PADB-logoLSSR - PepMap molecular information by study

Study ID 17494094
Species human
Disease healthy; Dent's disease, X-linked form of renal Fanconi syndrome; Lowe disease, X-linked form of renal Fanconi syndrome
Tissue / Source urine
Compartment whole

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753ALPAPIEKT   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664DEPPQSPWDRV   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583DGRYSLTYIYTGLSKH1778.8846 (expected)  modifications: N-Acetyl (Protein)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629EDPQGDAAQKTDTSHHDQDHPTFNKI   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302EIVMTQSPATLSLSPGERA  modifications: N-Acetyl (Protein); Oxidation (M)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284ERDCRV   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461GRTCPKPDDLPFSTVVPLKT   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513HGSPVDICTAKPRD   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KAAFTECCQAADKA   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KADDKETCFAEEGKKL   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KADEGISFRG   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KADRDQYELLCLDNTRK1881.8385 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KAEFAEVSKL   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KAFLEVNEEGSEAAASTAVVIAGRS   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KAGDFLEANYMNLQRS   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KAGDFLEANYMNLQRS  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KAHGGYSVFAGVGERT   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KAKVQPYLDDFQKKW   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KALFVSEEEKKL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KALVLIAFAQYLQQCPFEDHVKL   
A1702AGT, SERPINA8AngiotensinogenGI:553181KANAGKPKDPTFIPAPIQAKT   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KANRPFLVFIRE   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KAQTTVTCMENGWSPTPRC  modifications: Oxidation(M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871KASYLDCIRA997.472 (expected)   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KATAVMPDGQFKD   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KATAVMPDGQFKD  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KATEDEGSEQKIPEATNRR   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KATEDEGSEQKIPEATNRRV   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KATEHLSTLSEKA   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KATFGCHDGYSLDGPEEIECTKL   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805KATLGPAVRPLPWQRV   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KATVVYQGERV   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KAVGNLRKC757.4709 (expected)   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KAVLTIDEKG   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KAVMDDFAAFVEKC   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KAVMDDFAAFVEKC  modifications: Oxidation (M)
A1599CFH, HF, HF1Complement factor H precursorGI:758073KAVYTCNEGYQLLGEINYRE   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KAYLEEECPATLRK1451.6726 (expected)   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KAYLEEECPATLRKY1579.7641 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KCCAAADPHECYAKV   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378KCEPLEKQHEKE   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KCLAYDFYPGKI1233.5432 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KCLKDGAGDVAFVKH1379.687 (expected)   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KCLPVTAPENGKI   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KCSTSSLLEACTFRR1531.679 (expected)   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KCSYTEDAQCIDGTIEVPKC   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KCYFPYLENGYNQNYGRK   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KDCHLAQVPSHTVVARS1689.8148 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KDDNPNLPRL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KDFDFVPPVVRW   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KDGAGDVAFVKH978.4829 (expected)   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KDICEEQVNSLPGSITKA   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KDISLSDYKG   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KDKATFGCHDGYSLDGPEEIECTKL   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KDLATVYVDVLKD   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KDLATVYVDVLKDSGRD   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KDLLFRDDTVCLAKL1565.7778 (expected)   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KDMALTAFVLISLQEAKD  modifications: Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:553181KDPTFIPAPIQAKT   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KDSGFQMNQLRG1211.524 (expected)  modifications: Oxidation (M)
