PADB-logoLSSR - PepMap molecular information by study

Study ID 17381150
Species human
Disease healthy
Tissue / Source nasal
Compartment olfactory cleft mucus (nasal mucus)

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550AASCVLLHTGQKM  modifications: AcetN
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299AEEQPQVELFVKA  modifications: AcetN
A1949GSTA1, GST2Glutathione S-transferase A1P08263AEKPKLHYFNARG  modifications: AcetN
A0647ANXA1, ANX1, LPC1Annexin A1P04083AMVSEFLKQ  modifications: 1Met-ox;AcetN
A8385ANXA3, ANX3Annexin A3P12429ASIWVGHRG  modifications: AcetN
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371ASLSLAPVNIFKA  modifications: AcetN
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643ASMGTLAFDEYGRPFLIIKD  modifications: 1Met-ox;AcetN
A5959CA1Carbonic anhydrase 1P00915ASPDWGYDDKN  modifications: AcetN
A1581ALB, GIG20, GIG42Serum albumin precursorP02768DAHKSEVAHRF    
A1552APOA1, A175PApolipoprotein A-I precursorP02647DEPPQSPWDRV    
A9190OBP2AOdorant-binding protein 2a precursorQ9NY56;Q9NPH6EEDITGTWYVKA    
A4552ACTG1, ACTGActin, cytoplasmic 2P63261EEEIAALVIDNGSGMCKA  modifications: 1Met-ox;AcetN
A1742HBB, beta-globinHemoglobin beta chainP68871FFESFGDLSTPD    
A095CBPIFB4, LPLUNC4Long palate, lung and nasal epithelium carcinoma associated protein 4P59827GTSHETNTVLRV    
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KAAAIGIDLGTTYSCVGVFQHGKV   
A0492STIP1Stress-induced-phosphoprotein 1P31948KAAALEFLNRF   
A3205TPM3Tropomyosin alpha 3 chainP06753KAADAEAEVASLNRR   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KAAFTECCQAADKA   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KAAGIDEQENWHEGKE   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KAALEDTLAETEARF   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KAATYHVDRS   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KAAYLQETGKPLDETLKK   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KADAVQDSEMVELVELEIRE  modifications: 1Met-ox
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KADEGISFRG   
A643CTF, PRO1400Serotransferrin precursorP02787KADRDQYELLCLDNTRK   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KADTLTDEINFLRA   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KAFLASPEYVNLPINGNGKQ   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KAFVNCDENSRL   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KAFYPEEISSMVLTKM  modifications: 1Met-ox
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KAGFAGDDAPRA   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KAGFAGDDAPRA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KAHGGYSVFAGVGERT   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KAKPALEDLRQ   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KAKPYEGSILEADCDILIPAASEKQ   
A8385ANXA3, ANX3Annexin A3P12429KALLTLADGRR   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KALLYLCGGDD  modifications: 1Cys-am
A1550S100A8, CAGA, CFAGCalgranulin AP05109KALNSIIDVYHKY   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KALPGQLKPFETLLSQNQGGKT   
A0492STIP1Stress-induced-phosphoprotein 1P31948KALSVGNIDDALQCYSEAIKL   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KALTGHLEEVVLALLKT   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KALVLIAFAQYLQQCPFEDHVKL   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727KALVQQMEQLRQ  modifications: 1Met-ox
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KANKPGDVVRA   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KAPGFGDNRK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KAQIHDLVLVGGSTRI   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KAQYEDIANRS   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KAQYEEIAQRS   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KASANMDLMRA   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KASANMDLMRADMGGAATICSAIVSAAKL   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KASCLYGQLPKF   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KASMKGLGTDEDSLIEIICSRT  modifications: 1Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KASMKGLGTDEDSLIEIICSRT  modifications: 1Met-ox;1Cys-am
A643CTF, PRO1400Serotransferrin precursorP02787KASYLDCIRA   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KATAGDTHLGGEDFDNRL   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KATAVMPDGQFKD  modifications: 1Met-ox
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KAVADTRDQADG    
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KAVEEVKACNCLLLLKV   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KAVEHIINKT   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930KAVELLGDIVQNCSLEDSQIEKE   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KAVMDDFAAFVEKC  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KAWAVARL   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363KAYHEQLSVAEITNACFEPANQMVKC  modifications: 1Met-ox
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363KAYHEQLSVAEITNACFEPANQMVKC  modifications: 1Met-ox;1Cys-am
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366KAYHEQLSVAEITNACFEPANQMVKC  modifications: 1Met-ox
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366KAYHEQLSVAEITNACFEPANQMVKC  modifications: 1Met-ox;1Cys-am
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3KAYHEQLTVAEITNACFEPANQMVKC  modifications: 1Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KAYTNFDAERD   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KAYTNFDAERDALNIETAIKT   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KCAFSSQEPYFSYSGAFKC   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KCAVVDVPFGGAKA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KCCAAADPHECYAKV   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KCCTESLVNRR   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KCDVDIRK   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KCDVDIRK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KCPTLEQYAMRA  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KCSTSPLLEACEFLRK   
A643CTF, PRO1400Serotransferrin precursorP02787KCSTSSLLEACTFRR   
A8272IGJ, IGCJImmunoglobulin J chainP01591KCYTAVVPLVYGGETKM   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KDAAEAIKK   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KDAEAWFTSRT   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KDAGQISGLNVLRV   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KDAGTIAGLNVLRI   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KDAGTIAGLNVMRI  modifications: 1Met-ox
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KDAGVIAGLNVLRI   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KDASIVGFFDDSFSEAHSEFLKA   
A0492STIP1Stress-induced-phosphoprotein 1P31948KDCEECIQLEPTFIKG   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KDCGATWVVLGHSERR   
A643CTF, PRO1400Serotransferrin precursorP02787KDCHLAQVPSHTVVARS   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KDDNPNLPRL   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KDEVPYLRK   
A0432PRDX6, AOP2Peroxiredoxin 6P30041KDGDSVMVLPTIPEEEAKK  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KDGLIPLEIRF   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KDGSFSVVITGLRK   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441KDGVADVSIEDSVISLSGDHCIIGRT   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441KDGVADVSIEDSVISLSGDHCIIGRT  modifications: 1Cys-am
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KDIFQEIYDKQ   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KDIISDTSGDFRK   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KDIISDTSGDFRKL   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KDIKNVPFKI   
A0432PRDX6, AOP2Peroxiredoxin 6P30041KDINAYNCEEPTEKL   
A0432PRDX6, AOP2Peroxiredoxin 6P30041KDINAYNCEEPTEKL  modifications: 1Cys-am
A1609CALR, CRTCCalreticulin precursorP27797KDIRCKD  modifications: 1Cys-am
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KDISLSDYKG   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KDISLSDYKGKY   
A8385ANXA3, ANX3Annexin A3P12429KDISQAYYTVYKK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KDISQNKRA   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KDITSDTSGDFRN   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KDIVHSGLAYTMERS  modifications: 1Met-ox
A643CTF, PRO1400Serotransferrin precursorP02787KDKEACVHKI  modifications: 1Cys-am
A1552APOA1, A175PApolipoprotein A-I precursorP02647KDLATVYVDVLKD   
A3693CKB, CKBBCreatine kinase B-typeP12277KDLFDPIIEDRH   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KDLLIAYYDVDYEKN   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KDLQNFLKK   
A3793PHBProhibitinP35232KDLQNVNITLRI   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KDLSMIVLLPNEIDGLQKL   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KDLSMIVLLPNEIDGLQKL  modifications: 1Met-ox
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KDLYANTVLSGGTTMYPGIADRM  modifications: 1Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KDLYANTVLSGGTTMYPGIADRM  modifications: 1Met-ox
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KDLYPVINGGVPETTELLKE   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KDMAIATGGAVFGEEGLTLNLEDVQPHDLGKV  modifications: 1Met-ox
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KDNHLLGTFDLTGIPPAPRG   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KDNNLLGRF   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KDNTAQQIKKV   
A1609CALR, CRTCCalreticulin precursorP27797KDPDASKPEDWDERA   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KDQQEAALVDMVNDGVEDLRC   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KDQQEAALVDMVNDGVEDLRC  modifications: 1Met-ox
A643CTF, PRO1400Serotransferrin precursorP02787KDSAHGFLKV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KDSAIGFSRV   
A643CTF, PRO1400Serotransferrin precursorP02787KDSGFQMNQLRG   
A643CTF, PRO1400Serotransferrin precursorP02787KDSGFQMNQLRG  modifications: 1Met-ox
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KDTEEEDFHVDQVTTVKV   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KDVFLGMFLYEYARR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KDVLIEFYAPWCGHCKN  modifications: 2Cys-am
