A.QSVLTQPPSASGTPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480035A.QSVLTQPPSVSGAPGQR.V1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.QYLQQCPFEDHVK.L846.79 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.QYSSNTQQGR.T1169.58 (observed)1 
A8406CST4Cystatin S precursorIPI00032294A.REQTFGGVNYFFDVEVGR.T1060.99 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.REQTFGGVNYFFDVEVGR.T1060.36 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.RLYKMAVGFMLAHPYGFTR.V1128.08 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.RLYKMAVGFMLAHPYGFTR.V1128.08 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.RLYKMAVGFMLAHPYGFTR.V1128.08 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.RLYKMAVGFMLAHPYGFTR.V1128.08 (observed)2 
A2481ARSAArylsulfatase A precursorIPI00329685A.RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLR.F1414.57 (observed)3 
A8405CST1Cystatin-SNIPI00305477A.RQQTVGGVNYFFDVEVGR.T1037.02 (observed)2 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.RWLPAEYEDGLSLPFGWTPGK.T1210.11 (observed)2 
A9866PIF, DCD, AIDDDermcidin precursorIPI00027547A.SAPGSGNPCHEASAAQK.E834.25 (observed)2 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.SEHILLATSHTLFLR.E579.32 (observed)3 
A125AFRP1, SFRP1, FRPFrizzled-related proteinIPI00749245A.SEYDYVSFQSDIGPYQSGR.F1099.92 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.SGATFTWTPSSGK.S663.32 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952A.SGATFTWTPSSGK.S663.96 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.SGATFTWTPSSGK.S663.32 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.SGATFTWTPSSGK.S663.32 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.SGATFTWTPSSGK.S663.32 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.SGATFTWTPSSGK.S663.32 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.SGATFTWTPSSGK.S663.32 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.SGATFTWTPSSGK.S663.32 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.SGATFTWTPSSGK.S1326.39 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.SGATFTWTPSSGK.S663.32 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.SGATFTWTPSSGK.S663.96 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067A.SGATFTWTPSSGK.S663.96 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S1326.39 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S663.32 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S1326.39 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S663.32 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S1326.39 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S663.96 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993A.SGATFTWTPSSGK.S663.96 (observed)2 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.SGLYPDAFAPVAQFVNWIDSIIQR.S1354.2 (observed)2 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.SGLYPDAFAPVAQFVNWIDSIIQR.S903.13 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.33 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.33 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.33 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.33 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.33 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.SGVTFTWTPSSGK.S1354.45 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.SGVTFTWTPSSGK.S677.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.SGVTFTWTPSSGK.S677.67 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920A.SGVTFTWTPSSGK.S1355.69 (observed)1 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262A.SHTSDSDVPSGVTEVVVK.L922.11 (observed)2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262A.SHTSDSDVPSGVTEVVVK.L922.11 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.SILTFWDAR.L554.42 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.SILTFWDAR.L1108.68 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.SILTFWDAR.L554.74 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SILTFWDAR.L554.42 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SILTFWDAR.L1108.68 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SILTFWDAR.L554.74 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SILTFWDAR.L1108.68 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SILTFWDAR.L554.74 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.SILTFWDAR.L554.42 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.SILTFWDAR.L1108.68 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.SILTFWDAR.L554.74 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.SKHMWPGDIK.A599.65 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SKHMWPGDIK.A599.65 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.SKHMWPGDIK.A599.65 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.SKHMWPGDIK.A599.65 (observed)2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102A.SLLTTAEVVVTEIPKEEK.D993.98 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384401A.SQSISSNLAWYQQKPGQAPR.L1123.42 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115A.SQSVSNSYLAWYQQKPGQAPR.L1197.1 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205A.SQSVSSSYLAWYQQKPGQAPR.L1184.85 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384402A.SQSVSSSYLAWYQQKPGQAPR.L1184.85 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384576A.SQSVSSSYLAWYQQKPGQAPR.L1184.85 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387116A.SQSVSSSYLAWYQQKPGQAPR.L1184.85 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.SQWISDWLAWYQQKPGK.A1059.82 (observed)2 
A9820CCL28, SCYA28Small inducible cytokine A28 precursorIPI00016593A.SSCCTEVSHHISR.R781.14 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.SSEISGSEHTVDGIR.H787.22 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105A.SSEISGSEHTVDGIR.H787.24 (observed)2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654A.SSNVGFIDTDQVR.T718.85 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.SSSKEENRIIPGGIYDADLNDEWVQR.A997.83 (observed)3 
A8406CST4Cystatin S precursorIPI00032294A.SSSKEENRIIPGGIYDADLNDEWVQR.A998.15 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.SSYLSLTPEQWK.S719.64 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.SSYLSLTPEQWK.S719.64 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.SSYLSLTPEQWK.S719.64 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.SSYLSLTPEQWK.S719.59 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.SSYLSLTPEQWK.S719.64 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.SSYLSLTPEQWK.S719.59 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545A.SSYLSLTPEQWK.S719.59 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.SSYLSLTPEQWK.S1439.5 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SSYLSLTPEQWK.S719.64 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SSYLSLTPEQWK.S719.59 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SSYLSLTPEQWK.S1439.5 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.SVDSGSSEEQGGSSR.A734.31 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.SVDSGSSEEQGGSSR.A734.31 (observed)2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003A.SVSGKPQYMVLVPSLLHTETTEK.G1272.67 (observed)2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003A.SVSGKPQYMVLVPSLLHTETTEK.G848.52 (observed)3 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003A.SVSGKPQYMVLVPSLLHTETTEK.G1273.35 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.SVVCLLNNFYPR.E742.39 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.SVVCLLNNFYPR.E1483.76 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.SVVCLLNNFYPR.E742.39 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865A.SVVCLLNNFYPR.E1482.75 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162A.SYELTQPPSVSVSPGQTAR.I1004.01 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162A.SYELTQPPSVSVSPGQTAR.I1002.51 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SYELTQPPSVSVSPGQTAR.I1004.01 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SYELTQPPSVSVSPGQTAR.I1004.01 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SYELTQPPSVSVSPGQTAR.I1002.51 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SYELTQPPSVSVSPGQTAR.I1002.51 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.SYELTQPPSVSVSPGQTAR.I1002.51 (observed)2 
A8400CSTB, CST6, STFBCystatin BIPI00021828A.TAETQHIADQVR.S684.35 (observed)2 
A8406CST4Cystatin S precursorIPI00032294A.TEDEYYR.R487.7 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382A.TEDEYYR.R487.7 (observed)2 
A1588ELANE, ELA2Elastase 2, neutrophil IPI00027769A.TLIAPNFVMSAAHCVANVNVR.A1143.17 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.TLRETYGEMADCCAK.Q902.86 (observed)2 
A615EBPIFB1, LPLUNC1, UNQ706/PRO1357Long palate, lung and nasal epithelium carcinoma associated protein 1 precursorIPI00291410A.TLSPTAVLILGPK.V655.46 (observed)2 
A615EBPIFB1, LPLUNC1, UNQ706/PRO1357Long palate, lung and nasal epithelium carcinoma associated protein 1 precursorIPI00291410A.TLSPTAVLILGPK.V1309.64 (observed)1 
A615EBPIFB1, LPLUNC1, UNQ706/PRO1357Long palate, lung and nasal epithelium carcinoma associated protein 1 precursorIPI00291410A.TLSPTAVLILGPK.V654.94 (observed)2 
A5989CTSL1, CTSL, MEPCathepsin L1 precursorIPI00012887A.TLTFDHSLEAQWTK.W838.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752A.TLVCLISDFYPGAVTVAWK.A1070.63 (observed)2 
A017D Hypothetical proteinIPI00414884A.TQLNVPPLPPR.G1231.44 (observed)1 
A8400CSTB, CST6, STFBCystatin BIPI00021828A.TQPATAETQHIADQVR.S884.59 (observed)2 
A8272IGJ, IGCJImmunoglobulin J chainIPI00178926A.TQSNICDEDSATETCYTYDR.N1214.98 (observed)2 
A8272IGJ, IGCJImmunoglobulin J chainIPI00178926A.TQSNICDEDSATETCYTYDR.N1215.17 (observed)2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260A.TTPEPCELDDEDFR.C862.36 (observed)2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260A.TTPEPCELDDEDFR.C862.43 (observed)2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654A.TVGLSQQLFDSALLLLQK.A987.5 (observed)2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654A.TVGLSQQLFDSALLLLQK.A658.43 (observed)3 
A1631HPHaptoglobin precursorIPI00641737A.VDSGNDVTDIADDGCPKPPEIAHGYVEHSVR.Y1117.32 (observed)3 
A043D Uncharacterized protein C6ORF58 precursorIPI00374315A.VDSGVMGISSDQVR.L724.91 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VGFMLAHPYGFTR.V748.08 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VGFMLAHPYGFTR.V748.67 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VGFMLAHPYGFTR.V748.08 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VGFMLAHPYGFTR.V498.58 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VGFMLAHPYGFTR.V748.67 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VGFMLAHPYGFTR.V498.58 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VGFMLAHPYGFTR.V748.67 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VGFMLAHPYGFTR.V748.08 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VGFMLAHPYGFTR.V498.58 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VGFMLAHPYGFTR.V748.67 (observed)2 
A9866PIF, DCD, AIDDDermcidin precursorIPI00027547A.VHDVKDVLDSVL.-669.85 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748998A.VISYDGSNKYYADSVK.G904.36 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00736507A.VISYDGSNKYYADSVK.G904.36 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00413194A.VISYDGSNKYYADSVK.G904.36 (observed)2 
A341EBPIFA2, SPLUNC2, UNQ510/PRO1025Short palate, lung and nasal epithelium carcinoma associated protein 2 precursorIPI00304557A.VLGECASDPTSISLSLLDK.H1003.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384938A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00423463A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448938A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784828A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00807531A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A8363IGHM, IgIg mu chain CIPI00472610A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A8363IGHM, IgIg mu chain CIPI00472610A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A8363IGHM, IgIg mu chain CIPI00472610A.VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK.V1351.42 (observed)3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697A.VMDDFAAFVEK.C635.8 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697A.VMDDFAAFVEK.C1271.6 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.VMDDFAAFVEK.C635.8 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872A.VMDDFAAFVEK.C1271.6 (observed)1 
A6935LYZ, LZMLysozyme C precursorIPI00019038A.VNACHLSCSALLQDNIADAVACAK.R868.08 (observed)3 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023A.VNQEVSDHGLPYLPYDSK.K1031.42 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VPYSGWDFNDGK.C692.77 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VPYSGWDFNDGK.C1385.65 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VPYSGWDFNDGK.C693.17 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VPYSGWDFNDGK.C692.77 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VPYSGWDFNDGK.C1385.65 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VPYSGWDFNDGK.C693.17 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VPYSGWDFNDGK.C1385.65 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VPYSGWDFNDGK.C693.17 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VPYSGWDFNDGK.C692.77 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VPYSGWDFNDGK.C1385.65 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VPYSGWDFNDGK.C693.17 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VSAGTSSTCGSYFNPGSR.D917.59 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786A.VSAGTSSTCGSYFNPGSR.D917.64 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VSAGTSSTCGSYFNPGSR.D917.59 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VSAGTSSTCGSYFNPGSR.D917.64 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447A.VSAGTSSTCGSYFNPGSR.D917.64 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VSAGTSSTCGSYFNPGSR.D917.59 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476A.VSAGTSSTCGSYFNPGSR.D917.64 (observed)2 