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KDSGRDYVSQFEGSALGKQ   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KDSTYSLSSTLTLSKA   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KDTEEEDFHVDQVTTVKV   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KDTLMISRT  modifications: Oxidation (M)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KDVFLGMFLYEYARR   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KDYELLCLDGTRK1354.6143 (expected)   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KEAGIPEFYDYDVALIKL   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KEDPQTFYYAVAVVKK1629.7897 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KEFNAETFTFHADICTLSEKE   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KEFNAETFTFHADICTLSEKERQ   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KEFQLFSSPHGKD1276.6232 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KEGYYGYTGAFRC1283.5489 (expected)   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005KEHAVEGDCDFQLLKL   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KEHSSLAFWKT   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KEIPAWVPFDPAAQITKQ1782.9256 (expected)   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KEIPDEISILLLGVAHFKG   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KEKLQDEDLGFL   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KELLDTVTAPQKN   
A0419GSNGelsolin precursor, plasmaGI:38044288KEPAHLMSLFGGKPMIIYKG  modifications: 2 Oxidation (M)
A0419GSNGelsolin precursor, plasmaGI:38044288KEPGLQIWRV   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KEQLQDMGLVDLFSPEKS  modifications: Oxidation (M)
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057KESSSHHPGIAEFPSRG   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KETEGLRQEMSKDLEEVKA   
A021CHPXHemopexin precursorGI:386789KEVGTPHGIILDSVDAAFICPGSSRL   
A0419GSNGelsolin precursor, plasmaGI:38044288KFDLVPVPTNLYGDFFTGDAYVILKT   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KFDTISEKT   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KFGLEKRQ   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KFICPLTGLWPINTLKC   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KFLENEDRRS   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KFNKPFVFLMIEQNTKS  modifications: Oxidation (M)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KFNWYVDGVEVHNAKT   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KFQNALLVRY   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KFSPENTRK   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KFSPENTRKE   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005KFSVVYAKC   
A021CHPXHemopexin precursorGI:386789KGDKVWVYPPEKKE   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805KGDSGGPLVCGGVLEGVVTSGSRV   
A021CHPXHemopexin precursorGI:386789KGEFVWKS   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KGEWVALNPLRKC   
A021CHPXHemopexin precursorGI:386789KGGYTLVSGYPKR   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KGKWERPFEVKD   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KGNDDHWIVDTDYDTYAVQYSCRL   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KGPSVFPLAPSSKS   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KGQPREPQVYTLPPSRE   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KGQPREPQVYTLPPSREEMTKN  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRA   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KGTDYHKQPWQAKI   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KGTEAAGAMFLEAIPMSIPPEVKF  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KGTEAAGAMFLEAIPMSIPPEVKF  modifications: 2 Oxidation (M)
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KGVCEETSGAYEKT   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KGVCEETSGAYEKTDTDGKF   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KGVCEETSGAYEKTDTDGKFLYHKS   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KGYGFGLIKL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KGYTQQLAFRQ   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KHGGLYHENMRR  modifications: Oxidation (M)
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KHKVYACEVTHQGLSSPVTKS   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990KHQFLLTGDTQGRY   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KHQTVPQNTGGKN1166.5715 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KHQTVPQNTGGKNPDPWAKN1974.9228 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KHSTIFENLANKA1273.6359 (expected)   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KHVEDVPAFQALGSLNDLQFFRY2403.2396 (expected)   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KIAQLPLTGSMSIIFFLPLKV   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KIAQLPLTGSMSIIFFLPLKV  modifications: Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:553181KIDRFMQAVTGWKT   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KIECVSAETTEDCIAKI1725.7451 (expected)   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KIEGDEEMHCSDDGFWSKE   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KIGLFGGAGVGKT   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KIIYKENERF   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KILQDYKS   
A9139UMODUromodulin precursorGI:59850812KINFACSYPLDMKV   
A9139UMODUromodulin precursorGI:59850812KINFACSYPLDMKV  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KIPVGPETLGRI   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KISVIRPSKG   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KITPNLAEFAFSLYRQ   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KIVSSAMEPDREYHFGQAVRF   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KIVSSAMEPDREYHFGQAVRF   modifications: Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871KKASYLDCIRA1125.5546 (expected)   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KKATEDEGSEQKIPEATNRR   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KKATVVYQGERV   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KKCSYTEDAQCIDGTIEVPKC   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KKDNEQHVFKV   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KKDPEGLFLQDNIVAEFSVDETGQMSATAKG   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KKDPEGLFLQDNIVAEFSVDETGQMSATAKG  modifications: Oxidation (M)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KKEAGIPEFYDYDVALIKL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KKGYTQQLAFRQ   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KKLETAVNLAWTAGNSNTRF   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KKLSSWVLLMKY  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KKLYHSEAFTVNFGDTEEAKKQ   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805KKPGIYTRV   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KKQGGLGPMNIPLVSDPKR  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KKQINDYVEKG   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KKQTALVELVKH   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KKSASDLTWDNLKG1377.6807 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KKVPQVSTPTLVEVSRN   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KKYLYEIARR   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KLAAAVSNFGYDLYRV   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KLCMGSGLNLCEPNNKE1722.7419 (expected)  modifications: Oxidation (M)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLCTVATLRE   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLDELRDEGKA   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KLETAVNLAWTAGNSNTRF   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KLGLGLEFQA   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLKECCEKPLLEKS   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KLKLSYEGEVTKS   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KLLDNWDSVTSTFSKL   
A021CHPXHemopexin precursorGI:386789KLLQDEFPGIPSPLDAAVECHRG   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KLPGIVAEGRDDLYVSDAFHKA   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KLQDEDLGFL   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLQHLENELTHDIITKF   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KLQPLDFKE   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KLQPLDFKENAEQSRA   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KLQSLFDSPDFSKI   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KLREQLGPVTQEFWDNLEKE   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLSITGTYDLKS   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KLSPLGEEMRDRA  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLSSWVLLMKY  modifications: Oxidation (M)
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KLSYEGEVTKS   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KLTFDSSFSPNTGKK   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KLTFDSSFSPNTGKKN   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KLTLSALLDGKN   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLVAASQAALGL   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLVDKFLEDVKK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLVDKFLEDVKKL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLVNEVTEFAKT   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KLVPLKETIKG   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KLVTDLTKV   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLYHSEAFTVNFGDTEEAKK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KLYHSEAFTVNFGDTEEAKKQ   
A021CHPXHemopexin precursorGI:386789KLYLVQGTQVYVFLTKG   
A0419GSNGelsolin precursor, plasmaGI:38044288KMDYPKQTQVSVLPEGGETPLFKQ   
A0419GSNGelsolin precursor, plasmaGI:38044288KMDYPKQTQVSVLPEGGETPLFKQ  modifications: Oxidation (M)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KMKYWGVASFLQKG   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KMKYWGVASFLQKG  modifications: Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871KMYLGYEYVTAIRN1478.7127 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KMYLGYEYVTAIRN1494.6973 (expected)  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KNDNDNIFLSPLSISTAFAMTKL  modifications: Oxidation (M)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KNGMLHGDKVSFFCKN   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KNGMLHGDKVSFFCKN  modifications: Oxidation (M)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KNILDRQDPPSVVVTSHQAPGEKK2387.2406 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KNLNEKDYELLCLDGTRK1952.8902 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KNPDPWAKN827.4326 (expected)   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KNQVSLTCLVKG   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KNRWEDPGKQ   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KNVNAGGHKL   
A0419GSNGelsolin precursor, plasmaGI:38044288KNWRDPDQTDGLGLSYLSSHIANVERV   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KQDSQLQKA829.3736 (expected)  modifications: Pyro-glu (N-term Q)
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378KQEEGES   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KQEPERNECFLQHKD   
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057KQFTSSTSYNRG  modifications: Pyro-glu (N-term Q)
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057KQFTSSTSYNRG   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KQGGLGPMNIPLVSDPKR  modifications: Oxidation (M); Pyro-glu (N-term Q)
