PADB-logoLSSR - PepMap molecular information by study

Study ID 17902193
Species mouse
Disease healthy
Tissue / Source blood
Compartment serum

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A1581ALB, GIG20, GIG42Serum albumin precursorP07724AADKDTCFSTEGPNLVTR   sample ref: 10(1702)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9AAHSQCAYSNPEGTVLLACEESR   sample ref: 17(1810)
A795BAFM, ALB2, ALBAAfamin precursorO89020AAPITQYLK   sample ref: 9(2838)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838AAPLSLCALTAVDQSVLLLKPEAK   sample ref: 7(4850)
A795BAFM, ALB2, ALBAAfamin precursorO89020AAPQLPMEELVSLSK   sample ref: 9(2838)
A795BAFM, ALB2, ALBAAfamin precursorO89020AAPQLPMEELVSLSK   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942AAWGKIGGHGAEYGAEALER   sample ref: 25(7011)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279ACGPDYYEVEEDGIR   sample ref: 46(2844)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279ACGPDYYEVEEDGIRK   sample ref: 46(2844)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724AETFTFHSDICTLPEKEK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724AFKAWAVAR   sample ref: 10(1702)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938AGEYSVTYDGFNTFTIPK   sample ref: 36(1117)
A0419GSNGelsolin precursor, plasmaP13020AGKEPGLQIWR   sample ref: 22(4825)
A1468PLGPlasminogen precursorP20918AGLEKNYCR   sample ref: 37(5827)
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039AIEEKLANMEAEIR   
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838AINYLISGYQR   sample ref: 7(4850)
A6465Es1Liver carboxylesterase NP23953AISESGVVINTNVGKK   sample ref: 18(1709)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898AKGNEQSFHVSLR   sample ref: 24(2503)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9ALGLDEGEPAGSWDLTVEGR   sample ref: 17(1810)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838ALLAYAFALAGNK   sample ref: 7(4850)
A1602CFB, BF, BFDComplement factor B precursorP04186ALLDIGRDPK   sample ref: 15(6802)
A1602CFB, BF, BFDComplement factor B precursorP04186ALRLPQTATCK   sample ref: 15(6802)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838ALSFYQPR   sample ref: 7(4850)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728ALVQQLEQFR   sample ref: 12(2311)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728ALVQQLEQFRQQLGPNSGEVESHLSFLEK   sample ref: 12(2311)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1AMFHINKPR   sample ref: 20(3707)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1AMFHINKPR   
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1AMFHINKPRR   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699ANLMHNLGGEEVSVACK   sample ref: 19(2714)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699ANLMHNLGGEEVSVACK   
A795BAFM, ALB2, ALBAAfamin precursorO89020ANVGFLPPFPTLDPEEK   sample ref: 9(2838)
A6465Es1Liver carboxylesterase NP23953APEEILAEK   sample ref: 18(1709)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724APQVSTPTLVEAAR   sample ref: 10(1702)
A8269IGHG2Ig gamma-2P01867APQVYILPPPAEQLSR   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866APQVYILPPPAEQLSR   sample ref: 21(7602)
A8269IGHG2Ig gamma-2P01866APQVYILPPPAEQLSRK   sample ref: 21(7602)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868APQVYTIPPPKEQMAK   
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898APWMEQEGPEYWER   
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898APWMEQEGPEYWERETQR   
A1176APOEApolipoprotein E precursorP08226AQAFGDRIR   sample ref: 13(3409)
A0419GSNGelsolin precursor, plasmaP13020AQERAPQSR   sample ref: 22(4825)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699AQNVPLPVSTLVEFVIAATDCTAK   sample ref: 19(2714)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699AQNVPLPVSTLVEFVIAATDCTAKEVTDPAK   sample ref: 19(2714)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726AREEIFLVTLK   sample ref: 45(2505)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724ARFSGLWYAIAK   sample ref: 38(5215)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623ARPALEDLR   sample ref: 11(2312)
A1276CLU, APOJ, CLIClusterin precursorQ06890ASGIIDTLFQDR   sample ref: 16(1138)
A1276CLU, APOJ, CLIClusterin precursorQ06890ASGIIDTLFQDRFFAR   sample ref: 16(1138)
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionP06330ASGYTFTDYYMNWVK   sample ref: 27(7614)
A8273IGK, SDNK1, A30Ig kappa chainP01644ASQDISNYLNWYQQKPDGTVK   sample ref: 32(4303)
A8273IGK, SDNK1, A30Ig kappa chainP01645ASQDISNYLNWYQQKPDGTVK   sample ref: 33(5101)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339ATFGCHETYKLDGPEEAECTK   sample ref: 14(6706)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728ATIDQNLEDLRR   sample ref: 12(2311)
A1539KNG1, BDK, KNGKininogen-1O08677ATSQVVAGTKYVIEFIAR   sample ref: 30(2717)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339ATVLYQGMR   sample ref: 14(6706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339ATVLYQGMR   
A4552ACTG1, ACTGActin, cytoplasmic 2P60710AVFPSIVGRPR   sample ref: 8(4503)
A452CSLC6A11, GABT3, GAT3Sodium- and chloride-dependent GABA transporter 3P31650AVHERGHWNNK   sample ref: 39(5304)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599AVHKAVLTIDETGTEAAAATVFEAVPMSMPPILR   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599AVLTIDETGTEAAAATVFEAVPMSMPPILR   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599AVLTIDETGTEAAAATVFEAVPMSMPPILR   
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599AVLTIDETGTEAAAATVFEAVPMSMPPILR   
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897AVLTIDETGTEAAAATVLQVATYSMPPIVR   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896AVLTMDETGTEAAAATVLLAVPYSMPPIVR   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896AVLTMDETGTEAAAATVLLAVPYSMPPIVR   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279AVNHVCNPLCSSEGCWGPEPR   sample ref: 46(2844)
A643CTF, PRO1400Serotransferrin precursorQ921I1AVSSFFSGSCVPCADPVAFPK   sample ref: 41(7702)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590AVTHVGMDESEIIFVDWKK   
A1539KNG1, BDK, KNGKininogen-1O08677AYFPCIGCVHAISTDSPDLEPVLK   sample ref: 30(2717)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898AYLEAECVEWLLR   sample ref: 24(2503)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726AYLEEECPEMLKR   sample ref: 45(2505)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726AYLEEECPEMLKR   
A5592SAA4, CSAASerum amyloid A-4 proteinP31532AYRDNLEANYQNADQYFYAR   sample ref: 40(8129)
A643CTF, PRO1400Serotransferrin precursorQ921I1CAPNNKEEYNGYTGAFR   sample ref: 41(7702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724CCAEANPPACYGTVLAEFQPLVEEPK   sample ref: 10(1702)
A9149GCVitamin D-binding protein precursorP21614CCESTSEDCMASELPEHTIK   
A1581ALB, GIG20, GIG42Serum albumin precursorP07724CCSGSLVER   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724CCTLPEDQRLPCVEDYLSAILNR   sample ref: 10(1702)
A1468PLGPlasminogen precursorP20918CEGETDFVCR   sample ref: 37(5827)
A643CTF, PRO1400Serotransferrin precursorQ921I1CFVKLPEGTTPEK   sample ref: 41(7702)
A8954CFP, PFCComplement factor ProperdinP11680CGGHCPGEAQQSQACDTQK   sample ref: 50(7730)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726CLAYGFYPQR   sample ref: 45(2505)
A1602CFB, BF, BFDComplement factor B precursorP04186CLTNLIEKVASYGVRPR   sample ref: 15(6802)