A643CTF, PRO1400Serotransferrin precursorP02787KDYELLCLDGTRK   
A643CTF, PRO1400Serotransferrin precursorP02787KDYELLCLDGTRK  modifications: 1Cys-am
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KDYPVVSIEDPFDQDDWGAWQKF   
A0492STIP1Stress-induced-phosphoprotein 1P31948KEAADGYQRC   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKV  modifications: 1Met-ox
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363KEDAANNYARG   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3KEDAANNYARG   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366KEDAANNYARG   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65KEDAANNYARG   
A9149GCVitamin D-binding protein precursorP02774KEDFTSLSLVLYSRK   
A643CTF, PRO1400Serotransferrin precursorP02787KEDPQTFYYAVAVVKK   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KEDVGPGKA   
A8405CST1Cystatin-SNP01037KEEDRIIPGGIY    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KEEFEHQQKE   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KEEIFGPVQQIMKF  modifications: 1Met-ox
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KEEVVTVETWQEGSLKA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KEFNAETFTFHADICTLSEKE   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KEFNAETFTFHADICTLSEKE  modifications: 1Cys-am
A643CTF, PRO1400Serotransferrin precursorP02787KEFQLFSSPHGKD   
A1742HBB, beta-globinHemoglobin beta chainP68871KEFTPPVQAAYQKV   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119KEGGLGPLNIPLLADVTRR   
A643CTF, PRO1400Serotransferrin precursorP02787KEGYYGYTGAFRC   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KEIAEAYLGKT   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KEIAEAYLGYPVTNAVITVPAYFNDSQRQ   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363KEIIDLVLDRI   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3KEIIDLVLDRI   
A5959CA1Carbonic anhydrase 1P00915KEIINVGHSFHVNFEDNDNRS   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KEKEDDVPQFTSAGENFDKL   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KEKFEEMIQQIKE   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KEKFEEMIQQIKE  modifications: 1Met-ox
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KELASQPDVDGFLVGGASLKPEFVDIINAKQ   
A0492STIP1Stress-induced-phosphoprotein 1P31948KELGNDAYKK   
A0492STIP1Stress-induced-phosphoprotein 1P31948KELGNDAYKKK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KEMNPALGIDCLHKG  modifications: 1Met-ox
A3918VCPTransitional endoplasmic reticulum ATPaseP55072KEMVELPLRH  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KENNIFYSPISITSALGMVLLGAKD  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KEPLGPALAHELRY   
A1609CALR, CRTCCalreticulin precursorP27797KEQFLDGDGWTSRW   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KERFDHILYTGSTGVGKI   
A5959CA1Carbonic anhydrase 1P00915KESISVSSEQLAQFRS   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044KETDLLLDDSLVSIFGNRR   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KETEGLRQ   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KETMQSLNDRL  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KEVDEQMLNVQNKN  modifications: 1Met-ox
A021CHPXHemopexin precursorP02790KEVGTPHGIILDSVDAAFICPGSSRL   
A9149GCVitamin D-binding protein precursorP02774KEVVSLTEACCAEGADPDCYDTRT   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KFASFIDKV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KFDEYFSQSCAPGSDPRS   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KFEELNMDLFRS  modifications: 1Met-ox
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KFELTGIPPAPRG   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KFETEQALRM   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729KFETLQAQAGKH   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KFFVGGNWKM   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KFGANAILGVSLAVCSNAGATAEKG   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KFGDPVVQSDMKH  modifications: 1Met-ox
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KFGVEQDVDMVFASFIRK  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KFKDCHLARV   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KFLDAGHKL   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KFLDGNELTLADCNLLPKL   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KFLEDVKK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KFLENEDRR   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KFLENEDRRS   
A1949GSTA1, GST2Glutathione S-transferase A1P08263KFLQPGSPRK   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KFNLILRQ   
A9149GCVitamin D-binding protein precursorP02774KFPSGTFEQVSQLVKE   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KFQDGDLTLYQSNTILRH   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KFQLFGSPSGQKD   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KFQNALLVRY   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KFSAYIKN   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KFTASAGIQVVGDDLTVTNPKR   
A8385ANXA3, ANX3Annexin A3P12429KFTEILCLRS   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KFVMQEEFSRD   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KFVMQEEFSRD  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KFWEVISDEHGIDPTGTYHGDSDLQLERI   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KFYQTSVESVDFANAPEESRK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KGADFLVTEVENGGSLGSKK   
A1550S100A8, CAGA, CFAGCalgranulin AP05109KGADVWFKE   
A8385ANXA3, ANX3Annexin A3P12429KGAGTNEDALIEILTTRT   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KGANPVEIRR   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441KGDGPVQGIINFEQKE   
A021CHPXHemopexin precursorP02790KGDKVWVYPPEKK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KGDYPLEAVRM   
A0492STIP1Stress-induced-phosphoprotein 1P31948KGDYPQAMKH   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KGEADAMSLDGGYVYTAGKC  modifications: 1Met-ox
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KGEETPVIVGSALCALEGRD   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KGEETPVIVGSALCALEGRD  modifications: 1Cys-am
A1609CALR, CRTCCalreticulin precursorP27797KGEWKPRQ   
A4577ANXA7, ANX7, SNXAnnexin A7P20073KGFGTDEQAIVDVVANRS   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KGFIGPGIDVPAPDMSTGERE  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KGGFVLLDGETFEVKG   
A5959CA1Carbonic anhydrase 1P00915KGGPFSDSYRL   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KGGPGSAVSPYPTFNPSSDVAALHKA   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KGGPGSAVSPYPTFNPSSDVAALHKAIMVKG  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KGGPVQVLEDEELKS   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KGGSFQLNELQGLKS   
A021CHPXHemopexin precursorP02790KGGYTLVSGYPKR   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KGHYTEGAELVDSVLDVVRK   
A8385ANXA3, ANX3Annexin A3P12429KGIGTDEFTLNRI   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGITFDSGGISIKA   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KGLGTDEDSLIEIICSRT   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KGLGTDEDSLIEIICSRT  modifications: 1Cys-am
A0647ANXA1, ANX1, LPC1Annexin A1P04083KGLGTDEDTLIEILASRT   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KGLPNVQRS   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KGLQAQIASSGLTVEVDAPKS   
A1609CALR, CRTCCalreticulin precursorP27797KGLQTSQDARF   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441KGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGLVLGIYSKE   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KGLVQALGLSNFNSRQ   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGMTGRPTRT  modifications: 1Met-ox
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGMTGRPTRTLIEFLLRF  modifications: 1Met-ox
A1550S100A8, CAGA, CFAGCalgranulin AP05109KGNFHAVYRD   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KGPAVGIDLGTTYSCVGVFQHGKV   
A9149GCVitamin D-binding protein precursorP02774KGQELCADYSENTFTEYKK   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KGQETSTNPIASIFAWTRG   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KGQFPNLCRL   
A1609CALR, CRTCCalreticulin precursorP27797KGQTLVVQFTVKH   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KGQWEKK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGSDEPPVFLEIHYKG   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978KGSDFDCELRL   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978KGSDFDCELRL  modifications: 1Cys-am
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KGSNYWRN   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGSPNANEPPLVFVGKG   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KGTDVNVFNTILTTRS   
A1742HBB, beta-globinHemoglobin beta chainP68871KGTFATLSELHCDKL   
A1742HBB, beta-globinHemoglobin beta chainP68871KGTFATLSELHCDKL  modifications: 1Cys-am
A0647ANXA1, ANX1, LPC1Annexin A1P04083KGVDEATIIDILTKR   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KGVDEVTIVNILTNRS   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KGVIVDKDFSHPQMPKK  modifications: 1Met-ox
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KGVLFASGQNLARQ   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044KGVLFGVPGAFTPGCSKT   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KGVPLYRH   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KGVPLYRH   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KGVTFNVTTVDTKR   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KGWPLYLSTKN   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KGYFVQPTVFSNVTDEMRI   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KGYFVQPTVFSNVTDEMRI  modifications: 1Met-ox
A5959CA1Carbonic anhydrase 1P00915KHDTSLKPISVSYNPATAKE   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KHGDDLRRT   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KHGEVCPAGWKPGSDTIKPDVQKS   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441KHGGPKDEERH   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KHGGTIPIVPTAEFQDRI   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371KHGINCFINRQ   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KHHPEDVEPALRK   