A8401CST3Cystatin C precursorIPI00032293A.VSPAAGSSPGKPPR.L654.2 (observed)2 
A8401CST3Cystatin C precursorIPI00032293A.VSPAAGSSPGKPPR.L654.28 (observed)2 
A1611HRGHistidine-rich glycoprotein precursorIPI00022371A.VSPTDCSAVEPEAEK.A809.5 (observed)2 
A401D Uncharacterized proteinIPI00737141A.VSTEELEATVQEVLGR.L880.47 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.VTVSSASPTSPK.V2 peptide delta score: 59.35
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879A.VTVSSASPTSPK.V2 peptide delta score: 61.19
A8272IGJ, IGCJImmunoglobulin J chainIPI00178926A.VVPLVYGGETK.M1161.39 (observed)1 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918A.WFIENEEQEYVQTVK.S971.55 (observed)2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918A.WFIENEEQEYVQTVK.S971.55 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.WQLFVNEESTIPR.S1620.84 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573A.WQLFVNEESTIPR.S1620.84 (observed)1 
A8405CST1Cystatin-SNIPI00305477A.WSPKEEDRIIPGGIYNADLNDEWVQR.A1034.33 (observed)3 
A8405CST1Cystatin-SNIPI00305477A.WSPKEEDRIIPGGIYNADLNDEWVQR.A1033.84 (observed)3 
A8405CST1Cystatin-SNIPI00305477A.WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNK.A1459.48 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382A.WSPQEEDRIIEGGIYDADLNDER.V1361.36 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382A.WSPQEEDRIIEGGIYDADLNDER.V908.2 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382A.WSPQEEDRIIEGGIYDADLNDER.V1361.02 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382A.WSPQEEDRIIEGGIYDADLNDER.V907.51 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382A.WSPQEEDRIIEGGIYDADLNDERVQR.A1035.32 (observed)3 
A9866PIF, DCD, AIDDDermcidin precursorIPI00027547A.YDPEAASAPGSGNPCHEASAAQK.E1157.5 (observed)2 
A9866PIF, DCD, AIDDDermcidin precursorIPI00027547A.YDPEAASAPGSGNPCHEASAAQK.E1157.58 (observed)2 
A9866PIF, DCD, AIDDDermcidin precursorIPI00027547A.YDPEAASAPGSGNPCHEASAAQKENAGEDPGLAR.Q1142.5 (observed)3 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.YPSQEGQVLVGIYGQYQLLGIK.S1227.16 (observed)2 
A722CZG16B, UNQ773/PRO1567, EECPZymogen granule protein 16 homolog BIPI00060800A.YPSQEGQVLVGIYGQYQLLGIK.S1226.28 (observed)2 
A8402CST5Cystatin D precursorIPI00002851A.YQQIVGGVNYYFNVK.F896.46 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387098B.LLIYAASBLHSGVPSR.F849.81 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.AEDYLSVVLNQLCVLHEK.T1065.05 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.AEDYLSVVLNQLCVLHEK.T710.39 (observed)3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.AEDYLSVVLNQLCVLHEK.T1065.05 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.AEDYLSVVLNQLCVLHEK.T710.39 (observed)3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.AEDYLSVVLNQLCVLHEK.T1065.07 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.AEDYLSVVLNQLCVLHEK.T710.25 (observed)3 
A8405CST1Cystatin-SNIPI00305477C.AFHEQPELQKK.Q452.56 (observed)3 
A8406CST4Cystatin S precursorIPI00032294C.AFHEQPELQKK.Q452.56 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382C.AFHEQPELQKK.Q452.56 (observed)3 
BK622VH6DJ, IGH, IGH@Myosin-reactive immunoglobulin heavy chain variable regionIPI00384395C.AISGDSVSSNSAAWNWIR.Q960.96 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNK.V1270.88 (observed)1 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNK.V635.47 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNK.V1272.75 (observed)1 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNK.V636.82 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNKVINK.D862.46 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.ALDFAISEYNKVINK.D575.31 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F1068.92 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F534.87 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F1068.92 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F534.87 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F1068.49 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F534.59 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F1068.49 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ALGPEVANVAK.F534.59 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.04 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.53 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T765.36 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.AQPWNHGETFTCTAAHPELK.T1148.34 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.ARDSCNGAICYGFSPWGQGTLVTVSSASPTSPK.V1153.42 (observed)3 
A341EBPIFA2, SPLUNC2, UNQ510/PRO1025Short palate, lung and nasal epithelium carcinoma associated protein 2 precursorIPI00304557C.ASDPTSISLSLLDK.H723.6 (observed)2 
A341EBPIFA2, SPLUNC2, UNQ510/PRO1025Short palate, lung and nasal epithelium carcinoma associated protein 2 precursorIPI00304557C.ASDPTSISLSLLDK.H723.59 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.CAAADPHECYAK.V1392.56 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.CAAADPHECYAK.V1392.56 (observed)1 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.CEMEQQNQEYK.I743.62 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.CEMEQQNQEYK.I743.62 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.CEMEQQNQEYK.I743.62 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.CHGDLLECADDR.A730.3 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.CHGDLLECADDR.A1460.59 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.CHGDLLECADDR.A730.3 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.CHGDLLECADDR.A1460.59 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.DAQGQPPPCNRPGFVTVTR.P1049.15 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.43 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.43 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.43 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.43 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.57 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.57 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.57 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTNDANVVCR.Q833.57 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTSDANVVCR.Q820.18 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTSDANVVCR.Q820.18 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTSDANVVCR.Q820.18 (observed)2 
A938BDMBT1, GP340, Gp-340DMBT1 prototype precursorIPI00099110C.DDSWDTSDANVVCR.Q820.18 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.DFYNPHGGCEWHYQPCGAPCLK.T898.33 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.DIQLTQSPSFLSASVGDR.V961.15 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.DIQLTQSPSFLSASVGDR.V961.69 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.DIQMTQSPSSLSASVGDR.V3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.DIQMTQSPSSLSASVGDR.V3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.DIQMTQSPSSLSASVGDR.V3 peptide delta score: 69.05
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.DIQMTQSPSSLSASVGDR.V3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.DIQMTQSPSSLSASVGDR.V1 peptide delta score: 118.5