A643CTF, PRO1400Serotransferrin precursorQ921I1CLVEKGDVAFVK   sample ref: 41(7702)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279CNILEGEPR   sample ref: 46(2844)
A8269IGHG2Ig gamma-2P01867CPAPNLEGGPSVFIFPPNIKDVLMISLTPK   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339CPFPPRPENGYVNYPAKPVLLYK   sample ref: 14(6706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339CPFPPRPENGYVNYPAKPVLLYKDK   sample ref: 14(6706)
A1602CFB, BF, BFDComplement factor B precursorP04186CPRPQDFENGEFWPR   sample ref: 15(6802)
A1539KNG1, BDK, KNGKininogen-1O08677CQALDMTEMAR   sample ref: 30(2717)
A1539KNG1, BDK, KNGKininogen-1O08677CQALDMTEMAR   
A1539KNG1, BDK, KNGKininogen-1O08677CQALDMTEMAR   
A1468PLGPlasminogen precursorP20918CQSWAAMFPHR   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868CRVNSAAFPAPIEK   sample ref: 28(7555)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9CRWLNIQLSSR   sample ref: 17(1810)
A021CHPXHemopexin precursorQ91X72CSPDPGLTALLSDHR   sample ref: 26(2722)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724CSYDEHAK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724CSYDEHAKLVQEVTDFAK   sample ref: 10(1702)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339CSYTVEAHCR   sample ref: 14(6706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339CTEEGKWSPDIPACAR   sample ref: 14(6706)
A1468PLGPlasminogen precursorP20918CTTPPPPPSPTYQCLK   sample ref: 37(5827)
A795BAFM, ALB2, ALBAAfamin precursorO89020CWADNTLPECSK   sample ref: 9(2838)
A8272IGJ, IGCJImmunoglobulin J chainP01592CYTTMVPLR   
A8272IGJ, IGCJImmunoglobulin J chainP01592CYTTMVPLRYHGETK   
A1539KNG1, BDK, KNGKininogen-1O08677DAEEAATGECTATVGK   sample ref: 30(2717)
A6465Es1Liver carboxylesterase NP23953DAGVSTYMYEFR   sample ref: 18(1709)
A6465Es1Liver carboxylesterase NP23953DAGVSTYMYEFR   
A1552APOA1, A175PApolipoprotein A-I precursorQ00623DFANVYVDAVKDSGR   sample ref: 11(2312)
A643CTF, PRO1400Serotransferrin precursorQ921I1DFASCHLAQAPNHVVVSR   sample ref: 41(7702)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623DFWDNLEK   sample ref: 11(2312)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623DFWDNLEKETDWVR   sample ref: 11(2312)
A8363IGHM, IgIg mu chain CP01872DGFSGPAPR   sample ref: 35(4708)
A8363IGHM, IgIg mu chain CP01872DGFSGPAPRK   sample ref: 35(4708)
A0419GSNGelsolin precursor, plasmaP13020DGGQTAPASIR   sample ref: 22(4825)
A8363IGHM, IgIg mu chain CP01872DGKLVESGFTTDPVTIENK   sample ref: 35(4708)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339DGTIEIPSCFK   sample ref: 14(6706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339DGTIEIPSCFKEHSSLAFWK   sample ref: 14(6706)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1DGYMLSLNR   
A8273IGK, SDNK1, A30Ig kappa chainP01644DIQMTQTTSSLSASLGDR   
A8273IGK, SDNK1, A30Ig kappa chainP01645DIQMTQTTSSLSASLGDR   sample ref: 33(5101)
A8273IGK, SDNK1, A30Ig kappa chainP01645DIQMTQTTSSLSASLGDR   
A8273IGK, SDNK1, A30Ig kappa chainP01644DIQMTQTTSSLSASLGDRVTISCR   
A8273IGK, SDNK1, A30Ig kappa chainP01645DIQMTQTTSSLSASLGDRVTISCR   sample ref: 33(5101)
A8273IGK, SDNK1, A30Ig kappa chainP01645DIQMTQTTSSLSASLGDRVTISCR   
A8273IGK, SDNK1, A30Ig kappa chainP03977DIVLTQSPASLAVSLGQR   sample ref: 31(4309)
A8273IGK, SDNK1, A30Ig kappa chainP01656DIVLTQSPASLAVSLGQR   sample ref: 49(2188)
A8273IGK, SDNK1, A30Ig kappa chainP03977DIVLTQSPASLAVSLGQRATISCR   sample ref: 31(4309)
A8273IGK, SDNK1, A30Ig kappa chainP01656DIVLTQSPASLAVSLGQRATISCR   sample ref: 49(2188)
A9149GCVitamin D-binding protein precursorP21614DLCGQSTTQAMDQYTFELSR   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614DLCGQSTTQAMDQYTFELSR   
A1602CFB, BF, BFDComplement factor B precursorP04186DLEIEEVLFHPK   sample ref: 15(6802)
A643CTF, PRO1400Serotransferrin precursorQ921I1DLLFKDSAFGLLR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1DLLFRDDTK   sample ref: 41(7702)
A8269IGHG2Ig gamma-2P01866DLPSPIER   sample ref: 21(7602)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724DPNGLSPETRR   sample ref: 38(5215)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1DQKDGYMLSLNR   
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599DQSPASHEIATNLGDFAISLYR   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896DQSPASHEIATNLGDFAISLYR   sample ref: 3(2602)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105DQSPASHEIATNLGDFAISLYR   sample ref: 5(1612)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897DQSPASHEIATNLGDFALR   sample ref: 4(1610)
A643CTF, PRO1400Serotransferrin precursorQ921I1DQYELLCLDNTR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1DSAFGLLR   sample ref: 41(7702)
A795BAFM, ALB2, ALBAAfamin precursorO89020DSDPDKFFAEFIYEYSR   sample ref: 9(2838)
A8273IGK, SDNK1, A30Ig kappa chainP01837DSTYSMSSTLTLTKDEYER   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726DTTGSHTFQGMFGCEITNNR   
A1581ALB, GIG20, GIG42Serum albumin precursorP07724DVFLGTFLYEYSR   sample ref: 10(1702)
A1468PLGPlasminogen precursorP20918DVILFEKR   sample ref: 37(5827)
A021CHPXHemopexin precursorQ91X72DYFVSCPGR   sample ref: 26(2722)
A021CHPXHemopexin precursorQ91X72DYFVSCPGRGHGRPR   sample ref: 26(2722)
A795BAFM, ALB2, ALBAAfamin precursorO89020EACIINANKDDRPEGLSLR   sample ref: 9(2838)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724EAHKSEIAHR   sample ref: 10(1702)
A795BAFM, ALB2, ALBAAfamin precursorO89020EAKFTESENVCQER   sample ref: 9(2838)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728EAVEQFQKTDVTQQLSTLFQDK   sample ref: 12(2311)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532EAVQGTWDLWR   sample ref: 40(8129)
A9149GCVitamin D-binding protein precursorP21614ECCDTQDSVACFSTQSPLLKR   sample ref: 43(3706)
A795BAFM, ALB2, ALBAAfamin precursorO89020EDLQNKK   sample ref: 9(2838)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838EEGTGIELTGIGSCEIANALSKLK   sample ref: 7(4850)
A8363IGHM, IgIg mu chain CP01872EFVCTVTHR   sample ref: 35(4708)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339EHSSLAFWK   sample ref: 14(6706)
A6465Es1Liver carboxylesterase NP23953EILPLKISEDCLYLNIYSPADLTK   sample ref: 18(1709)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938EKIEDNGNFR   sample ref: 36(1117)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728EKVNSFMSTLEK   
A1176APOEApolipoprotein E precursorP08226ELEEQLGPVAEETR   sample ref: 13(3409)
A1176APOEApolipoprotein E precursorP08226ELEEQLGPVAEETRAR   sample ref: 13(3409)
A021CHPXHemopexin precursorQ91X72ELGSPPGISLETIDAAFSCPGSSR   sample ref: 26(2722)
A1276CLU, APOJ, CLIClusterin precursorQ06890ELHDPHYFSPIGFPHKRPHFLYPK   sample ref: 16(1138)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105ELISKFLLNR   sample ref: 5(1612)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897ELISQFLLNR   sample ref: 4(1610)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897ELISQFLLNRR   sample ref: 4(1610)
A1539KNG1, BDK, KNGKininogen-1O08677ENEFFIVTQTCK   sample ref: 30(2717)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938ENIIDLSNANR   sample ref: 36(1117)
A795BAFM, ALB2, ALBAAfamin precursorO89020ENPAGCYR   sample ref: 9(2838)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724ENPTTFMGHYLHEVAR   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724ENPTTFMGHYLHEVAR   
A0419GSNGelsolin precursor, plasmaP13020EPGLQIWR   sample ref: 22(4825)
A1471VTNVitronectin precursorP29788EPQFISR   sample ref: 44(1714)