A3205TPM3Tropomyosin alpha 3 chainP06753KHIAEEADRK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KHKLDVTSVEDYKA   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930KHLGGIPWTYAEDAVPTLTPCRF   
A9149GCVitamin D-binding protein precursorP02774KHLSLLTTLSNRV   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KHLTPVTLELGGKS   
A9149GCVitamin D-binding protein precursorP02774KHQPQEFPTYVEPTNDEICEAFRK   
A9149GCVitamin D-binding protein precursorP02774KHQPQEFPTYVEPTNDEICEAFRK  modifications: 1Cys-am
A643CTF, PRO1400Serotransferrin precursorP02787KHQTVPQNTGGKN   
A643CTF, PRO1400Serotransferrin precursorP02787KHSTIFENLANKA   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KHWPFQVINDGDKPKV   
A8385ANXA3, ANX3Annexin A3P12429KHYGYSLYSAIKS   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KIAILTCPFEPPKPKT   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KIAILTCPFEPPKPKT  modifications: 1Cys-am
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KIAVAAQNCYKV   
A1609CALR, CRTCCalreticulin precursorP27797KIDDPTDSKPEDWDKPEHIPDPDAKK   
A1609CALR, CRTCCalreticulin precursorP27797KIDNSQVESGSLEDDWDFLPPKK   
A643CTF, PRO1400Serotransferrin precursorP02787KIECVSAETTEDCIAKI   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KIEEFLEAVLCPPRY   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KIEEFLEAVLCPPRY  modifications: 1Cys-am
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KIENHEGVRR   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KIEWLESHQDADIEDFKA   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KIFINNEWHDSVSGKK   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KIGHPAPNFKA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KIGLFGGAGVGKT   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KIGNCPFSQRL   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371KIHPQTIIAGWRE   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KIIAEGANGPTTPEADKIFLERN   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KIIAPPERK   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KIIAPPERK   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KIIEDLRA   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406KIISNASCTTNCLAPLAKV   
A1609CALR, CRTCCalreticulin precursorP27797KIKDPDASKPEDWDERA   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KILGATIENSRI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KILQDYKS   
A643CTF, PRO1400Serotransferrin precursorP02787KILRQQQHLFGSNVTDCSGNFCLFRS  modifications: 2Cys-am
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KILSDMRS  modifications: 1Met-ox
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KIMADIRA  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KINSWVESQTNEKI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KIPVGPETLGRI   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KIRDWYQKQ   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KIREEYPDRI   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KISGGSVVEMQGDEMTRI  modifications: 2Met-ox
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KISSIQSIVPALEIANAHRK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KITITNDKGRL   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KITITNDQNRL   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KITLDNAYMEKC  modifications: 1Met-ox
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KITPNLAEFAFSLYRQ   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KIWYEHRL   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KIYVDDGLISLQVKQ   
A643CTF, PRO1400Serotransferrin precursorP02787KKDSGFQMNQLRG  modifications: 1Met-ox
A1949GSTA1, GST2Glutathione S-transferase A1P08263KKFLQPGSPRK   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KKGFIGPGIDVPAPDMSTGERE  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KKGGSFQLNELQGLKS   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KKISSIQSIVPALEIANAHRK   
A1550S100A8, CAGA, CFAGCalgranulin AP05109KKLLETECPQYIRK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KKLYHSEAFTVNFGDTEEAKK   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KKNHEEEISTLRG   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KKQINDYVEKG   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KKQTALVELVKH   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KKSDIDEIVLVGGSTRI   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KKSFETFSHRR   
A1742HBB, beta-globinHemoglobin beta chainP68871KKVLGAFSDGLAHLDNLKG   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KKVPQVSTPTLVEVSRN   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KKWQEEMELYRQ  modifications: 1Met-ox
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KKYEEIDNAPEERA   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KKYEGGRE   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KKYLYEIARR   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KLAALNPESNTAGLDIFAKF   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KLADFALLCLDGKR   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KLADLIERD   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLALDIEIATYRK   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729KLALDIEIATYRK   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KLALDVEIATYRK   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KLAMQEFMILPVGAANFRE  modifications: 2Met-ox
A0432PRDX6, AOP2Peroxiredoxin 6P30041KLAPEFAKR   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792KLATQSNEITIPVTFESRA   
A3693CKB, CKBBCreatine kinase B-typeP12277KLAVEALSSLDGDLAGRY   
A3693CKB, CKBBCreatine kinase B-typeP12277KLAVEALSSLDGDLAGRYYALKS   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KLAVNMVPFPRL  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KLCTVATLRE   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KLCYVALDFEQEMATAASSSSLEKS  modifications: 1Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KLCYVALDFEQEMATAASSSSLEKS  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KLDELRDEGKA   
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55KLDITAEILAVRD   
A0492STIP1Stress-induced-phosphoprotein 1P31948KLDPHNHVLYSNRS   
A3793PHBProhibitinP35232KLEAAEDIAYQLSRS   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KLEAEIATYRR   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLEAELGNMQGLVEDFKN  modifications: 1Met-ox
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KLECGGGPWGNKG   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KLFEASIETGDRV   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119KLGCEVLGVSVDSQFTHLAWINTPRK   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KLGENLKIKL   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KLGFAGLVQEISFGTTKD   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KLGFAGLVQEISFGTTKDKM   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KLGHPDTLNQGEFKE   
A9811CAPSCalcyphosinQ13938KLGLVLDQAEAEGVCRK   
A9811CAPSCalcyphosinQ13938KLGLVLDQAEAEGVCRK  modifications: 1Cys-am
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727KLGPHAGDVEGHLSFLEKD   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KLHELQEKL   
A1742HBB, beta-globinHemoglobin beta chainP68871KLHVDPENFRL   
A1949GSTA1, GST2Glutathione S-transferase A1P08263KLHYFNARG   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KLIFPYVELDLHSYDLGIENRD   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KLKECCEKPLLEKS   
A3205TPM3Tropomyosin alpha 3 chainP06753KLKGTEDELDKY   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLKLEAELGNMQGLVEDFKN  modifications: 1Met-ox
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KLLDAVDTYIPVPARD   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KLLDNWDSVTSTFSKL   
A0492STIP1Stress-induced-phosphoprotein 1P31948KLLEFQLALKD   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLLEGEESRL   
A1550S100A8, CAGA, CFAGCalgranulin AP05109KLLETECPQYIRK   
A1550S100A8, CAGA, CFAGCalgranulin AP05109KLLETECPQYIRK  modifications: 1Cys-am
A1550S100A8, CAGA, CFAGCalgranulin AP05109KLLETECPQYIRKK   
A3693CKB, CKBBCreatine kinase B-typeP12277KLLIEMEQRL  modifications: 1Met-ox
A021CHPXHemopexin precursorP02790KLLQDEFPGIPSPLDAAVECHRG   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KLLQDFFNGKE   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KLLQDFFNGRD   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KLLTEFNKS   
A0492STIP1Stress-induced-phosphoprotein 1P31948KLMDVGLIAIR  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KLMEWTSLQNMRE   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KLMEWTSLQNMRE  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KLMEWTSLQNMRE  modifications: 2Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KLNFAVASRK   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KLPEWAADEPVEKT   
A0432PRDX6, AOP2Peroxiredoxin 6P30041KLPFPIIDDRN   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KLQHGSILGFPKA   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KLQHLENELTHDIITKF   
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55KLQVNTPLVGASLLRL   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KLRPVAAEVYGTERQ   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLSELEAALQRA   
A0432PRDX6, AOP2Peroxiredoxin 6P30041KLSILYPATTGRN   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KLSITGTYDLKS   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KLSLEGDHSTPPSAYGSVKA   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KLSPLGEEMRD  modifications: 1Met-ox
A8385ANXA3, ANX3Annexin A3P12429KLTFDEYRN   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KLTMQNLNDRL  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KLTTPTYGDLNHLVSATMSGVTTCLRF  modifications: 1Met-ox