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.DIQMTQSPSSLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.DIQMTQSPSSLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.DIQMTQSPSSLSASVGDR.V3 peptide delta score: 69.05
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.DIQMTQSPSSLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.DIQMTQSPSSLSASVGDR.V1 peptide delta score: 118.5
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00376441C.DIQMTQSPSSLSASVGGR.V911.57 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00376441C.DIQMTQSPSSLSASVGGR.V911.57 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.DIQMTQSPSSVSASVGDR.V3 peptide delta score: 41.85
A8273IGK, SDNK1, A30Ig kappa chainIPI00387024C.DIQMTQSPSTLSASVGDR.V1893.9 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.DIQMTQSPSTLSASVGDR.V1893.9 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.DIQMTQSPSTLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.DIQMTQSPSTLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024C.DIQMTQSPSTLSASVGDR.V1893.9 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024C.DIQMTQSPSTLSASVGDR.V3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00738024C.DIQMTQSPSTLSASVGDR.V3 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023C.DLSQPQTLEELNTVLK.S913.99 (observed)2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673C.DNLWDLTDASVVCR.A832.48 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.DVISGDKINGNCTGIK.I845.55 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.DVISGDKINGNCTGIK.I845.55 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.DVISGDKINGNCTGIK.I845.55 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.DVISGDKINGNCTGIK.I845.55 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.DVVVNTLGK.R944.77 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.DVVVNTLGK.R944.77 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.EAEGGVHLLTPQPASCPDVSSCR.G1233.98 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.EAEGGVHLLTPQPASCPDVSSCR.G822.77 (observed)3 
A593CTCN1, TC1Transcobalamin I precursorIPI00299729C.EICEVSEENYIR.L771.2 (observed)2 
A593CTCN1, TC1Transcobalamin I precursorIPI00299729C.EICEVSEENYIR.L770.68 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784828C.EIQLVESGGGLVQPGGSLR.L948.95 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.ELFEQLGEYK.F628.49 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.ELFEQLGEYK.F628.49 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.ENSPSDTSSVAVGCLAQDFLPDSITFSWK.Y1053.25 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784842C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382493C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382493C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382493C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382497C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382497C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382497C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A8363IGHM, IgIg mu chain CIPI00220120C.EVQLLESGGGLVQPGGSLR.L948.01 (observed)2 
A8363IGHM, IgIg mu chain CIPI00220120C.EVQLLESGGGLVQPGGSLR.L632.55 (observed)3 
A8363IGHM, IgIg mu chain CIPI00220120C.EVQLLESGGGLVQPGGSLR.L949.6 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00737304C.EVQLVESGEGLVQPGGSLR.L977.42 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00737304C.EVQLVESGEGLVQPGGSLR.L977.52 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00442909C.EVQLVESGGGLVKPGESLR.L1954.06 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00442909C.EVQLVESGGGLVKPGESLR.L977.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00442909C.EVQLVESGGGLVKPGESLR.L977.33 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQ.P1314.85 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQ.P1314.85 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQ.P1314.85 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQ.P1314.85 (observed)1 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQ.P1314.85 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00430842C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00555872C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382480C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00384392C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00384392C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479553C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479553C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00479553C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
A8363IGHM, IgIg mu chain CIPI00472610C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L1884.04 (observed)1 
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L942.51 (observed)2 
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 62.27
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 85.2
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.68
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 51.65
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 61.52
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L1 peptide delta score: 92.61
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
BL309 DUNQU1 protein isoform 1IPI00396930C.EVQLVESGGGLVQPGGSLR.L3 peptide delta score: 80.99
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S1624.86 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S813.02 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S1624.86 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S813.02 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S813.26 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.EVQLVESGGGLVQPGR.S813.26 (observed)2 
A8268IGHD, VSIG6Ig delta chainIPI00163446C.EVQLVESGGGLVQPGR.S813.26 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.36 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTK.S692.37 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTK.S1385.74 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTK.S1382.69 (observed)1 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTK.S691.37 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTKSFNRGEC.-1116.51 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.EVTHQGLSSPVTKSFNRGEC.-744.79 (observed)3 
A6946MAN1A1Mannosyl-oligosaccharide 1,2-alpha-mannosidase IAIPI00291641C.FGAIFFLPDSSK.L664.34 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111C.FGGSSGGYGGLGGFGGGSFR.G890.77 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111C.FGGSSGGYGGLGGFGGGSFR.G890.77 (observed)2 
A3824KRT10, KPPKeratin, type I cytoskeletal 10IPI00383111C.FGGSSGGYGGLGGFGGGSFR.G890.77 (observed)2 