A8363IGHM, IgIg mu chain CP01872EQLNLRESATVTCLVK   sample ref: 35(4708)
A1468PLGPlasminogen precursorP20918EQQCVIMAENSK   sample ref: 37(5827)
A1539KNG1, BDK, KNGKininogen-1O08677ESNTELAEDCEIK   sample ref: 30(2717)
A8273IGK, SDNK1, A30Ig kappa chainP01656EVPWTFGGGTKLEIK   sample ref: 49(2188)
A8273IGK, SDNK1, A30Ig kappa chainP03977EVPYTFGGGTKLEIK   sample ref: 31(4309)
A0419GSNGelsolin precursor, plasmaP13020EVQGFESSTFSGYFK   sample ref: 22(4825)
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionP06330EVQLQQSGPELVKPGASVK   sample ref: 27(7614)
A9149GCVitamin D-binding protein precursorP21614EVVSLTEECCAEGADPTCYDTR   sample ref: 43(3706)
A6465Es1Liver carboxylesterase NP23953FAPPQPAEPWSFVK   sample ref: 18(1709)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938FAQLCEEHGILR   sample ref: 36(1117)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938FAQLCEEHGILRENIIDLSNANR   sample ref: 36(1117)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599FDHPFLFIIFEEHTQSPIFVGK   sample ref: 2(1621)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897FDHPFLFIIFEEHTQSPIFVGK   sample ref: 4(1610)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896FDHPFLFIIFEEHTQSPLFVGK   sample ref: 3(2602)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105FDHPFLFIIFEEHTQSPLFVGK   sample ref: 5(1612)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898FDSDAETPRMEPR   
A1471VTNVitronectin precursorP29788FEDGVLDPGYPR   sample ref: 44(1714)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898FIIVGYVDDTQFVR   sample ref: 24(2503)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898FIIVGYVDDTQFVRFDSDAETPR   sample ref: 24(2503)
A8363IGHM, IgIg mu chain CP01872FISKPNEVHKHPPAVYLLPPAR   sample ref: 35(4708)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599FLEEAKNHYQAEVFSVNFAESEEAK   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896FLEEAKNHYQAEVFSVNFAESEEAK   sample ref: 3(2602)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896FLLKRPR   sample ref: 3(2602)
A6644GPX3, GPXPGlutathione peroxidase 3P46412FLVGPDGIPVMR   
A021CHPXHemopexin precursorQ91X72FNPVTGEVPPR   sample ref: 26(2722)
A021CHPXHemopexin precursorQ91X72FNPVTGEVPPRYPLDAR   sample ref: 26(2722)
A1539KNG1, BDK, KNGKininogen-1O08677FPSLHGDCVALPNGDDGECR   sample ref: 30(2717)
A452CSLC6A11, GABT3, GAT3Sodium- and chloride-dependent GABA transporter 3P31650FPYLCYK   sample ref: 39(5304)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724FSGLWYAIAK   sample ref: 38(5215)
A8273IGK, SDNK1, A30Ig kappa chainP03977FSGSGSGTDFSLNIHPMEEDDTAMYFCQQSK   sample ref: 31(4309)
A8273IGK, SDNK1, A30Ig kappa chainP03977FSGSGSGTDFSLNIHPMEEDDTAMYFCQQSK   
A8273IGK, SDNK1, A30Ig kappa chainP03977FSGSGSGTDFSLNIHPMEEDDTAMYFCQQSK   
A8273IGK, SDNK1, A30Ig kappa chainP01656FSGSGSGTDFSLNIHPMEEDDTAMYFCQQSK   
A9149GCVitamin D-binding protein precursorP21614FSSSTFEQVNQLVK   sample ref: 43(3706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339FTCPLTGMWPINTLR   sample ref: 14(6706)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339FTCPLTGMWPINTLR   
A795BAFM, ALB2, ALBAAfamin precursorO89020FTESENVCQER   sample ref: 9(2838)
A1468PLGPlasminogen precursorP20918FVDWIER   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918FVDWIEREMR   
A648CTTR, PALB, TBPATransthyretin precursorP07309FVEGVYR   sample ref: 42(5101)
A648CTTR, PALB, TBPATransthyretin precursorP07309FVEGVYRVELDTK   sample ref: 42(5101)
A6465Es1Liver carboxylesterase NP23953FWANFAR   sample ref: 18(1709)
A1176APOEApolipoprotein E precursorP08226FWDYLR   sample ref: 13(3409)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9GAFQSLTGLQMLK   
A021CHPXHemopexin precursorQ91X72GATYAFTGSHYWR   sample ref: 26(2722)
A021CHPXHemopexin precursorQ91X72GECQSEGVLFFQGNRK   sample ref: 26(2722)
A1468PLGPlasminogen precursorP20918GENYRGTVSVTVSGK   sample ref: 37(5827)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247GFPIKDDFLEQSER   sample ref: 6(2630)
A8363IGHM, IgIg mu chain CP01872GFSPADISVQWLQR   sample ref: 35(4708)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726GFSQSLSVQWDR   sample ref: 45(2505)
A021CHPXHemopexin precursorQ91X72GGNNLVSGYPK   sample ref: 26(2722)
A0419GSNGelsolin precursor, plasmaP13020GGVASGFKHVVPNEVVVQR   sample ref: 22(4825)
A1468PLGPlasminogen precursorP20918GKTAVTAAGTPCQGWAAQEPHR   sample ref: 37(5827)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699GLSDHRTYHDLR   sample ref: 19(2714)
A8269IGHG2Ig gamma-2P01866GLVRAPQVYILPPPAEQLSR   sample ref: 21(7602)
A1602CFB, BF, BFDComplement factor B precursorP04186GNDYHKQPWQAK   sample ref: 15(6802)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898GNEQSFHVSLR   sample ref: 24(2503)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532GNYEAQQR   sample ref: 40(8129)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279GPDNCIQCAHYIDGPHCVK   sample ref: 46(2844)
A021CHPXHemopexin precursorQ91X72GPDSVFLIKEDK   sample ref: 26(2722)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9GQLVPNLKQEQLICPVNPGHLSFR   sample ref: 17(1810)
A1471VTNVitronectin precursorP29788GQYCYELDETAVRPGYPK   sample ref: 44(1714)
A1176APOEApolipoprotein E precursorP08226GRLEEVGNQAR   sample ref: 13(3409)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279GRSPSDCCHNQCAAGCTGPR   sample ref: 46(2844)
A648CTTR, PALB, TBPATransthyretin precursorP07309GSPAVDVAVK   sample ref: 42(5101)
A643CTF, PRO1400Serotransferrin precursorQ921I1GTDFQLNQLEGK   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1GTDFQLNQLEGKK   sample ref: 41(7702)
A8363IGHM, IgIg mu chain CP01872GVASVCVEDWNNR   sample ref: 35(4708)
A8363IGHM, IgIg mu chain CP01872GVASVCVEDWNNRK   sample ref: 35(4708)
A1176APOEApolipoprotein E precursorP08226GVSAIRER   sample ref: 13(3409)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898GYLQYAYDGR   sample ref: 24(2503)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898GYLQYAYDGRDYIALNEDLK   sample ref: 24(2503)
A4552ACTG1, ACTGActin, cytoplasmic 2P60710GYSFTTTAEREIVR   sample ref: 8(4503)
A643CTF, PRO1400Serotransferrin precursorQ921I1GYYAVAVVK   sample ref: 41(7702)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699HAFSPVASVESASGETLHSPK   sample ref: 19(2714)
A795BAFM, ALB2, ALBAAfamin precursorO89020HCFEHLK   sample ref: 9(2838)
A8269IGHG2Ig gamma-2P01867HEGLKNYYLK   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866HEGLKNYYLK   sample ref: 21(7602)
A795BAFM, ALB2, ALBAAfamin precursorO89020HFLVKFTK   sample ref: 9(2838)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590HGAFMLAFDLKDEK   sample ref: 1(418)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590HGAFMLAFDLKDEK   
A8954CFP, PFCComplement factor ProperdinP11680HGGPFCAGDATR   sample ref: 50(7730)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9HLEPDAFGGLPR   sample ref: 17(1810)
A1539KNG1, BDK, KNGKininogen-1O08677HLGQSLDCNANVYMRPWENK   
A9149GCVitamin D-binding protein precursorP21614HLSLLTTMSNR   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614HLSLLTTMSNR   
A8273IGK, SDNK1, A30Ig kappa chainP01837HNSYTCEATHK   sample ref: 29(5209)
A8273IGK, SDNK1, A30Ig kappa chainP01837HNSYTCEATHKTSTSPIVK   sample ref: 29(5209)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724HPDYSVSLLLR   sample ref: 10(1702)
A8363IGHM, IgIg mu chain CP01872HPPAVYLLPPAR   sample ref: 35(4708)