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887KQGGLGPMNIPLVSDPKR  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KQINDYVEKG  modifications: Pyro-glu (N-term Q)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KQINDYVEKG   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KQINDYVEKGTQGKI  modifications: Pyro-glu (N-term Q)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KQINDYVEKGTQGKI   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KQKPDGVFQEDAPVIHQEMIGGLRN  modifications: Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750KQKPDGVFQEDAPVIHQEMIGGLRN  modifications: Oxidation (M) Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750KQKPDGVFQEDAPVIHQEMIGGLRN  modifications: Oxidation (M)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KQKWEAEPVYVQRA1515.7358 (expected)  modifications: Pyro-glu (N-term Q)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KQKWEAEPVYVQRA1532.7725 (expected)   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KQLNEINYEDHKL  modifications: Pyro-glu (N-termQ)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KQLNEINYEDHKL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KQLYNVEATSYALLALLQLKD   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KQNCELFEQLGEYKF   
A1702AGT, SERPINA8AngiotensinogenGI:15079348KQPFVQGLALYTPVVLPRS  modifications: Pyro-glu (N-termQ)
A1702AGT, SERPINA8AngiotensinogenGI:15079348KQPFVQGLALYTPVVLPRS   
A1702AGT, SERPINA8AngiotensinogenGI:553181KQPFVQGLALYTPVVLPRS  modifications: Pyro-glu (N-termQ)
A1702AGT, SERPINA8AngiotensinogenGI:553181KQPFVQGLALYTPVVLPRS   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KQPWQAKI  modifications: Pyro-glu (N-termQ)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KQTALVELVKH  modifications: Pyro-glu (N-term Q)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KQTALVELVKH   
A0419GSNGelsolin precursor, plasmaGI:38044288KQTQVSVLPEGGETPLFKQ  modifications: Pyro-glu (N-term Q)
A0419GSNGelsolin precursor, plasmaGI:38044288KQTQVSVLPEGGETPLFKQ   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KQVPAHARD  modifications: Pyro-glu (N-termQ)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005KQYGFCKA  modifications: Pyro-glu (N-term Q)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005KQYGFCKA   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KRAPSTWLTAYVVKV   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KRLGMFNIQHCKK  modifications: Oxidation (M)
A1599CFH, HF, HF1Complement factor H precursorGI:758073KRPCGHPGDTPFGTFTLTGGNVFEYGVKA   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KRQGALELIKK   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KRTVAAPSVFIFPPSDEQLKS   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KSASDLTWDNLKG1249.59 (expected)   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD    
A643CTF, PRO1400Serotransferrin precursorGI:4557871KSDNCEDTPEAGYFAVAVVKK2071.8796 (expected)   
A0419GSNGelsolin precursor, plasmaGI:38044288KSEDCFILDHGKD   
A0419GSNGelsolin precursor, plasmaGI:38044288KSEDCFILDHGKDGKI   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KSFNRGEC   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KSGTASVVCLLNNFYPRE   
A1599CFH, HF, HF1Complement factor H precursorGI:758073KSIDVACHPGYALPKA   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KSKEFQLFSSPHGKD1491.7238 (expected)   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KSKFSPENTRK   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KSKFSPENTRKE   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KSKLPGIVAEGRD   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KSKLPGIVAEGRDDLYVSDAFHKA   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KSLHTLFGDKL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KSLHTLFGDKLCTVATLRE   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KSLQDIIAILGMDELSEEDKLTVSRA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KSLQDIIAILGMDELSEEDKLTVSRA  modifications: Oxidation (M)
A1599CFH, HF, HF1Complement factor H precursorGI:758073KSPDVINGSPISQKI   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KSPLFMGKV  modifications: Oxidation (M)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KSQPMGLWRQ990.4675 (expected)  modifications: Oxidation (M)
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KSSFVAPLEKS   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KSTSGGTAALGCLVKD   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KSVIPSDGPSVACVKK1415.6947 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KSVIPSDGPSVACVKKA1543.771 (expected)   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KSVLGQLGITKV   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KSYGTRPRV   
A9139UMODUromodulin precursorGI:59850812KTALQPMVSALNIRV   
A9139UMODUromodulin precursorGI:59850812KTALQPMVSALNIRV  modifications: Oxidation (M)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KTDASDVKPC   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KTDEFQLHTNVNDGTEFGGSIYQKV   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KTDTDGKFLYHKS   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KTDTSHHDQDHPTFNKI   
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057KTFPGFFSPMLGEFVSETESRG  modifications: Oxidation (M)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KTFYEPGEEITYSCKPGYVSRG   
A0419GSNGelsolin precursor, plasmaGI:38044288KTGAQELLRV   
A1702AGT, SERPINA8AngiotensinogenGI:553181KTGCSLMGASVDSTLAFNTYVHFQGKM  modifications: Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:15079348KTGCSLTGASVDSTLAFNTYVHFQGKM   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KTHTCPPCPAPELLGGPSVFLFPPKPKD   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513KTSDQIHFFFAKL   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KTSLEDFYLDEERT   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753KTTPPVLDSDGSFFLYSKL   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KTVLIMELINNVAKA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KTVLIMELINNVAKA  modifications: Oxidation (M)
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024KTVQAVLTVPKL   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KVALVYGQMNEPPGARA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KVALVYGQMNEPPGARA  modifications: Oxidation (M)