A5210TFF3, ITF, TFITrefoil factor 3 precursorIPI00018909C.FKPLQEAECTF.-685.58 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.FLQHKDDNPNLPR.L797.39 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.FSALEVDETYVPK.E1497.75 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.FSALEVDETYVPK.E749.15 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.FSALEVDETYVPK.E1497.75 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.FSALEVDETYVPK.E749.15 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.FSALEVDETYVPK.E749.13 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.GAHSDGQLQEGSPIQAWQLFVNEESTIPR.S1065.85 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.GAHSDGQLQEGSPIQAWQLFVNEESTIPR.S1065.85 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.GAHSDGQLQEGSPIQAWQLFVNEESTIPR.S1065.11 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.GAHSDGQLQEGSPIQAWQLFVNEESTIPR.S1065.11 (observed)3 
A8400CSTB, CST6, STFBCystatin BIPI00021828C.GAPSATQPATAETQHIADQVR.S1074.53 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A8270IGHG3Ig gamma-3 chainIPI00783993C.GCYSVSSVLPGCAQPWNHGETFTCTAAHPELK.T1187.87 (observed)3 
A9713FCGBPIgG Fc binding proteinIPI00242956C.GLLSSPTGPLSSCHK.L770.65 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.GNDWVCEHR.W586.63 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GNDWVCEHR.W586.63 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GNDWVCEHR.W586.63 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.GNDWVCEHR.W586.63 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.GNFDDNAINDFATR.S785.76 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.GPIQPATCNSR.N600.59 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.GSYFNPGSR.D493.11 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.GSYFNPGSR.D984.39 (observed)1 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.GSYFNPGSR.D493.32 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GSYFNPGSR.D493.11 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GSYFNPGSR.D984.39 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GSYFNPGSR.D493.32 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GSYFNPGSR.D984.39 (observed)1 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.GSYFNPGSR.D493.32 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.GSYFNPGSR.D493.11 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.GSYFNPGSR.D984.39 (observed)1 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.GSYFNPGSR.D493.32 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.HAHVPPESFFK.G648.52 (observed)2 
A6535FURIN, FUR, PACEFurin precursorIPI00018387C.HASCATCQGPALTDCLSCPSHASLDPVEQTCSR.Q1225.52 (observed)3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.HFYAVCNQHCDIDR.F917.57 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.HGDLLECADDR.A1300.56 (observed)1 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.HGDLLECADDR.A1300.56 (observed)1 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00032179C.HGSPVDICTAKPR.D1437.73 (observed)1 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00032179C.HGSPVDICTAKPR.D719.74 (observed)2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421C.HGSPVDICTAKPR.D1437.73 (observed)1 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421C.HGSPVDICTAKPR.D719.74 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.HGVTCRPQETCK.E736.56 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.HLSCSALLQDNIADAVACAK.R1079.03 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.HLSCSALLQDNIADAVACAK.R719.68 (observed)3 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.HLSCSALLQDNIADAVACAK.R719.01 (observed)3 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.HLSCSALLQDNIADAVACAK.R1078.52 (observed)2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991C.HPNSPLDEENLTQENQDR.G1068.45 (observed)2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729C.HVQHSSLAQPLVVPWEAS.-993.15 (observed)2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729C.HVQHSSLAQPLVVPWEAS.-992.69 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00384697C.IAEVENDEMPADLPSLAADFVESK.D1295.11 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.IAEVENDEMPADLPSLAADFVESK.D1295.11 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.IAEVENDEMPADLPSLAADFVESK.D1294.98 (observed)2 
A6853KLK1, KALLIKREINKallikrein 1IPI00304808C.ISDNYQLWLGR.H682.61 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ITLISSEGYVSSK.Y692.56 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ITLISSEGYVSSK.Y692.56 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ITLISSEGYVSSK.Y692.09 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.ITLISSEGYVSSK.Y692.09 (observed)2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145C.IVLQIDNAR.I2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145C.IVLQIDNAR.L2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.KPGQVCQPSGGILSCVTK.D958.52 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.KTGSGDIENYNDATQVR.D934.28 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.KTGSGDIENYNDATQVR.D623.05 (observed)3 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.KTGSGDIENYNDATQVR.D934.31 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.KTGSGDIENYNDATQVR.D934.28 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.KTGSGDIENYNDATQVR.D623.05 (observed)3 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.KTGSGDIENYNDATQVR.D934.31 (observed)2 
A5803AMY2BAlpha-amylase 2B precursorIPI00021447C.KTGSGDIENYNDATQVR.D934.31 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.KTGSGDIENYNDATQVR.D934.28 (observed)2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.KTGSGDIENYNDATQVR.D623.05 (observed)3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476C.KTGSGDIENYNDATQVR.D934.31 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y883.95 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LAQDFLPDSITFSWK.Y884.08 (observed)2 
A6853KLK1, KALLIKREINKallikrein 1IPI00304808C.LASGWGSIEPENFSFPDDLQCVDLK.I1412.91 (observed)2 
A6853KLK1, KALLIKREINKallikrein 1IPI00383717C.LASGWGSIEPENFSFPDDLQCVDLK.I1412.15 (observed)2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729C.LAYDFYPGK.I1074.26 (observed)1 
A1587SLPI, WAP4, WFDC4Antileukoproteinase 1 precursorIPI00008580C.LDPVDTPNPTR.R612.31 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784627C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784713C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784935C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784983C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785079C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785164C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785196C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00785200C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00719373C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8275IGLL5, IGLV3-21, IGLIg lambda chain variantIPI00784545C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00154742C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00382938C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00450309C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00550162C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A1666.88 (observed)1 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A833.44 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00747752C.LISDFYPGAVTVAWK.A556.01 (observed)3 