A643CTF, PRO1400Serotransferrin precursorQ921I1HQTVLDNTEGKNPAEWAK   sample ref: 41(7702)
A1468PLGPlasminogen precursorP20918HSIFTPQTNPR   sample ref: 37(5827)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838HSLGDNDAHSIFQSVGINIFTNSK   sample ref: 7(4850)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623HSLMPMLETLK   sample ref: 11(2312)
A1276CLU, APOJ, CLIClusterin precursorQ06890HTCMKFYAR   
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1HVPLIQPVEK   sample ref: 20(3707)
A0419GSNGelsolin precursor, plasmaP13020HVVPNEVVVQR   sample ref: 22(4825)
A648CTTR, PALB, TBPATransthyretin precursorP07309HYTIAALLSPYSYSTTAVVSNPQN   sample ref: 42(5101)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339ICPKPDDLPFATVVPLK   sample ref: 14(6706)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726IDPPTVTITSR   sample ref: 45(2505)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599IFNNGADLSGITEENAPLK   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896IFNNGADLSGITEENAPLK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897IFNNGADLSGITEENAPLK   sample ref: 4(1610)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105IFNNGADLSGITEENAPLK   sample ref: 5(1612)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599IFNNGADLSGITEENAPLKLSK   sample ref: 2(1621)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897IFNNGADLSGITEENAPLKLSK   sample ref: 4(1610)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896IFNNGADLSGITEENAPLKLSQAVHK   sample ref: 3(2602)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942IGGHGAEYGAEALER   sample ref: 25(7011)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942IGGHGAEYGAEALERMFASFPTTK   sample ref: 25(7011)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942IGGHGAEYGAEALERMFASFPTTK   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279IICAQQCSHR   sample ref: 46(2844)
A8272IGJ, IGCJImmunoglobulin J chainP01592IIPSTEDPNEDIVER   sample ref: 48(1207)
A8272IGJ, IGCJImmunoglobulin J chainP01592IIPSTEDPNEDIVERNIR   sample ref: 48(1207)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938INGEWHTIILASDKR   sample ref: 36(1117)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279IPLENLQIIR   sample ref: 46(2844)
A643CTF, PRO1400Serotransferrin precursorQ921I1IPSHAVVAR   sample ref: 41(7702)
A6465Es1Liver carboxylesterase NP23953ISEDCLYLNIYSPADLTK   sample ref: 18(1709)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726ISLHWNK   sample ref: 45(2505)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339ITCPPPPVPK   sample ref: 14(6706)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599IVEAVKELDQDTVFALANYILFK   sample ref: 2(1621)
A1471VTNVitronectin precursorP29788IYVTGSLSHSAQAK   sample ref: 44(1714)
A1602CFB, BF, BFDComplement factor B precursorP04186KAEGIPEFYDYDVALVK   sample ref: 15(6802)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339KATVLYQGMR   
A1468PLGPlasminogen precursorP20918KCQSWAAMFPHR   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339KCSYTVEAHCR   sample ref: 14(6706)
A1602CFB, BF, BFDComplement factor B precursorP04186KDNEHHVFK   sample ref: 15(6802)
A8363IGHM, IgIg mu chain CP01872KEFVCTVTHR   sample ref: 35(4708)
A9149GCVitamin D-binding protein precursorP21614KFSSSTFEQVNQLVK   sample ref: 43(3706)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728KGSPDQPQALPLPEQAQEQAQEQAQEQVQPKPLES   sample ref: 12(2311)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726KLAFEPER   sample ref: 45(2505)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896KLDQDTVFALANYILFK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897KLDQDTVFALANYILFK   sample ref: 4(1610)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105KLDQDTVFALANYILFK   sample ref: 5(1612)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896KPFDPENTEEAEFHVDESTTVK   sample ref: 3(2602)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599KPFDPENTEEAEFHVDK   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599KPFDPENTEEAEFHVDKSTTVK   sample ref: 2(1621)
A643CTF, PRO1400Serotransferrin precursorQ921I1KPVDQYEDCYLAR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1KPVKDFASCHLAQAPNHVVVSR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1KSCHTGLGR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1KSCHTGVDR   sample ref: 41(7702)
A648CTTR, PALB, TBPATransthyretin precursorP07309KTSEGSWEPFASGK   sample ref: 42(5101)
A643CTF, PRO1400Serotransferrin precursorQ921I1KTSYPDCIK   sample ref: 41(7702)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838KTVSWAVTPK   sample ref: 7(4850)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898KWEQAGAAEYYR   sample ref: 24(2503)
A021CHPXHemopexin precursorQ91X72KWFWDFATR   sample ref: 26(2722)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724KYEATLEK   sample ref: 10(1702)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532KYFQGLLNR   sample ref: 40(8129)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623LAELKSNPTLNEYHTR   sample ref: 11(2312)
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039LANMEAEIR   
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247LAPRMEEDYPQFSSPK   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896LAQIHFPR   sample ref: 3(2602)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105LAQIHFPR   sample ref: 5(1612)
A9149GCVitamin D-binding protein precursorP21614LAQKVPTANLENVLPLAEDFTEILSR   sample ref: 43(3706)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LCAIPNLR   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LCAIPNLRENYGELADCCTK   sample ref: 10(1702)
A643CTF, PRO1400Serotransferrin precursorQ921I1LCQLCPGCGCSSTQPFFGYVGAFK   sample ref: 41(7702)
A4552ACTG1, ACTGActin, cytoplasmic 2P60710LDLAGRDLTDYLMK   
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247LDNQDFGDHATLK   sample ref: 6(2630)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247LDNQDFGDHATLKR   sample ref: 6(2630)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897LDQDTVFALANYILFK   sample ref: 4(1610)
A1602CFB, BF, BFDComplement factor B precursorP04186LEDIVTYHCSR   sample ref: 15(6802)
A8269IGHG2Ig gamma-2P01867LEPSGPISTINPCPPCK   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866LEPSGPISTINPCPPCK   sample ref: 21(7602)
A8269IGHG2Ig gamma-2P01867LEPSGPISTINPCPPCKECHK   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866LEPSGPISTINPCPPCKECHK   sample ref: 21(7602)
A001AMup8, Mup11Major urinary proteins 11 and 8P04938LFLEQIHVLENSLVLK   sample ref: 36(1117)
A021CHPXHemopexin precursorQ91X72LFQEEFPGIPYPPDAAVECHR   sample ref: 26(2722)
A1176APOEApolipoprotein E precursorP08226LGADMEDLRNR   
A452CSLC6A11, GABT3, GAT3Sodium- and chloride-dependent GABA transporter 3P31650LGASPRTVTVNDCEAK   sample ref: 39(5304)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LGDASTYADGVHNK   sample ref: 12(2311)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LGEYGFQNAILVR   sample ref: 10(1702)
A1176APOEApolipoprotein E precursorP08226LGKEVQAAQAR   sample ref: 13(3409)
A1176APOEApolipoprotein E precursorP08226LGPLVEQGR   sample ref: 13(3409)
A1176APOEApolipoprotein E precursorP08226LGPLVEQGRQR   sample ref: 13(3409)
A8363IGHM, IgIg mu chain CP01872LICEATNFTPKPITVSWLK   sample ref: 35(4708)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247LIGQNDKADFHGGK   sample ref: 6(2630)
A1468PLGPlasminogen precursorP20918LILEPNNR   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918LILEPNNRDIALLK   sample ref: 37(5827)