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KVDNALQSGNSQESVTEQDSKDSTYSLSSTL   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KVEPLRAELQEGARQ   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KVEPLRAELQEGARQKL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KVFDEFKPLVEEPQNLIKQ   
A9139UMODUromodulin precursorGI:59850812KVFMYLSDSRC   
A9139UMODUromodulin precursorGI:59850812KVFMYLSDSRC  modifications: Oxidation (M)
A1598C3, CPAMD1Complement C3 precursorGI:3745750KVFSLAVNLIAIDSQVLCGAVKW   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KVFSNGADLSGVTEEAPLKL   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KVKDISEVVTPRF   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KVLDSGAPIKI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KVLDSGAPIKIPVGPETLGRI   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KVNNSSLIGLGYTQTLKPGIKL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KVPQVSTPTLVEVSRN   
A0419GSNGelsolin precursor, plasmaGI:38044288KVPVDPATYGQFYGGDSYIILYNYRH   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KVQPYLDDFQKK   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KVQPYLDDFQKKW   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805KVQVLLGAHSLSQPEPSKR   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805KVQVLLGAHSLSQPEPSKRL   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KVSFFCKN   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990KVTLTCVAPLSGVDFQLRR   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029KVVDLLAPYAKG   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629KVVNPTQK   
A021CHPXHemopexin precursorGI:386789KVWVYPPEKKE   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302KVYACEVTHQGLSSPVTKS   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KWCALSHHERL1195.5406 (expected)   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KWEAEPVYVQRA1276.6389 (expected)   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378KWFYIASAFRN   
A1598C3, CPAMD1Complement C3 precursorGI:3745750KWLILEKQ   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691KWNTDNTLGTEITVEDQLARG   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KWQEEMELYRQ   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664KWQEEMELYRQ  modifications: Oxidation (M)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461KWSPELPVCAPIICPPPSIPTFATLRV   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KWYNLAIGSTCPWLKK   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KWYNLAIGSTCPWLKKIMDRM   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067KWYNLAIGSTCPWLKKIMDRM  modifications: Oxidation (M)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358KYGQTIRPICLPCTEGTTRA   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KYICENQDSISSKL   
A643CTF, PRO1400Serotransferrin precursorGI:4557871KYLGEEYVKA1000.4918 (expected)   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KYLYEIARR   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456KYLYEIARRH   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284KYWGVASFLQKG   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KYYYDGKD808.3574 (expected)   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583KYYYDGKDYIEFNKE1717.764 (expected)   
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691MAVPPTYADLGKS   modifications: N-Acetyl (Protein)
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691MAVPPTYADLGKSARDVFTKG  modifications: N-Acetyl (Protein); Oxidation (M)
A0419GSNGelsolin precursor, plasmaGI:38044288MVVEHPEFLKAGKE  modifications: N-Acetyl (Protein); Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:15079348RAAMVGMLANFLGFRI  modifications: Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:15079348RAAMVGMLANFLGFRI  modifications: 2 Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:553181RAAMVGMLANFLGFRI  modifications: Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:553181RAAMVGMLANFLGFRI  modifications: 2 Oxidation (M)
A1702AGT, SERPINA8AngiotensinogenGI:15079348RADSQAQLLLSTVVGVFTAPGLHLKQ   
A1702AGT, SERPINA8AngiotensinogenGI:553181RADSQAQLLLSTVVGVFTAPGLHLKQ   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RAGEVQEPELRG1127.5471 (expected)   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RAHVDALRT   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RAHYDLRH   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RAIAELGIYPAVDPLDSTSRI   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RALYYDLISSPDIHGTYKE   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RALYYDLISSPDIHGTYKELLDTVTAPQKN   
A0419GSNGelsolin precursor, plasmaGI:38044288RAMAELAA  modifications: Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871RAPNHAVVTRK964.5276 (expected)   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RAPSTWLTAYVVKV   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RAQLVPLPPSTYVEFTVSGTDCVAKE   
A0419GSNGelsolin precursor, plasmaGI:38044288RAQPVQVAEGSEPDGFWEALGGKA   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302RASQSVSSYLAWYQQKPGQAPRL   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RATWSGAVLAGRD   
A0419GSNGelsolin precursor, plasmaGI:38044288RAVEVLPKA   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RAVPHPDSQPDTIDHDLLLLQLSEKA    
A643CTF, PRO1400Serotransferrin precursorGI:4557871RCLVEKGDVAFVKH1364.7087 (expected)   
A9139UMODUromodulin precursorGI:59850812RCSGFNDRDNRD   