A3205TPM3Tropomyosin alpha 3 chainP06753KLVIIEGDLERT   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406KLVINGNPITIFQERD   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406KLVINGNPITIFQERDPSKI   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KLVLPSLISSRI   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KLVNEVTEFAKT   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727KLVPFATELHERL   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KLVQDVANNTNEEAGDGTTTATVLARS   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KLVSESSDVLPK   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KLYGSGDQEAWQKG   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KLYHSEAFTVNFGDTEEAKK   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KLYHSEAFTVNFGDTEEAKKQ   
A5959CA1Carbonic anhydrase 1P00915KLYPIANGNNQSPVDIKT   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KLYSNAYLNDLAGCIKT   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KLYSPSQIGAFVLMKM  modifications: 1Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KMDATANDVPSPYEVRG  modifications: 1Met-ox
A3918VCPTransitional endoplasmic reticulum ATPaseP55072KMDELQLFRG  modifications: 1Met-ox
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KMEEFKDQLPADECNKL  modifications: 1Met-ox
A3205TPM3Tropomyosin alpha 3 chainP06753KMELQEIQLKE  modifications: 1Met-ox
A3205TPM3Tropomyosin alpha 3 chainP06753KMELQEIQLKEAKH  modifications: 1Met-ox
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KMHEGDEGPGHHHKPGLGEGTP   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KMHEGDEGPGHHHKPGLGEGTP  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KMSATFIGNSTAIQELFKR  modifications: 1Met-ox
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KMSQLERN   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KMSQLERN  modifications: 1Met-ox
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KMVEGFFDRG  modifications: 1Met-ox
A0647ANXA1, ANX1, LPC1Annexin A1P04083KMYGISLCQAILDETKG  modifications: 1Met-ox
A643CTF, PRO1400Serotransferrin precursorP02787KMYLGYEYVTAIRN   
A643CTF, PRO1400Serotransferrin precursorP02787KMYLGYEYVTAIRN  modifications: 1Met-ox
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KNADGTICYDSTHYKE   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KNADLQVLKPEPELVYEDLRG   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KNAGVEGSLIVEKI   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KNALESYAFNMKS  modifications: 1Met-ox
A3918VCPTransitional endoplasmic reticulum ATPaseP55072KNAPAIIFIDELDAIAPKR   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KNAVITVPAYFNDSQRQ   
A021CHPXHemopexin precursorP02790KNFPSPVDAAFRQ   
A5959CA1Carbonic anhydrase 1P00915KNGPEQWSKL   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KNHEEEISTLRG   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618KNICKVVEVGSKI   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KNKITITNDQNRL   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KNKLEGLEDALQKA   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KNLIPEGNIGSNTTLVLVNAIYFKG   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669KNLKPIKPMQFLGDEETVRK  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KNLLFNDNTECLARL   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KNLLFNDNTECLARL  modifications: 1Cys-am
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KNLNHVSYGRL   
A643CTF, PRO1400Serotransferrin precursorP02787KNPDPWAKN   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KNQTAEKEEFEHQQKE   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KNQVALNPQNTVFDAKR   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KNQVAMNPTNTVFDAKR  modifications: 1Met-ox
A1949GSTA1, GST2Glutathione S-transferase A1P08263KNRYFPAFEKV   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KNSNPALNDNLEKG   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KNSSYFVEWIPNNVKT   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KNYAEAKD   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KQAGPASVPLRT   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KQAKVLENAEGART  modifications: pyroGlu
A0647ANXA1, ANX1, LPC1Annexin A1P04083KQAWFIENEEQEYVQTVKS  modifications: pyroGlu
A0647ANXA1, ANX1, LPC1Annexin A1P04083KQAWFIENEEQEYVQTVKS   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KQCASLQAAIADAEQRGEMALKD   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729KQEELEAALQRAKQ   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KQEPERNECFLQHKD   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KQEPERNECFLQHKD  modifications: 1Cys-am
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KQEYDESGPSIVHRK  modifications: pyroGlu
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KQEYDESGPSIVHRK   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KQEYDESGPSIVHRK  modifications: pyroGlu
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KQEYDESGPSIVHRK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KQFAPIHAEAPEFMEMSVEQEILVTGIKV  modifications: 2Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KQFYPDLIRE  modifications: pyroGlu
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KQFYPDLIRE   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KQGGLGPMNIPLVSDPKR  modifications: pyroGlu;1Met-ox
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830KQGGLGPMNIPLVSDPKR  modifications: 1Met-ox
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KQGHFYGETAAVYVAVEERK   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KQGPGPSRD  modifications: pyroGlu
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KQGPGPSRD   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KQINDYVEKG   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KQKILDKC  modifications: pyroGlu
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KQLSFEEFIMLMARL  modifications: pyroGlu
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KQLSFEEFIMLMARL  modifications: pyroGlu;1Met-ox
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KQLSFEEFIMLMARL   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KQLSFEEFIMLMARL  modifications: 1Met-ox
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KQLSFEEFIMLMARL  modifications: 2Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KQNCELFEQLGEYKF   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KQNCELFEQLGEYKF  modifications: 1Cys-am
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KQQHVIETLIGKK   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643KQQISLATQMVRM  modifications: 1Met-ox
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KQSLGELIGTLNAAKV   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KQTALVELVKH   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KQTQIFTTYSDNQPGVLIQVYEGERA  modifications: pyroGlu
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KQTQIFTTYSDNQPGVLIQVYEGERA   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KQTQTFTTYSDNQPGVLIQVYEGERA   
A3793PHBProhibitinP35232KQVAQQEAERA   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KQVLLHQQAKF   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KRAPAFEGRI   
A3693CKB, CKBBCreatine kinase B-typeP12277KRGTGGVDTAAVGGVFDVSNADRL   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KRKPVTEARS   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KRNNAQRQ   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978KRPAEDMEEEQAFKR  modifications: 1Met-ox
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978KRPAEDMEEEQAFKRS  modifications: 1Met-ox
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KRTEMENEFVLIKK  modifications: 1Met-ox
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KRVEEFKL   
A643CTF, PRO1400Serotransferrin precursorP02787KSASDLTWDNLKG   
A1742HBB, beta-globinHemoglobin beta chainP68871KSAVTALWGKV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KSCHTAVDRT   
A643CTF, PRO1400Serotransferrin precursorP02787KSCHTAVGRT   
A643CTF, PRO1400Serotransferrin precursorP02787KSCHTGLGRS   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KSCHTGLRR   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KSCNCLLLKV   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KSDIDEIVLVGGSTRI   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KSDIGEVILVGGMTRM  modifications: 1Met-ox
A643CTF, PRO1400Serotransferrin precursorP02787KSDNCEDTPEAGYFAVAVVKK   
A643CTF, PRO1400Serotransferrin precursorP02787KSDNCEDTPEAGYFAVAVVKK  modifications: 1Cys-am
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KSEEEVAARRA   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727KSELTQQLNALFQDKL   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KSEVAHRF   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KSFETFSHRR   
A1550S100A8, CAGA, CFAGCalgranulin AP05109KSHEESHKE   
A1949GSTA1, GST2Glutathione S-transferase A1P08263KSHGQDYLVGNKL   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KSINPDEAVAYGAAVQAAILMGDKS  modifications: 1Met-ox
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KSINPDEAVAYGAAVQAAILSGDKS   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KSIQMMRQ   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KSIQMMRQ  modifications: 1Met-ox
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727KSLAELGGHLDQQVEEFRR   
A8385ANXA3, ANX3Annexin A3P12429KSLGDDISSETSGDFRK   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KSLHTLFGDKL   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KSLQDIIAILGMDELSEEDKL  modifications: 1Met-ox
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KSLQDIIAILGMDELSEEDKLTVSRA  modifications: 1Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KSLYYYIQQDTKG   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KSNAPRVKA   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KSNVSDAVAQSTRI   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRH   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KSPLFMGKV  modifications: 1Met-ox
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KSPNGTIRN   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KSPQYCQVIHRL   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228KSPQYCQVIHRL  modifications: 1Cys-am