A1471VTNVitronectin precursorP29788LIQDVWGIEGPIDAAFTR   sample ref: 44(1714)
A1468PLGPlasminogen precursorP20918LKEAQLPVIENK   sample ref: 37(5827)
A1176APOEApolipoprotein E precursorP08226LKGWFEPIVEDMHR   
A643CTF, PRO1400Serotransferrin precursorQ921I1LLEACTFHKH   sample ref: 41(7702)
A8273IGK, SDNK1, A30Ig kappa chainP03977LLIYAASNQGSGVPAR   sample ref: 31(4309)
A8273IGK, SDNK1, A30Ig kappa chainP01656LLIYAASNQGSGVPAR   sample ref: 49(2188)
A8273IGK, SDNK1, A30Ig kappa chainP01644LLIYYTSR   sample ref: 32(4303)
A8273IGK, SDNK1, A30Ig kappa chainP01645LLIYYTSR   sample ref: 33(5101)
A8273IGK, SDNK1, A30Ig kappa chainP01645LLIYYTSRLHSGVPSR   sample ref: 33(5101)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LNHQMEGLAFQMK   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LNHQMEGLAFQMKK   
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LPCVEDYLSAILNR   sample ref: 10(1702)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339LPECLEVK   sample ref: 14(6706)
A643CTF, PRO1400Serotransferrin precursorQ921I1LPEGTTPEK   sample ref: 41(7702)
A1176APOEApolipoprotein E precursorP08226LQAEIFQAR   sample ref: 13(3409)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LQEHLKPYAVDLQDQINTQTQEMK   
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9LQLLNLSR   sample ref: 17(1810)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LQLTPYIQR   sample ref: 12(2311)
A9149GCVitamin D-binding protein precursorP21614LQMKHLSLLTTMSNR   
A9149GCVitamin D-binding protein precursorP21614LQMKHLSLLTTMSNR   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724LQNLDGTCADSYSFVFSR   sample ref: 38(5215)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724LQNLDGTCADSYSFVFSRDPNGLSPETR   sample ref: 38(5215)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LQTCCDKPLLK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LQTCCDKPLLKK   sample ref: 10(1702)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942LRVDPVNFK   sample ref: 25(7011)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599LSISGDYNLK   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599LSISGDYNLKTLMSPLGITR   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599LSISGDYNLKTLMSPLGITR   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896LSISGEYNLK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897LSISGNYNLK   sample ref: 4(1610)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9LSNNMLAR   
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838LSPQSIYNLLPGK   sample ref: 7(4850)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623LSPVAEEFR   sample ref: 11(2312)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623LSPVAEEFRDR   sample ref: 11(2312)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LSQTFPNADFAEITK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LSQTFPNADFAEITKLATDLTK   sample ref: 10(1702)
A1468PLGPlasminogen precursorP20918LSRPATITDK   sample ref: 37(5827)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838LTEVPALVHKDTVVK   sample ref: 7(4850)
A8363IGHM, IgIg mu chain CP01872LVESGFTTDPVTIENK   sample ref: 35(4708)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728LVPFVVQLSGHLAKETER   sample ref: 12(2311)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724LVQEVTDFAK   sample ref: 10(1702)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599LVQIHIPR   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599LVQIHIPRLSISGDYNLK   sample ref: 2(1621)
A8954CFP, PFCComplement factor ProperdinP11680LVVEEKR   sample ref: 50(7730)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1LVVLPFPGKEQR   sample ref: 20(3707)
A021CHPXHemopexin precursorQ91X72LWWLDLK   sample ref: 26(2722)
A1468PLGPlasminogen precursorP20918LYDYCDIPLCASASSFECGKPQVEPKK   sample ref: 37(5827)
A643CTF, PRO1400Serotransferrin precursorQ921I1LYLGHNYVTAIR   sample ref: 41(7702)
A021CHPXHemopexin precursorQ91X72LYVSSGRR   sample ref: 26(2722)
A6644GPX3, GPXPGlutathione peroxidase 3P46412MDILSYMRR   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942MFASFPTTK   sample ref: 25(7011)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942MFASFPTTK   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942MFASFPTTKTYFPHFDVSHGSAQVK   
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1MFYESVYGQCK   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724MKYWGVASFLQR   sample ref: 38(5215)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724MKYWGVASFLQR   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728MMPHANKVTQTFGENMQK   
A6465Es1Liver carboxylesterase NP23953MNEETASLLLR   sample ref: 18(1709)
A6465Es1Liver carboxylesterase NP23953MNEETASLLLR   
A6465Es1Liver carboxylesterase NP23953MNEETASLLLRR   sample ref: 18(1709)
A6465Es1Liver carboxylesterase NP23953MNEETASLLLRR   
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599MQHLEQTLNKELISK   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896MQHLEQTLSK   sample ref: 3(2602)
A1468PLGPlasminogen precursorP20918MRDVILFEK   
A8954CFP, PFCComplement factor ProperdinP11680MSINCEGTPGQQSR   sample ref: 50(7730)
A8954CFP, PFCComplement factor ProperdinP11680MSINCEGTPGQQSR   
A6465Es1Liver carboxylesterase NP23953MVMKFWANFAR   
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039NAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGR   
A8272IGJ, IGCJImmunoglobulin J chainP01592NFVYHLSDVCK   sample ref: 48(1207)
A8272IGJ, IGCJImmunoglobulin J chainP01592NFVYHLSDVCKK   sample ref: 48(1207)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339NGMMHGDKIHFYCK   
A6465Es1Liver carboxylesterase NP23953NGNPNGEGLPHWPEYDEKEGYLQIGATTQQAQR   sample ref: 18(1709)
A1471VTNVitronectin precursorP29788NGSLFAFR   sample ref: 44(1714)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532NHGLETLQATQK   sample ref: 40(8129)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532NHGLETLQATQKAEEWGR   sample ref: 40(8129)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896NHYQAEVFSVNFAESEEAK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897NHYQAEVFSVNFAESEEAK   sample ref: 4(1610)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896NHYQAEVFSVNFAESEEAKK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897NHYQAEVFSVNFAESEEAKK   sample ref: 4(1610)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105NHYQAEVFSVNFAESEEAKK   sample ref: 5(1612)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728NLAPLVEDVQSK   sample ref: 12(2311)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279NLCYANTINWK   sample ref: 46(2844)
A1468PLGPlasminogen precursorP20918NLEENYCR   sample ref: 37(5827)
A643CTF, PRO1400Serotransferrin precursorQ921I1NLKQEDFELLCPDGTR   sample ref: 41(7702)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279NLQEILIGAVR   sample ref: 46(2844)
A8363IGHM, IgIg mu chain CP01872NLVAMGCLAR   sample ref: 35(4708)
A8363IGHM, IgIg mu chain CP01872NLVAMGCLAR   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728NMEELKGHLTPR   
A1468PLGPlasminogen precursorP20918NPDGDVNGPWCYTTNPR   sample ref: 37(5827)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532NPNHFRPEGLPEKF   sample ref: 40(8129)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247NPNPSALPQLQEQR   sample ref: 6(2630)
A643CTF, PRO1400Serotransferrin precursorQ921I1NQQEGVCPEGSIDNSPVK   sample ref: 41(7702)