A021CHPXHemopexin precursorGI:386789RCSPHLVLSALTSDNHGATYAFSGTHYWRL   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RCTLKPCDYPDIKH   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RDAQYAPGYDKV   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RDAQYAPGYDKVKD   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RDDLYVSDAFHKA   
A9139UMODUromodulin precursorGI:59850812RDGPCGTVLTRN   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RDIPMNPMCIYRS  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RDIPMNPMCIYRS  modifications: 2 Oxidation (M)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RDLLYIGKD   
A9139UMODUromodulin precursorGI:59850812RDNRDWVSVVTPARD   
A0419GSNGelsolin precursor, plasmaGI:38044288RDPDQTDGLGLSYLSSHIANVERV   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RDPNGLPPEAQKI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RDQEGQDVLLFIDNIFRF   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RDQYELLCLDNTRK1539.7039 (expected)   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RDSCKGDSGGPLVCGGVLEGVVTSGSR   
A9139UMODUromodulin precursorGI:59850812RDSTIQVVENGESSQGRF   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RDTDTGALLFIGKI   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RDVAPGTLCDVAGWGIVNHAGRR   
A9139UMODUromodulin precursorGI:59850812RDWVSVVTPARD   
A021CHPXHemopexin precursorGI:386789RDYFMPCPGRG  modifications: Oxidation (M)
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RDYVSQFEGSALGKQ   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RECDTDGWTNDIPICEVVKC   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583REDIFMETLKD1141.5876 (expected)  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029REGNDLYHEMIESGVINLKD   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029REGNDLYHEMIESGVINLKD  modifications: Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871REGTCPEAPTDECKPVKW1817.7719 (expected)   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378REHVAHLLFLRD   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753REPQVYTLPPSRE   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753REPQVYTLPPSREEMTKN   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753REPQVYTLPPSREEMTKN  modifications: Oxidation (M)
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664REQLGPVTQEFWDNLEKE   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RETLLQDFRV   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RETYGEMADCCAKQ   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RETYGEMADCCAKQ  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513REVPLNTIIFMGRV   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513REVPLNTIIFMGRV  modifications: Oxidation (M)
A1599CFH, HF, HF1Complement factor H precursorGI:758073REYHFGQAVRF   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378REYQTRQ   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RFATTFYQHLADSKN   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RFDEFFSEGCAPGSKK1577.6914 (expected)   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RFDEFFSEGCAPGSKKD1705.7539 (expected)   
A021CHPXHemopexin precursorGI:386789RFDPVRGEVPPRYPRD   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RFKDLGEENFKA   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RFLCTGGVSPYADPNTCRG   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RFLSQPFQVAEVFTGHMGKL   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RFLSQPFQVAEVFTGHMGKL  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RFRIEDGFSLKE   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RFSGTWYAMAKK   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RFSGTWYAMAKK  modifications: Oxidation (M)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RFSGTWYAMAKKD   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RFSGTWYAMAKKD  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RFTQAGSEVSALLGRI   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RFVCNSGYKI   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RGDAVCTESGWRPLPSCEEKS   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RGDSGGPLIVHKR   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RGECVPGEQEPEPILIPRV   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887RGLFIIDDKG   
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057RGSESGIFTNTKE   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RGVTFLLRR   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RHHGPTITAKL   
A1467FGAFibrinogen alpha/alpha-E chain precursorGI:223057RHPDEAAFFDTASTGKT   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RHPDYSVVLLLRL   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RHPYFYAPELLFFAKR   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RHPYFYAPELLFFAKRY   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RHTFMGVVSLGSPSGEVSHPRK   
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RHTFMGVVSLGSPSGEVSHPRK  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RIEDGFSLKE   
A0419GSNGelsolin precursor, plasmaGI:38044288RIEGSNKVPVDPATYGQFYGGDSYIILYNYRH    