A6855KLK11, klk11, PRSS20Kallikrein 11 precursorIPI00002818C.LISGWGSTSSPQLR.L744.62 (observed)2 
A6855KLK11, klk11, PRSS20Kallikrein 11 precursorIPI00002818C.LISGWGSTSSPQLR.L744.62 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.LLDACQVQGHPGGLCPAVATYVAACQAAGAQLR.E1141.47 (observed)3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784070C.LLNNFYPR.E518.61 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784661C.LLNNFYPR.E518.61 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.28 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.61 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.61 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784669C.LLNNFYPR.E518.61 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.LLNNFYPR.E518.7 (observed)2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00784985C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430820C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430847C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00440577C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550731C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00746963C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784773C.LLNNFYPR.E518.61 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.LLNNFYPR.E518.7 (observed)2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00784865C.LLNNFYPR.E518.61 (observed)2 
A1587SLPI, WAP4, WFDC4Antileukoproteinase 1 precursorIPI00008580C.LMLNPPNFCEMDGQCK.R977.15 (observed)2 
A795ANPDC1Neural proliferation differentiation and control protein-1 precursorIPI00299699C.LQPFQEDQQGLCVPR.M907.64 (observed)2 
A795ANPDC1Neural proliferation differentiation and control protein-1 precursorIPI00299699C.LQPFQEDQQGLCVPR.M907.64 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.LTNGDTLWR.T538.33 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.LTNGDTLWR.T538.33 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.LTNGDTLWR.T538.13 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.LTNGDTLWR.T538.13 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1360.69 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1360.69 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1360.69 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1360.69 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1360.69 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N1362.2 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.7 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.LVQGFFPQEPLSVTWSESGQGVTAR.N1361.68 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.LVQGFFPQEPLSVTWSESGQGVTAR.N907.52 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.LVQGFFPQEPLSVTWSESGQNVTAR.N1390.15 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.5 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.LVTGFSPADVFVQWMQR.G990.72 (observed)2 
A8420SERPINB1, ELANH2, MNEILeukocyte elastase inhibitorIPI00027444C.MLMPEENFTADHPFLFFIR.H1177.95 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461C.MVDHEALPLAFTQK.T800.19 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461C.MVDHEALPLAFTQK.T799.71 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.MVGHEALPLAFTQK.T770.91 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.MVGHEALPLAFTQK.T772.42 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T770.91 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T770.91 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T770.91 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T1541.81 (observed)1 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T772.42 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T772.42 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.MVGHEALPLAFTQK.T772.42 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.MVSHEALPLAFTQK.T786.05 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.MVSHEALPLAFTQK.T786.49 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.NRPGFVTVTR.P573.57 (observed)2 
A3850KRT4, CYK4Keratin, type II cytoskeletal 4IPI00290078C.PAGGIQEVTINQSLLTPLHVEIDPEIQK.V1013.8 (observed)3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PDALAPKDPCTANPFRK.S949.1 (observed)2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00103397C.PDALAPKDPCTANPFRK.S949.1 (observed)2 
A2616MUC5AC, MUC5, MUC 5ACMucin 5ACIPI00479313C.PDALAPKDPCTANPFRK.S949.1 (observed)2 
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorIPI00022974C.PDDAAVIPIK.N519.29 (observed)2 
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorIPI00022974C.PDDAAVIPIK.N1039.32 (observed)1 
A5080PIP, GCDFP15, GPIP4Prolactin-inducible protein precursorIPI00022974C.PDDAAVIPIK.N519.59 (observed)2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463C.PEAPTDECKPVK.W1370.66 (observed)1 
A8401CST3Cystatin C precursorIPI00032293C.PFHDQPHLK.R1118.58 (observed)1 
A0536S100A6, CACYCalcyclinIPI00027463C.PLDQAIGLLVAIFHK.Y818.12 (observed)2 
A0536S100A6, CACYCalcyclinIPI00027463C.PLDQAIGLLVAIFHK.Y818.6 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PLFCDFYNPHGGCEWHYQPCGAPCLK.T1070.78 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.PLLVDSEGWVK.A1242.8 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.PLLVDSEGWVK.A1242.8 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.PLLVDSEGWVK.A1244.54 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.PLLVDSEGWVK.A1244.54 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PLNMQHQECGSPCTDTCSNPQR.A1309.08 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PPSQPFFNEDQMK.C782.43 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PPTKVYKPCGPIQPATCNSR.N1135.59 (observed)2 
A5149SPRR3, SPRCEsophaginIPI00082931C.PSTVTPGPAQQK.T1210.64 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.PVLADIECR.A1072.53 (observed)1 
A9713FCGBPIgG Fc binding proteinIPI00242956C.QAAGATVHPWR.S596.86 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.QAAGVAVKPWR.T592.33 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.QALPSQDEGPSK.A1256.61 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.QALPSQDEGPSK.A1256.61 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.QSLEAYAELCR.A669.92 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382489C.QVQLVESGGGVVQPGR.S1 
A209DCRISP3, SGP28Cysteine-rich secretory protein-3 precursorIPI00004798C.QYCPAGNWANR.L668.63 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.RAAYEDFNVQLR.R741.38 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.RAQAQPGVPLR.E596.76 (observed)2 
A9867Em:AF200455.10, DEFA1, Em:AF200455.12Neutrophil defensin 1 precursorIPI00005721C.RIPACIAGER.R572.3 (observed)2 