A6644GPX3, GPXPGlutathione peroxidase 3P46412NSCPPTAELLGSPGR   sample ref: 23(3109)
A1471VTNVitronectin precursorP29788NWHGVPGKVDAAMAGR   sample ref: 44(1714)
A1471VTNVitronectin precursorP29788NWHGVPGKVDAAMAGR   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279NYDLSFLK   sample ref: 46(2844)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279NYVVTDHGSCVR   sample ref: 46(2844)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724QEELCLER   sample ref: 38(5215)
A4552ACTG1, ACTGActin, cytoplasmic 2P60710QEYDESGPSIVHR   sample ref: 8(4503)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623QKLQELQGR   sample ref: 11(2312)
A6465Es1Liver carboxylesterase NP23953QKTESELLEISGK   sample ref: 18(1709)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728QLEQQVEEFRR   sample ref: 12(2311)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699QLTEHAVEGDCDFHILK   sample ref: 19(2714)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699QLTEHAVEGDCDFHILKQDGQFR   sample ref: 19(2714)
A8273IGK, SDNK1, A30Ig kappa chainP01837QNGVLNSWTDQDSK   sample ref: 29(5209)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897QPFDPENTEEAEFHVDESTTVK   sample ref: 4(1610)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728QQLGPNSGEVESHLSFLEK   sample ref: 12(2311)
A1602CFB, BF, BFDComplement factor B precursorP04186QQLVPSYAR   sample ref: 15(6802)
A1276CLU, APOJ, CLIClusterin precursorQ06890QQSQVLDAMQDSFAR   
A8954CFP, PFCComplement factor ProperdinP11680QRLCTPLLPK   sample ref: 50(7730)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724QRQEELCLER   sample ref: 38(5215)
A8954CFP, PFCComplement factor ProperdinP11680QRVCDNPAPK   sample ref: 50(7730)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724QTALAELVK   sample ref: 10(1702)
A0419GSNGelsolin precursor, plasmaP13020QTQVSVLPEGGETPLFK   sample ref: 22(4825)
A1176APOEApolipoprotein E precursorP08226QWANLMEK   sample ref: 13(3409)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724QYRWIEHNGYCQSRPSR   sample ref: 38(5215)
A1602CFB, BF, BFDComplement factor B precursorP04186RDLEIEEVLFHPK   sample ref: 15(6802)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724RHPDYSVSLLLR   sample ref: 10(1702)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896RLAQIHFPR   sample ref: 3(2602)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105RLAQIHFPR   sample ref: 5(1612)
A795BAFM, ALB2, ALBAAfamin precursorO89020RLCFFYNK   sample ref: 9(2838)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599RLVQIHIPR   sample ref: 2(1621)
A021CHPXHemopexin precursorQ91X72RLWWLDLK   sample ref: 26(2722)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724RPCFSALTVDETYVPK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724RPCFSALTVDETYVPKEFK   sample ref: 10(1702)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590RPDITPELR   sample ref: 1(418)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590RPDITPELREVFQK   sample ref: 1(418)
A1276CLU, APOJ, CLIClusterin precursorQ06890RPHFLYPK   sample ref: 16(1138)
A1539KNG1, BDK, KNGKininogen-1O08677RPPGFSPFR   sample ref: 30(2717)
A1602CFB, BF, BFDComplement factor B precursorP04186RQQLVPSYAR   sample ref: 15(6802)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897RSDAQIHIPR   sample ref: 4(1610)
A0419GSNGelsolin precursor, plasmaP13020RTPITVVR   sample ref: 22(4825)
A9149GCVitamin D-binding protein precursorP21614RTQVPEVFLSK   sample ref: 43(3706)
A1468PLGPlasminogen precursorP20918RVYLSECK   sample ref: 37(5827)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1SAECPGPEKENNPLVLPP   sample ref: 20(3707)
A643CTF, PRO1400Serotransferrin precursorQ921I1SAGWVIPIGLLFCK   sample ref: 41(7702)
A9149GCVitamin D-binding protein precursorP21614SCESDAPFPVHPGTPECCTK   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614SCESDAPFPVHPGTPECCTKEGLER   sample ref: 43(3706)
A643CTF, PRO1400Serotransferrin precursorQ921I1SCHTGLGR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1SCHTGVDR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1SCHTGVDRTAGWNIPMGMLYNR   
A8954CFP, PFCComplement factor ProperdinP11680SCSAPAPSHQPPGKPCSGPAYEHK   sample ref: 50(7730)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897SDAQIHIPR   sample ref: 4(1610)
A0419GSNGelsolin precursor, plasmaP13020SEDCFILDHGR   sample ref: 22(4825)
A0419GSNGelsolin precursor, plasmaP13020SEDCFILDHGRDGK   sample ref: 22(4825)
A8273IGK, SDNK1, A30Ig kappa chainP01837SFNRNEC   sample ref: 29(5209)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK   sample ref: 4(1610)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105SFQHLLQTLNRPDSELQLSTGNGLFVNNDLK   sample ref: 5(1612)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896SFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897SFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEK   sample ref: 4(1610)
A1468PLGPlasminogen precursorP20918SFQYHSK   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918SFQYHSKEQQCVIMAENSK   
A0419GSNGelsolin precursor, plasmaP13020SGALNSNDAFVLK   sample ref: 22(4825)
A021CHPXHemopexin precursorQ91X72SGAQATWTEVSWPHEKVDGALCLDK   sample ref: 26(2722)
A1539KNG1, BDK, KNGKininogen-1O08677SGNQYMLHR   sample ref: 30(2717)
A1539KNG1, BDK, KNGKininogen-1O08677SGNQYMLHR   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726SHLDRIDPPTVTITSR   sample ref: 45(2505)
A8363IGHM, IgIg mu chain CP01872SILEGSDEYLVCK   sample ref: 35(4708)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838SKAINYLISGYQR   sample ref: 7(4850)
A643CTF, PRO1400Serotransferrin precursorQ921I1SKDFQLFSSPLGK   sample ref: 41(7702)
A1176APOEApolipoprotein E precursorP08226SKMEEQTQQIR   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728SLAPLTVGVQEK   sample ref: 12(2311)
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039SLCTELQGTVAIPR   sample ref: 34(8201)
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039SLCTELQGTVAIPRNAEENK   sample ref: 34(8201)
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionP06330SLEWIGDINPNNGGTSYNQK   sample ref: 27(7614)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724SLHTLFGDKLCAIPNLR   sample ref: 10(1702)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279SLKEISDGDVIISGNR   sample ref: 46(2844)
A021CHPXHemopexin precursorQ91X72SLPQPQKVNSILGCSQ   sample ref: 26(2722)
A6465Es1Liver carboxylesterase NP23953SLRDAGVSTYMYEFR   sample ref: 18(1709)
A6465Es1Liver carboxylesterase NP23953SLRDAGVSTYMYEFR   
A9149GCVitamin D-binding protein precursorP21614SLSLILYSR   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614SLSLILYSRK   sample ref: 43(3706)
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionP06330SLTSEDSAVYYCAR   sample ref: 27(7614)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623SNPTLNEYHTR   sample ref: 11(2312)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868SNWEAGNTFTCSVLHEGLHNHHTEK   sample ref: 28(7555)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279SPSDCCHNQCAAGCTGPR   sample ref: 46(2844)
A462DGUGU, FETUB, IRL685Fetuin-B precursorQ9QXC1SQASCSLQHSDSEPVGICQGSTVQSSLR   sample ref: 20(3707)
A0419GSNGelsolin precursor, plasmaP13020SQHVQVEEGSEPDAFWEALGGK   sample ref: 22(4825)
A9149GCVitamin D-binding protein precursorP21614SRLSHLIK   sample ref: 43(3706)
A1471VTNVitronectin precursorP29788SSDGAREPQFISR   sample ref: 44(1714)
A1468PLGPlasminogen precursorP20918SSRPEFYK   sample ref: 37(5827)