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RIFFHLNAVALGDGGHYTCRY   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RIKSSFVAPLEKS   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMDPNIVGSEHYDVARG   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMDPNIVGSEHYDVARG  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMNVIGEPIDERG   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMNVIGEPIDERG  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMNVIGEPIDERGPIKT   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIMNVIGEPIDERGPIKT  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIPSAVGYQPTLATDMGTMQERI  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RIPSAVGYQPTLATDMGTMQERI  modifications: 2 Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871RKCSTSSLLEACTFRR1659.7647 (expected)   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RKELFYKA   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461RKFICPLTGLWPINTLKC   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RKGEWVALNPLRKC   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RKGVCEETSGAYEKT   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RKGVCEETSGAYEKTDTDGKF   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RKKPGIYTRV   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RKPVEEYANCHLARA1586.7324 (expected)   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RKSQPMGLWRQ1118.5706 (expected)  modifications: Oxidation (M)
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RKTSLEDFYLDEERT   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RKVGSQYRL   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RLDLQEINNWVQAQMKG   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RLDLQEINNWVQAQMKG  modifications: Oxidation (M)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RLEDSVTYHCSRG   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RLELHVDGPPPRPQLRA   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RLETPDFQLFKN   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629RLGMFNIQHCKK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629RLGMFNIQHCKK  modifications: Oxidation (M)
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629RLGMFNIQHCKKL  modifications: Oxidation (M)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLIVHNGYCDGRS   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RLKCDEWSVNSVGKI1521.7198 (expected)   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RLKGPLLNKF   
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302RLLIYDASNRA   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLLNLDGTCADSYSFVFSRD   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLLNNWDVCADMVGTFTDTEDPAKF   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLLNNWDVCADMVGTFTDTEDPAKF  modifications: Oxidation (M)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLLNNWDVCADMVGTFTDTEDPAKFKM   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RLLNNWDVCADMVGTFTDTEDPAKFKM  modifications: Oxidation (M)
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RLLQEGQALEYVCPSGFYPYPVQTRT   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RLPPTTTCQQQKE   
A1602CFB, BF, BFDComplement factor B precursorGI:67782358RLPPTTTCQQQKEELLPAQDIKA   
A1702AGT, SERPINA8AngiotensinogenGI:15079348RLQAILGVPWKD   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RLSQRFPKA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RLVLEVAQHLGESTVRT   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887RLVQAFQFTDKH   
A021CHPXHemopexin precursorGI:386789RLWWLDLKS   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RLYDVLRA   
A9139UMODUromodulin precursorGI:59850812RMAETCVPVLRC   
A9139UMODUromodulin precursorGI:59850812RMAETCVPVLRC  modifications: Oxidation (M)
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RMTVSTLVLGEGATEAEISMTSTRW   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RMTVSTLVLGEGATEAEISMTSTRW  modifications: Oxidation (M)
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RMTVSTLVLGEGATEAEISMTSTRW  modifications: 2 Oxidation (M)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RNECFLQHKDDNPNLPRL   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RNGFYPATRG   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RNNNEKDMALTAFVLISLQEAKD  modifications: Oxidation (M)
A1599CFH, HF, HF1Complement factor H precursorGI:758073RNTEILTGSWSDQTYPEGTQAIYKC   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RQDPPSVVVTSHQAPGEKK1758.8529 (expected)  modifications: Pyro-glu (N-term Q)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RQDPPSVVVTSHQAPGEKK1775.873 (expected)   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RQEELCLARQ  modifications: Pyro-glu (N-term Q)
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RQEELCLARQ   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQGALELIKK  modifications: Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQGALELIKK   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQGALELIKKG  modifications: Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQGALELIKKG   
A021CHPXHemopexin precursorGI:386789RQGHNSVFLIKG  modifications: Pyro-glu (N-term Q)
A021CHPXHemopexin precursorGI:386789RQGHNSVFLIKG   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RQGLLPVLESFKV  modifications: Pyro-glu (N-term Q)
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RQGLLPVLESFKV   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RQKVEPLRAELQEGARQ  modifications: Pyro-glu (N-term Q)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RQLKEHAVEGDCDFQLLKL  modifications: Pyro-glu (N-term Q)
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorGI:4502005RQLKEHAVEGDCDFQLLKL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQPSSAFAAFVKR  modifications: Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQPSSAFAAFVKR   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQPSSAFAAFVKRA  modifications: Pyro-glu (N-termQ)
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQPSSAFAAFVKRA   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RQPSSAFAAFVKRAPSTWLTAYVVKV   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RQRQEELCLARQ  modifications: Pyro-glu (N-term Q)
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RQVEGMEDWKQDSQLQKA1947.8715 (expected)  modifications: Oxidation (M); Pyro-glu (N-term Q)