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KSQIFSTASDNQPTVTIKV   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KSQIHDIVLVGGSTRI   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KSQQSSDPDPNCVDRPVEGYLAVAVVRR   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KSQVFSTAADGQTQVEIKV   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727KSRLEQEIATYRS   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KSTAGDTHLGGEDFDNRM   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KSTNGDTFLGGEDFDQALLRH   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KSVLGQLGITKV   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709KSYELPDGQVITIGNERF   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261KSYELPDGQVITIGNERF   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KSYSPYDMLESIRK  modifications: 1Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KSYSPYDMLESIRKE  modifications: 1Met-ox
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KTATPQQAQEVHEKL   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371KTAVCDIPPRG   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119KTDEGIAYRG   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KTDLEKDIISDTSGDFRK   
A3693CKB, CKBBCreatine kinase B-typeP12277KTDLNPDNLQGGDDLDPNYVLSSRV   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KTDTSHHDQDHPTFNKI   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KTEISEMNRN  modifications: 1Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KTFSHELSDFGLESTAGEIPVVAIRT   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KTFVVQGFGNVGLHSMRY  modifications: 1Met-ox
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KTGAPCRSERL  modifications: 1Cys-am
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044KTHLPGFVEQAEALKA   
A4577ANXA7, ANX7, SNXAnnexin A7P20073KTILQCALNRPAFFAERL   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KTIQVDNTDAEGRL   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KTKPYIQVDIGGGQTKT   
A4577ANXA7, ANX7, SNXAnnexin A7P20073KTLGTMIAGDTSGDYRR  modifications: 1Met-ox
A4577ANXA7, ANX7, SNXAnnexin A7P20073KTLGTMIAGDTSGDYRRL  modifications: 1Met-ox
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KTLNDELEIIEGMKF  modifications: 1Met-ox
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809KTLNDELEIIEGMKFDRG  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KTNSILFYGRF   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905KTNVKAAWGKV   
A0647ANXA1, ANX1, LPC1Annexin A1P04083KTPAQFDADELRA   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355KTPAQYDASELKA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KTPVSDRV   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KTVAYTEQKM   
A0492STIP1Stress-induced-phosphoprotein 1P31948KTVDLKPDWGKG   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KTVEAEAAHGTVTRH   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KTVTNAVVTVPAYFNDSQRQ   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KTYETTLEKC   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905KTYFPHFDLSHGSAQVKG   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KTYLFLQEYLDAIKK   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905KVADALTNAVAHVDDMPNALSALSDLHAHKL   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905KVADALTNAVAHVDDMPNALSALSDLHAHKL  modifications: 1Met-ox
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KVAFTGSTEVGKL   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KVALVYGQMNEPPGARA   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KVALVYGQMNEPPGARA  modifications: 1Met-ox
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KVAYGGTGDAATRY   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729KVDALNDEINFLRT   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KVEAQVYILSKE   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142KVEIIANDQGNRT   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KVEIIANDQGNRT   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874KVEITYTPSDGTQKV   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KVELQAKADTLTDEINFLRA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KVFDEFKPLVEEPQNLIKQ   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KVFDFTFSPEEMKQ  modifications: 1Met-ox
A6935LYZ, LZMLysozyme C precursorP61626KVFERCELART   
A6935LYZ, LZMLysozyme C precursorP61626KVFERCELART    
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KVFSNGADLSGVTEEAPLKL   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905KVGAHAGEYGAEALERM   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044KVGDAIPAVEVFEGEPGNKV   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KVHTECCHGDLLECADDRA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KVHTECCHGDLLECADDRA  modifications: 1Cys-am
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KVHTECCHGDLLECADDRADLAKY   
A1609CALR, CRTCCalreticulin precursorP27797KVHVIFNYKG   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KVIDDTNITRL   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702KVIEHIMEDLDTNADKQ   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299KVLDNYLTSPLPEEVDETSAEDEGVSQRK   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KVLDTKWTLLQEQGTKT   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KVLEIPYKG   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KVLENAEGART   
A9149GCVitamin D-binding protein precursorP02774KVLEPTLKSLGECCDVEDSTTCFNAKG  modifications: 2Cys-am
A1742HBB, beta-globinHemoglobin beta chainP68871KVLGAFSDGLAHLDNLKG   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508KVLHFDQVTENTTGKA   
A3693CKB, CKBBCreatine kinase B-typeP12277KVLTPELYAELRA   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044KVNLAELFKG   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KVNQIGSVTESLQACKL   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KVNQIGSVTESLQACKL   
A1742HBB, beta-globinHemoglobin beta chainP68871KVNVDEVGGEALGRL   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KVPADTEVVCAPPTAYIDFARQ   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KVPADTEVVCAPPTAYIDFARQ  modifications: 1Cys-am
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KVPCHFPCKF   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KVPQVSTPTLVEVSRN   
A9149GCVitamin D-binding protein precursorP02774KVPTADLEDVLPLAEDITNILSKC   
A9149GCVitamin D-binding protein precursorP02774KVPTADLEDVLPLAEDITNILSKCCESASEDCMAKE  modifications: 1Met-ox
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KVQKLLQDFFNGRD   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KVQPYLDDFQKK   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KVQQTVQDLFGRA   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838KVRYPPSPAKM   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KVSFLSALEEYTKK   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KVSTSGPRA   
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55KVTDPQLLELGLVQSPDGHRL   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KVTHAVVTVPAYFNDAQRQ   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KVTNGAFTGEISPGMIKD  modifications: 1Met-ox
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55KVTSVIPGLNNIIDIKV   
A1742HBB, beta-globinHemoglobin beta chainP68871KVVAGVANALAHKY   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576KVVDLLAPYAKG   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KVVFEQTKV   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KVVIGMDVAASEFFRS   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KVVIGMDVAASEFFRS  modifications: 1Met-ox
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KVVIGMDVAASEFYRD   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KVVIGMDVAASEFYRD  modifications: 1Met-ox
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174KVVLAYEPVWAIGTGKT   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KVVVAENFDEIVNNENKD   
A021CHPXHemopexin precursorP02790KVWVYPPEKK   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021KVYEGERPLTKD   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833KVYTVDLGRT   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838KWAHLDIAGVMTNKD  modifications: 1Met-ox
A643CTF, PRO1400Serotransferrin precursorP02787KWCALSHHERL   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009KWERPFEVKD   
A6935LYZ, LZMLysozyme C precursorP61626KWESGYNTRA   
A1552APOA1, A175PApolipoprotein A-I precursorP02647KWQEEMELYRQ  modifications: 1Met-ox
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729KWTLLQEQKS   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646KYAEEDRRK   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550KYALSVGYRH   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KYDLDFKS   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KYEDEINKRT   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411KYEEIDNAPEERA   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787KYEELQSLAGKH   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667KYEELQVTAGRH   
A3205TPM3Tropomyosin alpha 3 chainP06753KYEEVARKL   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783KYETELAMRQ  modifications: 1Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101KYGVSGYPTLKI   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KYICENQDSISSKL   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352KYILGNPLTPGVTQGPQIDKE   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KYISLIYTNYEAGKD   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211KYISLIYTNYEAGKDDYVKA   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930KYIYDQCPAVAGYGPIEQLPDYNRI   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930KYIYDQCPAVAGYGPIEQLPDYNRI  modifications: 1Cys-am
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107KYKAEDEVQRE   
A0492STIP1Stress-induced-phosphoprotein 1P31948KYKDAIHFYNKS   
A643CTF, PRO1400Serotransferrin precursorP02787KYLGEEYVKA   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788KYLGPQYVAGITNLKK   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768KYLYEIARR   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367KYNLGLDLRT   
A1949GSTA1, GST2Glutathione S-transferase A1P08263KYNLYGKD   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524KYNQLLRI   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733KYNQLLRI   
A5959CA1Carbonic anhydrase 1P00915KYSAELHVAHWNSAKY   
A9149GCVitamin D-binding protein precursorP02774KYTFELSRR   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905LAAHLPAEFTPA    
A2402PRB4Basic salivary proline-rich protein 4P10163LFLISGKPEGRR    