A1602CFB, BF, BFDComplement factor B precursorP04186STGSWSDLQTR   sample ref: 15(6802)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247SVPTAEETRR   sample ref: 6(2630)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868SVSELPIMHQDWLNGKEFK   
A1539KNG1, BDK, KNGKininogen-1O08677SVTVQETK   sample ref: 30(2717)
A4552ACTG1, ACTGActin, cytoplasmic 2P60710SYELPDGQVITIGNER   sample ref: 8(4503)
A648CTTR, PALB, TBPATransthyretin precursorP07309TAESGELHGLTTDEK   sample ref: 42(5101)
A648CTTR, PALB, TBPATransthyretin precursorP07309TAESGELHGLTTDEKFVEGVYR   sample ref: 42(5101)
A643CTF, PRO1400Serotransferrin precursorQ921I1TAGWNIPMGMLYNR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1TAGWNIPMGMLYNR   
A1176APOEApolipoprotein E precursorP08226TANLGAGAAQPLRDR   sample ref: 13(3409)
A1468PLGPlasminogen precursorP20918TAVTAAGTPCQGWAAQEPHR   sample ref: 37(5827)
A8954CFP, PFCComplement factor ProperdinP11680TCDHPAPR   sample ref: 50(7730)
A795BAFM, ALB2, ALBAAfamin precursorO89020TDFAFRR   sample ref: 9(2838)
A1539KNG1, BDK, KNGKininogen-1O08677TDGSPTFYSFK   sample ref: 30(2717)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898TDPPKTHVTHHPGSEGDVTLR   sample ref: 24(2503)
A8269IGHG2Ig gamma-2P01867TDSFSCNVR   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866TDSFSCNVR   sample ref: 21(7602)
A8269IGHG2Ig gamma-2P01867TDSFSCNVRHEGLK   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866TDSFSCNVRHEGLK   sample ref: 21(7602)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728TDVTQQLSTLFQDKLGDASTYADGVHNK   sample ref: 12(2311)
A8273IGK, SDNK1, A30Ig kappa chainP01644TFGGGTKLEIK   sample ref: 32(4303)
A8273IGK, SDNK1, A30Ig kappa chainP01645TFGGGTKLEIK   sample ref: 33(5101)
A8378SERPINF2, AAP, PLIAlpha-2-antiplasmin precursorQ61247TFGPDLKLAPR   sample ref: 6(2630)
A8363IGHM, IgIg mu chain CP01872TGGKYLATSQVLLSPK   sample ref: 35(4708)
A1468PLGPlasminogen precursorP20918TGIGNGYRGTMSR   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279TGLRELPMR   sample ref: 46(2844)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339TGTWSFLPTCR   sample ref: 14(6706)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898THVTHHPGSEGDVTLR   sample ref: 24(2503)
A1468PLGPlasminogen precursorP20918TICYITGWGETQGTFGAGR   sample ref: 37(5827)
A795BAFM, ALB2, ALBAAfamin precursorO89020TINPAVDHCCK   sample ref: 9(2838)
A795BAFM, ALB2, ALBAAfamin precursorO89020TINPAVDHCCKTDFAFR   sample ref: 9(2838)
A8269IGHG2Ig gamma-2P01867TISRSPGLDLDDICAEAK   sample ref: 47(7636)
A648CTTR, PALB, TBPATransthyretin precursorP07309TLGISPFHEFADVVFTANDSGHR   sample ref: 42(5101)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599TLMSPLGITR   sample ref: 2(1621)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599TLMSPLGITR   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896TLMSPLGITR   sample ref: 3(2602)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896TLMSPLGITR   
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897TLMSPLGITR   sample ref: 4(1610)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897TLMSPLGITR   
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105TLMSPLGITR   sample ref: 5(1612)
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105TLMSPLGITR   
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896TLMSPLGITRIFNNGADLSGITEENAPLK   
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897TLMSPLGITRIFNNGADLSGITEENAPLK   
A8374Serpina1fAlpha-1-antitrypsin 1-6P81105TLMSPLGITRIFNNGADLSGITEENAPLK   
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9TLNLAQNLLTQLPK   sample ref: 17(1810)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9TLPGRLFQSLR   sample ref: 17(1810)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724TNCDLYEKLGEYGFQNAILVR   sample ref: 10(1702)
A1468PLGPlasminogen precursorP20918TPENFPCK   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918TPENFPDAGLEMNYCR   
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279TPPLDPRELEILK   sample ref: 46(2844)
A0419GSNGelsolin precursor, plasmaP13020TPSAAYLWVGAGASEAEK   sample ref: 22(4825)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724TPVSEHVTK   sample ref: 10(1702)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623TQLAPHSEQMR   sample ref: 11(2312)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623TQLAPHSEQMR   
A1552APOA1, A175PApolipoprotein A-I precursorQ00623TQLAPHSEQMRESLAQR   
A9149GCVitamin D-binding protein precursorP21614TQVPEVFLSK   sample ref: 43(3706)
A648CTTR, PALB, TBPATransthyretin precursorP07309TSEGSWEPFASGK   sample ref: 42(5101)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339TSYDPGEQIVYSCKPGYVSR   sample ref: 14(6706)
A643CTF, PRO1400Serotransferrin precursorQ921I1TSYPDCIK   sample ref: 41(7702)
A8269IGHG2Ig gamma-2P01867TTPPSVYPLAPGCGDTTGSSVTLGCLVK   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866TTPPSVYPLAPGCGDTTGSSVTLGCLVK   sample ref: 21(7602)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868TTPPSVYPLAPGSAAQTNSMVTLGCLVK   
A6644GPX3, GPXPGlutathione peroxidase 3P46412TTVSNVKMDILSYMR   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728TVEPMGEMFNK   
A643CTF, PRO1400Serotransferrin precursorQ921I1TVLPPDGPR   sample ref: 41(7702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724TVMDDFAQFLDTCCK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724TVMDDFAQFLDTCCK   
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898TWTAADVAAIITR   sample ref: 24(2503)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942TYFPHFDVSHGSAQVK   sample ref: 25(7011)
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP01942TYFPHFDVSHGSAQVKGHGK   sample ref: 25(7011)
A1471VTNVitronectin precursorP29788TYLFKGSQYWR   sample ref: 44(1714)
A4552ACTG1, ACTGActin, cytoplasmic 2P60710VAPEEHPVLLTEAPLNPK   sample ref: 8(4503)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623VAPLGAELQESAR   sample ref: 11(2312)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623VAPLGAELQESARQK   sample ref: 11(2312)
A643CTF, PRO1400Serotransferrin precursorQ921I1VAQEHFGK   sample ref: 41(7702)
A1602CFB, BF, BFDComplement factor B precursorP04186VASYGVRPR   sample ref: 15(6802)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724VCLLHEK   sample ref: 10(1702)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724VCLLHEKTPVSEHVTK   sample ref: 10(1702)
A9149GCVitamin D-binding protein precursorP21614VCNELAMLGKEDFR   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614VCNELAMLGKEDFR   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339VCPFAGILENGIVR   sample ref: 14(6706)
A9149GCVitamin D-binding protein precursorP21614VCSQYAAYGK   sample ref: 43(3706)
A9149GCVitamin D-binding protein precursorP21614VCSQYAAYGKEK   sample ref: 43(3706)
A1468PLGPlasminogen precursorP20918VEYLNNR   sample ref: 37(5827)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699VGQPGAAGPVSPMCPGR   sample ref: 19(2714)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorP29699VGQPGAAGPVSPMCPGR   
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898VGSDGRFLR   sample ref: 24(2503)
A1602CFB, BF, BFDComplement factor B precursorP04186VGSQYRLEDIVTYHCSR   sample ref: 15(6802)
A1539KNG1, BDK, KNGKininogen-1O08677VIEGTKTDGSPTFYSFK   sample ref: 30(2717)