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RRHPDYSVVLLLRL   
A021CHPXHemopexin precursorGI:386789RRLWWLDLKS   
A1581ALB, GIG20, GIG42Serum albumin precursorGI:3212456RRPCFSALEVDETYVPKE   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RRPDSLQHVLLPVLDRA   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RRPYFPVAVGKY   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RRTHHDGAITERL   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RRVWELSKA   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942629RSASLHLPKL   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378RSDVMYTDWKKD  modifications: Oxidation (M)
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RSGLSTGWTQLSKL   
A1702AGT, SERPINA8AngiotensinogenGI:15079348RSLDFTELDVAAEKI   
A1702AGT, SERPINA8AngiotensinogenGI:553181RSLDFTELDVAAEKI   
A1702AGT, SERPINA8AngiotensinogenGI:553181RSLDFTELDVAAEKIDRF   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RSLGNVIMVCRK   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RSLGNVIMVCRK  modifications: Oxidation (M)
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RSLNPNRVTFKA   
A9139UMODUromodulin precursorGI:59850812RSTEYGEGYACDTDLRG   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RSYTVAIAGYALAQMGRL   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RSYTVAIAGYALAQMGRL  modifications: Oxidation (M)
A643CTF, PRO1400Serotransferrin precursorGI:4557871RTAGWNIPMGLLYNKI1593.7791 (expected)  modifications: Oxidation (M)
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461RTCPKPDDLPFSTVVPLKT   
A1599CFH, HF, HF1Complement factor H precursorGI:758073RTGDEITYQCRN   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RTHHDGAITERL   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RTHLAPYSDELRQ   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RTIAMDGTEGLVRG   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RTIAMDGTEGLVRG  modifications: Oxidation (M)
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1GI:55959887RTIAQDYGVLKA   
A9139UMODUromodulin precursorGI:59850812RTLDEYWRS   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753RTPEVTCVVVDVSHEDPEVKF   
A735CA1BGAlpha-1B-glycoprotein precursorGI:69990RTPGAAANLELIFVGPQHAGNYRC    
A0419GSNGelsolin precursor, plasmaGI:38044288RTPITVVKQ   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RTREGNDLYHEMIESGVINLKD   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RTREGNDLYHEMIESGVINLKD  modifications: Oxidation (M)
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:11275302RTVAAPSVFIFPPSDEQLKS   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RVAEGTQVLELPFKGDDITMVLILPKPEKS  modifications: Oxidation (M)
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:89574029RVALTGLTVAEYFRD   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RVANPCVK   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RVASYAAWIDSVLA   
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorGI:6573461RVCPFAGILENGAVRY   
A1620CFD, DF, PFDComplement factor D precursorGI:1827805RVDRDVAPGTLCDVAGWGIVNHAGRR   
A0419GSNGelsolin precursor, plasmaGI:38044288RVEKFDLVPVPTNLYGDFFTGDAYVILKT   
A9139UMODUromodulin precursorGI:59850812RVGGTGMFTVRM   
A9139UMODUromodulin precursorGI:59850812RVGGTGMFTVRM  modifications: Oxidation (M)
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RVKDLATVYVDVLKD   
A1552APOA1, A175PApolipoprotein A-I precursorGI:90108664RVKDLATVYVDVLKDSGRD   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RVKENFDKA   
A353CRBP4, PRO2222, PRBPRetinol binding protein 4, plasmaGI:230284RVKENFDKARF   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RVLTGNPRL   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RVLTGNPRLDLQEINNWVQAQMKG  modifications: Oxidation (M)
A0419GSNGelsolin precursor, plasmaGI:38044288RVPFDAATLHTSTAMAAQHGMDDDGTGQKQ  modifications: 2 Oxidation (M)
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691RVTQSNFAVGYKT   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RVVAQGVGIPEDSIFTMADRG   
A8383AMBP, ITIL, HCPAMBP protein precursorGI:4502067RVVAQGVGIPEDSIFTMADRG  modifications: Oxidation (M)
A0419GSNGelsolin precursor, plasmaGI:38044288RVVQGKEPAHLMSLFGGKPMIIYKG  modifications: 2 Oxidation (M)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753RVVSVLTVLHQDWLNGKE   
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorGI:999513RVWELSKA   
A643CTF, PRO1400Serotransferrin precursorGI:4557871RWCAVSEHEATKC1317.5933 (expected)   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RWLNEQRY   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753RWQQGNVFSCSVMHEALHNHYTQKS   
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753RWQQGNVFSCSVMHEALHNHYTQKS  modifications: Oxidation (M)
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:6063691RWTEYGLTFTEKW   
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:29170378RYEGGREHVAHLLFLRD   
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorGI:15988024RYGLDSDLSCKI   
A0419GSNGelsolin precursor, plasmaGI:38044288RYIETDPANRD   
A0419GSNGelsolin precursor, plasmaGI:38044288RYIETDPANRDRR   
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorGI:4699583RYSLTYIYTGLSKH1408.7142 (expected)   
A021CHPXHemopexin precursorGI:386789RYYCFQGNQFLRF   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RYYGGGYGSTQATFMVFQALAQYQKD   
A1598C3, CPAMD1Complement C3 precursorGI:3745750RYYGGGYGSTQATFMVFQALAQYQKD  modifications: Oxidation (M)
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:9857753STKGPSVFPLAPSSKS   

Compile date 12-23-2014© PADB initiative