A9867Em:AF200455.10, DEFA1, Em:AF200455.12Neutrophil defensin 1 precursorIPI00005721C.RIPACIAGER.R572.3 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.RLSGLLDLALGK.D627.76 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.RLSGLLDLALGKDYVR.S596.72 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y742.43 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y1114.44 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y742.43 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y1114.44 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y742.55 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y1114.24 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y742.55 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQGARGGCITLISSEGYVSSK.Y1114.24 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQSSGENCDVVVNTLGK.R932.23 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQSSGENCDVVVNTLGK.R621.62 (observed)3 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQSSGENCDVVVNTLGK.R932.23 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573C.RQSSGENCDVVVNTLGK.R621.62 (observed)3 
A1579K14, KRT14Keratin, type I cytoskeletal 14IPI00384444C.RVLDELTLAR.A593.48 (observed)2 
A1579K14, KRT14Keratin, type I cytoskeletal 14IPI00384444C.RVLDELTLAR.A593.48 (observed)2 
A1579K14, KRT14Keratin, type I cytoskeletal 14IPI00384444C.RVLDELTLAR.A593.48 (observed)2 
A1579K14, KRT14Keratin, type I cytoskeletal 14IPI00384444C.RVLDELTLAR.A593.48 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.RVLDELTLAR.A593.48 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.RVLDELTLAR.A593.48 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.RVLDELTLAR.A593.48 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.RVLDELTLAR.A593.48 (observed)2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768C.RVLDELTLAR.A593.48 (observed)2 
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16IPI00217963C.RVLDELTLAR.A593.48 (observed)2 
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16IPI00217963C.RVLDELTLAR.A593.48 (observed)2 
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16IPI00217963C.RVLDELTLAR.A593.48 (observed)2 
A3785KRT15, KRTBKeratin, type I cytoskeletal 15IPI00290077C.RVLDELTLAR.A593.48 (observed)2 
A3787KRT19, K19Keratin, type I cytoskeletal 19IPI00479145C.RVLDELTLAR.A593.48 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.SALLQDNIADAVACAK.R1661.84 (observed)1 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.SALLQDNIADAVACAK.R831.42 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.SALLQDNIADAVACAK.R829.92 (observed)2 
A6935LYZ, LZMLysozyme C precursorIPI00019038C.SALLQDNIADAVACAK.R1659.84 (observed)1 
A8406CST4Cystatin S precursorIPI00032294C.SFEIYEVPWEDR.M785.37 (observed)2 
A8406CST4Cystatin S precursorIPI00032294C.SFEIYEVPWEDR.M1571.73 (observed)1 
A8406CST4Cystatin S precursorIPI00032294C.SFEIYEVPWEDR.M785.3 (observed)2 
A8405CST1Cystatin-SNIPI00305477C.SFEIYEVPWENR.R785.2 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.SFQINEVPWEDK.I745.83 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.SFQINEVPWEDK.I1491.71 (observed)1 
A8402CST5Cystatin D precursorIPI00002851C.SFQINEVPWEDK.I747.36 (observed)2 
A8402CST5Cystatin D precursorIPI00002851C.SFQINEVPWEDKISILNYK.C774.73 (observed)3 
A8407CST2Cystatin SA precursorIPI00013382C.SFQIYEVPWEDR.M784.37 (observed)2 
A8407CST2Cystatin SA precursorIPI00013382C.SFQIYEVPWEDR.M1568.73 (observed)1 
A8407CST2Cystatin SA precursorIPI00013382C.SFQIYEVPWEDR.M784.78 (observed)2 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292C.SFVAPWNSLSLAQR.R788.8 (observed)2 
A1774TIMP1, CLGI, TIMPMetalloproteinase inhibitor 1 precursorIPI00032292C.SFVAPWNSLSLAQR.R788.65 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SGGLWQCQDLPCPGTCSVQGGAHISTYDEK.L1102.84 (observed)3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00788824C.SGSSSNIGSNTVNWYQQLPGTAPK.L1248.61 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SILHGPTFAACR.S1329.7 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SILHGPTFAACR.S664.92 (observed)2 
A9149GCVitamin D-binding protein precursorIPI00555812C.SINSPPLYCDSEIDAELK.N1025.48 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SLDFGLVCR.N534.27 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SLETGLTCK.N504.65 (observed)2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00790669C.SSASTTEDCIALVLK.G797.68 (observed)2 
A5839AGA, GAN(4)-(beta)-N-acetylglucosaminyl-L-asparaginase precursorIPI00026259C.SSPLPLVVNTWPFK.N792.44 (observed)2 
A5839AGA, GAN(4)-(beta)-N-acetylglucosaminyl-L-asparaginase precursorIPI00026259C.SSPLPLVVNTWPFK.N792.52 (observed)2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463C.STLNQYFGYSGAFK.C791.89 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1320.98 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1320.98 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1320.98 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1320.98 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1320.98 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.49 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.STQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTAR.N1321.73 (observed)3 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350C.SVDSQFTHLAWINTPR.R937.63 (observed)2 
A7502PRDX4Peroxiredoxin 4IPI00011937C.SVDSQFTHLAWINTPR.R937.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448925C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448938C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448938C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00448938C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00761159C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784810C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784817C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00784828C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00807531C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8269IGHG2Ig gamma-2IPI00399007C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8269IGHG2Ig gamma-2IPI00784807C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8269IGHG2Ig gamma-2IPI00784942C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8271IGHG4Ig gamma-4 chainIPI00550640C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8271IGHG4Ig gamma-4 chainIPI00550640C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8271IGHG4Ig gamma-4 chainIPI00784998C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A8363IGHM, IgIg mu chain CIPI00472610C.SVMHEALHNHYTQK.S848.17 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153C.SVMHEALHNR.F596.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153C.SVMHEALHNR.F596.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153C.SVMHEALHNR.F596.