A9190OBP2AOdorant-binding protein 2a precursorQ9NY56;Q9NPH6LSFTLEEEDIT    
A1742HBB, beta-globinHemoglobin beta chainP68871LVVYPWTQRFFE    
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174MAPSRKF  modifications: 1Met-ox
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905MFLSFPTTKTYF    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576MLGFVGRV   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576MLGFVGRVAAAPASGALRR  modifications: 1Met-ox
A1550S100A8, CAGA, CFAGCalgranulin AP05109MLTELEKALN    
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211PPYTVVYFPVRG   
A3793PHBProhibitinP35232RAATFGLILDDVSLTHLTFGKE   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RAAVAAGCRQ   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RAAVEEGIVLGGGCALLRC   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RAAVEEGIVLGGGCALLRC  modifications: 1Cys-am
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RAAVPSGASTGIYEALELRD   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RADAVTLDGGFIYEAGLAPYKL   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RADEGWYWCGVKQ   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RADMGGAATICSAIVSAAKL  modifications: 1Cys-am
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RAEAESMYQIKY   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RAEAGDNLGALVRG   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RAEAGDNLGALVRGLKR   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RAEDGSVIDYELIDQDARD   
A3205TPM3Tropomyosin alpha 3 chainP06753RAEFAERS   
A3205TPM3Tropomyosin alpha 3 chainP06753RAEFAERSVAKL   
A1552APOA1, A175PApolipoprotein A-I precursorP02647RAELQEGARQ   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RAEVSADQVATVMWDYFSQLSNNAKE  modifications: 1Met-ox
A1552APOA1, A175PApolipoprotein A-I precursorP02647RAHVDALRT   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RAIAELGIYPAVDPLDSTSRI   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RAKLEAAIAEAEERG   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RAKQEELEAALQRA   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RALMLQGVDLLADAVAVTMGPKG  modifications: 2Met-ox
A9811CAPSCalcyphosinQ13938RALRPPMSQARE   
A9811CAPSCalcyphosinQ13938RALRPPMSQARE  modifications: 1Met-ox
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RALSSQHQARI   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RALTVPELTQQMFDAKN  modifications: 1Met-ox
A0647ANXA1, ANX1, LPC1Annexin A1P04083RALYEAGERR   
A0492STIP1Stress-induced-phosphoprotein 1P31948RAMADPEVQQIMSDPAMRL  modifications: 3Met-ox
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RAMTKDNNLLGKF  modifications: 1Met-ox
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RANNTFYGLSAGVFTKD   
A643CTF, PRO1400Serotransferrin precursorP02787RAPNHAVVTRK   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RAPSIHGGSGGRG   
A9811CAPSCalcyphosinQ13938RAQCLSRG   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RAQFEGIVTDLIRR   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367RAQHSQHRT   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RAQIFANTVDNARI   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RAQLGGPEAAKS   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RAQYDELARK   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RARFEELCSDLFRS   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RASLEAAIADAEQRG   
A6935LYZ, LZMLysozyme C precursorP61626RATNYNAGDRS   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RAVFPSIVGRPRH   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RAVFPSIVGRPRH   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RAVFVDLEPTVIDEIRN   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RAVFVDLEPTVIDEVRT   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RAVFVDLEPTVIDEVRT   
A3793PHBProhibitinP35232RAVIFDRF   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RAVLVDLEPGTMDSVRS  modifications: 1Met-ox
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RAVMIDLEPTVVDEVRA   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RAVMIDLEPTVVDEVRA  modifications: 1Met-ox
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RAVTIFIRG   
A6935LYZ, LZMLysozyme C precursorP61626RAWVAWRN   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RCIPALDSLTPANEDQKI   
A1609CALR, CRTCCalreticulin precursorP27797RCKDDEFTHLYTLIVRPDNTYEVKI   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RCLAENAGDVAFVKD   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RCPLLVDSEGWVKA   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RCYQSEFGRD   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RDAGHPLYPFNDPY   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RDAGYEFDICFTSVQKR   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367RDDGSWEVIEGYRA   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RDENQSINHQMAQEDAQRL   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RDENQSINHQMAQEDAQRL  modifications: 1Met-ox
A0432PRDX6, AOP2Peroxiredoxin 6P30041RDFTPVCTTELGRA   
A0432PRDX6, AOP2Peroxiredoxin 6P30041RDFTPVCTTELGRA  modifications: 1Cys-am
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RDGAGDVAFIRE   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RDGEEAGAYDGPRT   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RDGFNPADVEAGLYGSHLYVWDWQRH   
A643CTF, PRO1400Serotransferrin precursorP02787RDHMKSVIPSDGPSVACVKK  modifications: 1Cys-am
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524RDIFESRG   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RDKPHVNVGTIGHVDHGKT   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RDLEKPFLLPVEAVYSVPGRG   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RDLTDYLMKI  modifications: 1Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RDLTDYLMKI  modifications: 1Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RDLYDAGVKR   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RDLYDAGVKRK   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524RDNDKTRY   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RDNDKTRY   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RDPDEPVLLEEPVVLALAEKY   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RDQEGQDVLLFIDNIFRF   
A643CTF, PRO1400Serotransferrin precursorP02787RDQYELLCLDNTRK   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RDRLLLATMESMNGGKL  modifications: 2Met-ox
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367RDSNYHLLMSVQESLERK  modifications: 1Met-ox
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009RDTVFALVNYIFFKG   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RDVDFELIKV   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930RDVVFNYLHATAFQGTPLAQAVEGPSENVRK   
A3693CKB, CKBBCreatine kinase B-typeP12277RDWPDARG   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RDWSHYFKI   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RDWYPHSRL   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RDYDDMSPRR  modifications: 1Met-ox
A021CHPXHemopexin precursorP02790RDYFMPCPGRG   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RDYSHYYTTIQDLRD   
A1552APOA1, A175PApolipoprotein A-I precursorP02647RDYVSQFEGSALGKQ   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618REAEAAIYHLQLFEELRR   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101REATNPPVIQEEKPKK   
A9811CAPSCalcyphosinQ13938REAVIAAAFAKL   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072REDEEESLNEVGYDDIGGCRK   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072REDEEESLNEVGYDDIGGCRK  modifications: 1Cys-am
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299REEFASTCPDDEEIELAYEQVAKA   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299REEFASTCPDDEEIELAYEQVAKA  modifications: 1Cys-am
A463CSELENBP1, SBPSelenium-binding protein 1Q13228REEIVYLPCIYRN   
A4577ANXA7, ANX7, SNXAnnexin A7P20073REFSGYVESGLKT   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576REGNDLYHEMIESGVINLKD  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228REGSVMLQVDVDTVKGGLKL  modifications: 1Met-ox
A370ATUFMElongation factor Tu, mitochondrial precursorP49411REHLLLARQ   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733REIFDSRG   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371REIVHLQAGQCGNQIGAKF   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838REKPLALYMFSSNDKV  modifications: 1Met-ox
A0432PRDX6, AOP2Peroxiredoxin 6P30041RELAILLGMLDPAEKD  modifications: 1Met-ox
A0432PRDX6, AOP2Peroxiredoxin 6P30041RELAILLGMLDPAEKDEKG  modifications: 1Met-ox
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RELGEYGFHEYTEVKT   
A0492STIP1Stress-induced-phosphoprotein 1P31948RELIEQLRN   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RELLTEFGYKG   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RELQELVQYPVEHPDKF   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RELQSQISDTSVVLSMDNSRS  modifications: 1Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RELSDFISYLQRE   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RENADSLQASLRPHADELKA   
A1552APOA1, A175PApolipoprotein A-I precursorP02647REQLGPVTQEFWDNLEKE   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RETLNISGPPLKA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RETYGEMADCCAKQ  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727REVAGHTEQLQMSRS  modifications: 1Met-ox
A3918VCPTransitional endoplasmic reticulum ATPaseP55072REVDIGIPDATGRL   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729REVTINQSLLAPLRL   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787REYQELMNVKL  modifications: 1Met-ox
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RFAEIIEKN   
A3693CKB, CKBBCreatine kinase B-typeP12277RFCTGLTQIETLFKS   
A3793PHBProhibitinP35232RFDAGELITQRE   
A643CTF, PRO1400Serotransferrin precursorP02787RFDEFFSEGCAPGSKK   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RFDGALNVDLTEFQTNLVPYPRI   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RFDGALNVDLTEFQTNLVPYPRI   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RFDGALNVDLTEFQTNLVPYPRI   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RFDGALNVDLTEFQTNLVPYPRI   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RFDHILYTGSTGVGKI   