A1468PLGPlasminogen precursorP20918VILGAHEEYIR   sample ref: 37(5827)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896VINDFVEK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897VINDFVEK   sample ref: 4(1610)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599VINDFVEKGTQGK   sample ref: 2(1621)
A8371Serpina1cAlpha-1-antitrypsin 1-3Q00896VINDFVEKGTQGK   sample ref: 3(2602)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897VINDFVEKGTQGK   sample ref: 4(1610)
A1468PLGPlasminogen precursorP20918VIPACLPSPNYMVADR   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorQ64726VIPGGNRIFK   sample ref: 45(2505)
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838VKALSFYQPR   sample ref: 7(4850)
A643CTF, PRO1400Serotransferrin precursorQ921I1VKAVLTSQETLFGGSDCTGNFCLFK   sample ref: 41(7702)
A1602CFB, BF, BFDComplement factor B precursorP04186VKDASEVVTPR   sample ref: 15(6802)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623VKDFANVYVDAVK   sample ref: 11(2312)
A452CSLC6A11, GABT3, GAT3Sodium- and chloride-dependent GABA transporter 3P31650VKGDGTISAITEK   sample ref: 39(5304)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728VKGNTEGLQK   sample ref: 12(2311)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339VKIQEQFK   sample ref: 14(6706)
A9990MBD3L, MBD3L1Methyl-CpG-binding domain protein 3-like 1P39039VKSLCTELQGTVAIPR   sample ref: 34(8201)
A452CSLC6A11, GABT3, GAT3Sodium- and chloride-dependent GABA transporter 3P31650VLAISDGIEHIGNLR   sample ref: 39(5304)
A648CTTR, PALB, TBPATransthyretin precursorP07309VLDAVRGSPAVDVAVK   sample ref: 42(5101)
A9149GCVitamin D-binding protein precursorP21614VLEPTLKTLR   sample ref: 43(3706)
A6465Es1Liver carboxylesterase NP23953VLGKYISLEGFEQPVAVFLGVPFAKPPLGSLR   sample ref: 18(1709)
A795BAFM, ALB2, ALBAAfamin precursorO89020VLNSINVAVFSK   sample ref: 9(2838)
A795BAFM, ALB2, ALBAAfamin precursorO89020VMLDYRDR   sample ref: 9(2838)
A795BAFM, ALB2, ALBAAfamin precursorO89020VMLDYRDR   
A8269IGHG2Ig gamma-2P01867VNNKDLPSPIER   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866VNNKDLPSPIER   sample ref: 21(7602)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionP01868VNSAAFPAPIEK   sample ref: 28(7555)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728VNSFMSTLEK   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728VNSFMSTLEKK   
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorQ61838VNTNYRPGLPFSGQVLLVDEK   sample ref: 7(4850)
A643CTF, PRO1400Serotransferrin precursorQ921I1VPPRMDYR   
A1552APOA1, A175PApolipoprotein A-I precursorQ00623VQPYLDEFQK   sample ref: 11(2312)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623VQPYLDEFQKK   sample ref: 11(2312)
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06728VSAKIDQLQK   sample ref: 12(2311)
A0419GSNGelsolin precursor, plasmaP13020VSEARPSTMVVEHPEFLK   sample ref: 22(4825)
A0419GSNGelsolin precursor, plasmaP13020VSEARPSTMVVEHPEFLK   
A0419GSNGelsolin precursor, plasmaP13020VSNGAGSMSVSLVADENPFAQGALR   
A1468PLGPlasminogen precursorP20918VSRFVDWIER   sample ref: 37(5827)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9VVFLNTQVR   sample ref: 17(1810)
A1468PLGPlasminogen precursorP20918VVGGCVANPHSWPWQISLR   sample ref: 37(5827)
A021CHPXHemopexin precursorQ91X72VWVYPPEKK   sample ref: 26(2722)
A1468PLGPlasminogen precursorP20918VYLSECKTGIGNGYR   sample ref: 37(5827)
A795BAFM, ALB2, ALBAAfamin precursorO89020VYMDFLEDCCSR   sample ref: 9(2838)
A795BAFM, ALB2, ALBAAfamin precursorO89020VYMDFLEDCCSR   
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898WASVVVPLGK   sample ref: 24(2503)
A643CTF, PRO1400Serotransferrin precursorQ921I1WCALSHLER   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1WCAVSEHENTK   sample ref: 41(7702)
A8269IGHG2Ig gamma-2P01867WEKTDSFSCNVR   sample ref: 47(7636)
A8269IGHG2Ig gamma-2P01866WEKTDSFSCNVR   sample ref: 21(7602)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898WEQAGAAEYYR   sample ref: 24(2503)
A1468PLGPlasminogen precursorP20918WEYCDIPR   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918WEYCNLKR   sample ref: 37(5827)
A021CHPXHemopexin precursorQ91X72WFWDFATR   sample ref: 26(2722)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724WIEHNGYCQSRPSR   sample ref: 38(5215)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724WIEHNGYCQSRPSRNSL   sample ref: 38(5215)
A1552APOA1, A175PApolipoprotein A-I precursorQ00623WKEDVELYR   sample ref: 11(2312)
A8273IGK, SDNK1, A30Ig kappa chainP01837WKIDGSER   sample ref: 29(5209)
A8370Serpina1bAlpha-1-antitrypsin 1-2P22599WKKPFDPENTEEAEFHVDK   sample ref: 2(1621)
A021CHPXHemopexin precursorQ91X72WKNPITSVDAAFR   sample ref: 26(2722)
A8372Serpina1dAlpha-1-antitrypsin 1-4Q00897WKQPFDPENTEEAEFHVDESTTVK   sample ref: 4(1610)
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorQ9DBB9WLNIQLSSR   sample ref: 17(1810)
A1468PLGPlasminogen precursorP20918WSEQTPHR   sample ref: 37(5827)
A1468PLGPlasminogen precursorP20918WSEQTPHRHNR   sample ref: 37(5827)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorQ01339WSPDIPACAR   sample ref: 14(6706)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279YCTAISGDLHILPVAFK   sample ref: 46(2844)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279YCTAISGDLHILPVAFKGDSFTR   sample ref: 46(2844)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590YEGGVETFAHLIVLR   sample ref: 1(418)
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorQ60590YEGGVETFAHLIVLRK   sample ref: 1(418)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898YFETSVSRPGLGEPR   sample ref: 24(2503)
A5592SAA4, CSAASerum amyloid A-4 proteinP31532YFQGLLNR   sample ref: 40(8129)
A1602CFB, BF, BFDComplement factor B precursorP04186YGLLTYATVPK   sample ref: 15(6802)
A1602CFB, BF, BFDComplement factor B precursorP04186YGQTLRPICLPCTEGTTR   sample ref: 15(6802)
A0419GSNGelsolin precursor, plasmaP13020YIETDPANR   sample ref: 22(4825)
A0419GSNGelsolin precursor, plasmaP13020YIETDPANRDR   sample ref: 22(4825)
A1276CLU, APOJ, CLIClusterin precursorQ06890YINKEIQNAVQGVK   sample ref: 16(1138)
A6465Es1Liver carboxylesterase NP23953YISLEGFEQPVAVFLGVPFAKPPLGSLR   sample ref: 18(1709)
A8363IGHM, IgIg mu chain CP01872YLATSQVLLSPK   sample ref: 35(4708)
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorP01898YLELGKETLLR   sample ref: 24(2503)
A643CTF, PRO1400Serotransferrin precursorQ921I1YLGAEYMQSVGNMR   sample ref: 41(7702)
A643CTF, PRO1400Serotransferrin precursorQ921I1YLGAEYMQSVGNMR   
A643CTF, PRO1400Serotransferrin precursorQ921I1YLGAEYMQSVGNMRK   
A1581ALB, GIG20, GIG42Serum albumin precursorP07724YMCENQATISSK   
A1581ALB, GIG20, GIG42Serum albumin precursorP07724YNDLGEQHFK   sample ref: 10(1702)
A6465Es1Liver carboxylesterase NP23953YRPSFVSDK   sample ref: 18(1709)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279YSFGATCVK   sample ref: 46(2844)
A0156EGFR, ERBB, ERBB1Epidermal growth factor receptor precursorQ01279YSFGATCVKK   sample ref: 46(2844)
A1581ALB, GIG20, GIG42Serum albumin precursorP07724YTQKAPQVSTPTLVEAAR   sample ref: 10(1702)
A1539KNG1, BDK, KNGKininogen-1O08677YVIEFIAR   sample ref: 30(2717)
A6644GPX3, GPXPGlutathione peroxidase 3P46412YVRPGGGFVPNFQLFEK   sample ref: 23(3109)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaQ00724YWGVASFLQR   sample ref: 38(5215)
A021CHPXHemopexin precursorQ91X72YYCFQGNK   sample ref: 26(2722)
A021CHPXHemopexin precursorQ91X72YYCFQGNKFLR   sample ref: 26(2722)

Compile date 12-23-2014© PADB initiative