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153C.SVMHEALHNR.F596.99 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00418153C.SVMHEALHNR.F596.99 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00472345C.SVMHEALHNR.F596.99 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00472345C.SVMHEALHNR.F596.99 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00472345C.SVMHEALHNR.F596.99 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.SVQGGAHISTYDEK.L746.15 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.TAAHPELK.T433.24 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952C.TAAHPELK.T433.86 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461C.TAAHPELK.T433.24 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.TAAHPELK.T433.24 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.TAAHPELK.T433.86 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067C.TAAHPELK.T433.86 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.24 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.24 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.24 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.86 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.86 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993C.TAAHPELK.T433.86 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.98 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.98 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.98 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.98 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423460C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.TAAYPESKTPLTATLSK.S889.66 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.TAAYPESKTPLTATLSK.S593.32 (observed)3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.TAFHDNEETFLK.K1451.68 (observed)1 
A5969CA6Carbonic anhydrase VI precursorIPI00295105C.TENVHWFVLADFVK.L852.92 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105C.TENVHWFVLADFVK.L568.96 (observed)3 
A5969CA6Carbonic anhydrase VI precursorIPI00295105C.TENVHWFVLADFVK.L568.63 (observed)3 
A5969CA6Carbonic anhydrase VI precursorIPI00295105C.TENVHWFVLADFVK.L853.04 (observed)2 
A9713FCGBPIgG Fc binding proteinIPI00242956C.TFQGLQLAPGQEVWADELCQR.R1223.4 (observed)2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00477644C.TGTSSDVGGYNYVSWYQQHPGK.A1216.19 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.TLSEKERQIK.K616.49 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q1308.71 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q654.63 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q1308.66 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.TVTHTDLPSPLK.Q654.81 (observed)2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00745872C.VADESAENCDK.S1239.51 (observed)1 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.VAYGDGHFITFDGDR.Y834.82 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.VHNEATYKPGETIR.V807.72 (observed)2 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820C.VLTSVAISSALHK.K663.03 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00385264C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00477090C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549291C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V1105.62 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V553.34 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V553.11 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V1106.2 (observed)1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00748158C.VVAHEALPNR.V553.11 (observed)2 
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorIPI00300786C.WAQYSSNTQQGR.T713.68 (observed)2 
A1538F12Coagulation factor XIIIPI00019581C.WVLTAAHCLQ.D599.58 (observed)2 
A1538F12Coagulation factor XIIIPI00019581C.WVLTAAHCLQ.D599.58 (observed)2 
A1538F12Coagulation factor XIIIPI00019581C.WVLTAAHCLQ.D599.58 (observed)2 
A1538F12Coagulation factor XIIIPI00019581C.WVLTAAHCLQ.D599.58 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.YAHGTVLAPGEVVHDEGAVCSCTGGK.L1335.7 (observed)2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00747373C.YAHGTVLAPGEVVHDEGAVCSCTGGK.L891.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YGFSPWGQGTLVTVSSASPTSPK.V1176.74 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386879C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00426060C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00744561C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00449920C.YSVSSVLPGCAEPWNHGK.T993.97 (observed)2 
A8272IGJ, IGCJImmunoglobulin J chainIPI00178926C.YTAVVPLVYGGETK.M748.89 (observed)2 
A8272IGJ, IGCJImmunoglobulin J chainIPI00178926C.YTAVVPLVYGGETK.M749.49 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AAPDEKVLDSGFREIENK.A1009.79 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AAPDEKVLDSGFREIENK.A1009.79 (observed)2 
A937ARFPL4B, RNF211RET finger protein-like 4BIPI00419209D.ADLEEIQ.F408.72 (observed)2 
A8405CST1Cystatin-SNIPI00305477D.ADLNDEWVQR.A623.19 (observed)2 
A8405CST1Cystatin-SNIPI00305477D.ADLNDEWVQR.A1247.68 (observed)1 
A8406CST4Cystatin S precursorIPI00032294D.ADLNDEWVQR.A623.19 (observed)2 
A8406CST4Cystatin S precursorIPI00032294D.ADLNDEWVQR.A1247.68 (observed)1 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGFYWCLTNGDTLWR.T931.42 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGFYWCLTNGDTLWR.T931.42 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGFYWCLTNGDTLWR.T930.16 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGFYWCLTNGDTLWR.T930.16 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGQYLCQAGDDSNSNKK.N928.91 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGQYLCQAGDDSNSNKK.N928.91 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGQYLCQAGDDSNSNKK.N928.23 (observed)2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573D.AGQYLCQAGDDSNSNKK.N928.23 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105D.APDGLAVLAAFVEVK.N750.46 (observed)2 
A5969CA6Carbonic anhydrase VI precursorIPI00295105D.APDGLAVLAAFVEVK.N750.95 (observed)2 
A7360LPO, SAPXLactoperoxidase precursorIPI00025023D.ASFVYSSEPSLASR.L750.75 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00384952D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00423461D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784758D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784830D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784950D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00784969D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067D.ASGATFTWTPSSGK.S699.06 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1424IGHA2, IGH@Ig alpha-2 chainIPI00785067D.ASGATFTWTPSSGK.S699.14 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.06 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.06 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.06 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.14 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.14 (observed)2 
A8270IGHG3Ig gamma-3 chainIPI00783993D.ASGATFTWTPSSGK.S699.14 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00061977D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00166866D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164D.ASGDLYTTSSQLTLPATQCLAGK.S1192.26 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00383164D.ASGDLYTTSSQLTLPATQCLAGK.S795.16 (observed)3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00386524D.ASGDLYTTSSQLTLPATQCLAGK.S1192.88 (observed)2 
A1411<