A021CHPXHemopexin precursorP02790RFDPVRGEVPPRY   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RFEELCSDLFRS   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RFEELCSDLFRS  modifications: 1Cys-am
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RFEELNADLFRG   
A1742HBB, beta-globinHemoglobin beta chainP68871RFFESFGDLSTPDAVMGNPKV   
A1742HBB, beta-globinHemoglobin beta chainP68871RFFESFGDLSTPDAVMGNPKV  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RFFSASCVPGADKG   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RFGPGVAFRA   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RFKDLGEENFKA   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RFKVEESYDLKD   
A9811CAPSCalcyphosinQ13938RFLDNFDSSEKD   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RFLEQQNKL   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RFLEQQNKM   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RFLEQQNKMLETKW  modifications: 1Met-ox
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RFLQDYFDGNLKR   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RFLSQPFQVAEVFTGHMGKL  modifications: 1Met-ox
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RFLYFSNWLHGDLRQ   
A3693CKB, CKBBCreatine kinase B-typeP12277RFPAEDEFPDLSAHNNHMAKV  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RFPGQLNADLRK   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RFSGWYDADLSPAGHEEAK®   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RFSGWYDADLSPAGHEEAKRG   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044RFSMVVQDGIVKA   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044RFSMVVQDGIVKA  modifications: 1Met-ox
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RFTQAGSEVSALLGRI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERI  modifications: 2Met-ox
A8272IGJ, IGCJImmunoglobulin J chainP01591RFVYHLSDLCKK   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406RGALQNIIPASTGAAKA   
A9811CAPSCalcyphosinQ13938RGASGIQGLARF   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371RGATQQILDEAERS   
A021CHPXHemopexin precursorP02790RGECQAEGVLFFQGDRE   
A021CHPXHemopexin precursorP02790RGECQAEGVLFFQGDRE  modifications: 1Cys-am
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RGELAIKDANAKL   
A3693CKB, CKBBCreatine kinase B-typeP12277RGFCLPPHCSRG   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RGFPTIYFSPANKK   
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299RGFTIPEAFRG   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RGGCITLISSEGYVSSKY   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RGGDLMAYDRR  modifications: 1Met-ox
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RGGRPMPPSRR   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RGIHPIRI   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RGILLYGPPGTGKT   
A6935LYZ, LZMLysozyme C precursorP61626RGISLANWMCLAKW  modifications: 1Met-ox
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RGITINAAHVEYSTAARH   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RGLEVTAYSPLGSSDRA   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RGLFIIDDKG   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RGLFIIDDKGILRQ   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RGLFIIDGKG   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RGLVLSGVLHKA   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RGLVMVKPGSIKPHQKV  modifications: 1Met-ox
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RGNPTVEVDLFTSKG   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RGPPPPPPGRG   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RGPSWDPFRD   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RGQLEALQVDGGRL   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RGQVGGQVSVEVDSAPGTDLAKI   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RGRLDSELRN   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RGRPVGFPMRGRG  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RGSQQYRA   
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RGSVTFHCALGPEVANVAKF   
A3693CKB, CKBBCreatine kinase B-typeP12277RGTGGVDTAAVGGVFDVSNADRL   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RGTVVTGTLERG   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RGVMLAVDAVIAELKK  modifications: 1Met-ox
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RGVPQIEVTFEIDVNGILRV   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RGYISPYFINTSKG   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RGYSFTTTAERE   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RGYSFTTTAERE   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874RHAYGDQYRA   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RHEIVQTLSLKD   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RHGESAWNLENRF   
A3693CKB, CKBBCreatine kinase B-typeP12277RHGGYKPSDEHKT   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RHIADLAGNSEVILPVPAFNVINGGSHAGNKL   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RHIDCAAIYGNEPEIGEALKE   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RHIDCAAIYGNEPEIGEALKE  modifications: 1Cys-am
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RHPDYSVVLLLRL   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RHPYFYAPELLFFAKR   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RHPYFYAPELLFFAKRY   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RHQGVMVGMGQKD  modifications: 2Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RHQGVMVGMGQKD  modifications: 2Met-ox
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RHTADRWRV   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174RHVFGESDELIGQKV   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441RHVGDLGNVTADKD   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RHYAHTDCPGHADYVKN   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RHYGGLTGLNKA   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RIADGYEQAARV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RIDSGLYLGSGYFTAIQNLRK   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RIEIESFYEGEDFSETLTRA   
A3793PHBProhibitinP35232RIFTSIGEDYDERV   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RIFVEESIYDEFVRR   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524RIGAEVYHNLKN   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RIGAEVYHNLKN   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RIHFPLATYAPVISAEKA   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RIHFPLATYAPVISAEKA   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RIHFPLATYAPVISAEKA   
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorP00367RIIKPCNHVLSLSFPIRR   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RIINEPTAAAIAYGLDKK   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RIINEPTAAAIAYGLDKR   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RIINEPTAAAIAYGLDRT   
A8272IGJ, IGCJImmunoglobulin J chainP01591RIIVPLNNRE   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874RIIWELIKE   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174RIIYGGSVTGATCKE   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RIMDPNIVGSEHYDVARG  modifications: 1Met-ox
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RIMNVIGEPIDERG  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RINVYYNEATGGKY   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RIPSAVGYQPTLATDMGTMQERI  modifications: 2Met-ox
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RIQEIIEQLDVTTSEYEKE   
A3205TPM3Tropomyosin alpha 3 chainP06753RIQLVEEELDRA   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RISDTGSAGLMLVEFFAPWCGHCKRL  modifications: 1Cys-am
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RISEQFTAMFRR   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RISEQFTAMFRR  modifications: 1Met-ox
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RISSSSFSRV   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RITPSYVAFTPEGERL   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RIVLQIDNARL   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RIVLQIDNARL   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RIVSQLLTLMDGLKQ  modifications: 1Met-ox
A0492STIP1Stress-induced-phosphoprotein 1P31948RKAAALEFLNRF   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RKDAEAWFTSRT   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RKDLYANTVLSGGTTMYPGIADRM  modifications: 1Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RKDLYANTVLSGGTTMYPGIADRM  modifications: 1Met-ox
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RKDSETGENIRQ   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RKEGGLGPLNIPLLADVTRR   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174RKFFVGGNWKM   
A0492STIP1Stress-induced-phosphoprotein 1P31948RKFMNPFNMPNLYQKL  modifications: 2Met-ox
A9149GCVitamin D-binding protein precursorP02774RKFPSGTFEQVSQLVKE   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RKGDIFLVRG   
A0647ANXA1, ANX1, LPC1Annexin A1P04083RKGTDVNVFNTILTTRS   
A3793PHBProhibitinP35232RKLEAAEDIAYQLSRS   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RKLLEGEESRL   
A3205TPM3Tropomyosin alpha 3 chainP06753RKLVIIEGDLERT   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RKPLVIIAEDVDGEALSTLVLNRL   
A643CTF, PRO1400Serotransferrin precursorP02787RKPVEEYANCHLARA   
A643CTF, PRO1400Serotransferrin precursorP02787RKPVEEYANCHLARA  modifications: 1Cys-am
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RKSEEEVAARR   
A3205TPM3Tropomyosin alpha 3 chainP06753RKYEEVARK   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKL  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RLAADDFRT   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RLAADDFRV   
A1552APOA1, A175PApolipoprotein A-I precursorP02647RLAEYHAKA   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RLAPEYEAAATRL   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RLAPITSDPTEATAVGAVEASFKC   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RLASYLDRV   
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55RLAVKLDITAEILAVRD   
A0492STIP1Stress-induced-phosphoprotein 1P31948RLAYINPDLALEEKN   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RLDIDSPPITARN   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RLDLAGRD   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RLDLAGRD   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RLDQLIYIPLPDEKS   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RLEGLTDEINFLRQ   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RLEPYADQLRT   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RLEQEIATYRS   
A3693CKB, CKBBCreatine kinase B-typeP12277RLEQGQAIDDLMPAQK  modifications: 1Met-ox
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RLESGMQNMSIHTKT  modifications: 2Met-ox
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RLFDQAFGLPRL   
A5959CA1Carbonic anhydrase 1P00915RLFQFHFHWGSTNEHGSEHTVDGVKY   
A3693CKB, CKBBCreatine kinase B-typeP12277RLGFSEVELVQMVVDGVKL  modifications: 1Met-ox
A6935LYZ, LZMLysozyme C precursorP61626RLGMDGYRG  modifications: 1Met-ox
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009RLGMFNIQHCKK  modifications: 1Met-ox
A4577ANXA7, ANX7, SNXAnnexin A7P20073RLGTDESCFNMILATRS   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RLGTDESCFNMILATRS  modifications: 1Met-ox
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RLHFFMPGFAPLTSRG  modifications: 1Met-ox
A021CHPXHemopexin precursorP02790RLHIMAGRR  modifications: 1Met-ox
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RLIGDAAKNQVALNPQNTVFDAKR   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RLILADALCYAHTFNPKV   
A0492STIP1Stress-induced-phosphoprotein 1P31948RLILEQMQKD  modifications: 1Met-ox
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RLIQEQEQELVGALAADLHKN   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RLISQIVSSITASLRF   
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialP30044RLLADPTGAFGKE   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RLLEDGEDFNLGDALDSSNSMQTIQKT  modifications: 1Met-ox
A1742HBB, beta-globinHemoglobin beta chainP68871RLLGNVLVCVLAHHFGKE   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RLLKEYQELMNVKL  modifications: 1Met-ox
A4577ANXA7, ANX7, SNXAnnexin A7P20073RLLVSMCQGNRD  modifications: 1Met-ox
A1742HBB, beta-globinHemoglobin beta chainP68871RLLVVYPWTQRF   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RLNFSHGTHEYHAETIKN   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RLPDIFEAQIAGLRG   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RLSEDYGVLKT   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RLSKEEIERM   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RLSVDYGKK   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RLSVDYGKK   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RLSVDYGKK   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RLTGQLFLGGSIVKG   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RLTPEEIERM   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RLTPYADEFKV   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702RLTWASHEKM   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RLVLEVAQHLGESTVRT   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RLVNHFVEEFKR   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RLVNHFVEEFKRK   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RLVQAFQFTDKH   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RLVRPEVDVMCTAFHDNEETFLKK  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RLVRPEVDVMCTAFHDNEETFLKK  modifications: 1Met-ox;1Cys-am
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RLVRPEVDVMCTAFHDNEETFLKKY  modifications: 1Met-ox
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RLVSLTLNLVTRA   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RLYDSMKG  modifications: 1Met-ox
A4577ANXA7, ANX7, SNXAnnexin A7P20073RLYQAGEGRL   
A813DBPIFA1, LUNX, NASGProtein Plunc precursorQ9NP55RLYVTIPLGIKL   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905RMFLSFPTTKT   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905RMFLSFPTTKT  modifications: 1Met-ox
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211RMLLADQGQSWKE   
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211RMLLADQGQSWKE  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RMPCAEDYLSVVLNQLCVLHEKT   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RMPLFEHYTRQ   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RMPLFEHYTRQ  modifications: 1Met-ox
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RMQHLIARE  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RMSVEADINGLRR  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RMSVEADINGLRRV  modifications: 1Met-ox
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RMVNHFIAEFKR  modifications: 1Met-ox
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930RNALVSHLDGTTPVCEDIGRS  modifications: 1Cys-am
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RNECFLQHKD   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RNECFLQHKDDNPNLPRL   
A0432PRDX6, AOP2Peroxiredoxin 6P30041RNFDEILRV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RNGSDCPDKFCLFQSETKN   
A9811CAPSCalcyphosinQ13938RNGSGTLDLEEFLRA   
A1551S100A9, CAGB, CFAGProtein S100-A9P06702RNIETIINTFHQYSVKL   
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874RNILGGTVFRE   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RNLDIERPTYTNLNRL   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RNLDIERPTYTNLNRL   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RNLDIERPTYTNLNRL   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RNLDIERPTYTNLNRL   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RNLPLPPPPPPRG   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RNTDEMVELRILLQSKN  modifications: 1Met-ox
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RNTGIICTIGPASRS   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RNTKQEIAEINRM   
A8385ANXA3, ANX3Annexin A3P12429RNTPAFLAERL   
A8385ANXA3, ANX3Annexin A3P12429RNTPAFLAERLHRA   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RPLPPAAIESPAVAAPAYSRA   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RQAFQIGSPWRT  modifications: pyroGlu
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RQAFQIGSPWRT   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RQAQEYEALLNIKV   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RQAVTNPNNTFYATKR  modifications: pyroGlu
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RQDEHGYISRC  modifications: pyroGlu
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RQDEHGYISRC   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RQDIAFAYQRR  modifications: pyroGlu
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RQDIAFAYQRR   
A021CHPXHemopexin precursorP02790RQGHNSVFLIKG   
A1552APOA1, A175PApolipoprotein A-I precursorP02647RQGLLPVLESFKV   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RQIGVEHVVVYVNKA   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RQITVNDLPVGRS  modifications: pyroGlu
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RQITVNDLPVGRS   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RQITVNDLPVGRS  modifications: pyroGlu
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RQITVNDLPVGRS   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RQLDSIVGERG  modifications: pyroGlu
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RQLDSIVGERG   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RQLETLGQEKL   
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RQLFHPEQLITGKE  modifications: pyroGlu
A5179TUBA1B, TUBA1, K-ALPHA-1Tubulin alpha-1 chainP68363RQLFHPEQLITGKE   
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RQLFHPEQLITGKE  modifications: pyroGlu
A5180TUBA1C, TUBA6Tubulin alpha-1C chainQ9BQE3RQLFHPEQLITGKE   
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RQLFHPEQLITGKE  modifications: pyroGlu
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainP68366RQLFHPEQLITGKE   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RQLFHPEQLITGKE  modifications: pyroGlu
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RQLFHPEQLITGKE   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RQLMETPANEMTPTRF  modifications: 2Met-ox
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RQLTPYAQRM   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RQLYEEEIRE  modifications: pyroGlu
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RQLYEEEIRE   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RQMAEIAVNAVLTVADMERR  modifications: 2Met-ox
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RQNLEPLFEQYINNLRR   
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RQNLEPLFEQYINNLRRQ   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RQNQEYQRL  modifications: pyroGlu
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RQNQEYQRL   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RQPMILEKGQRF   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RQSSATSSFGGLGGGSVRF  modifications: pyroGlu
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RQSSATSSFGGLGGGSVRF   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RQSVENDIHGLRK  modifications: pyroGlu
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RQSVENDIHGLRK   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RQTNPSAMEVEEDDPVPEIRR  modifications: 1Met-ox
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RQVKEMNPALGIDCLHKG  modifications: pyroGlu
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RQVKEMNPALGIDCLHKG  modifications: pyroGlu;1Cys-am
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371RQVLLSAAEAAEVILRV  modifications: pyroGlu
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371RQVLLSAAEAAEVILRV   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RQYDISDPQRPRL   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RQYTSFHFASLEDVQAKV   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RRAEDGSVIDYELIDQDARD   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RRDVDFELIKV   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RREAVCIVLSDDTCSDEKI  modifications: 2Cys-am
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RRFDDAVVQSDMKH  modifications: 1Met-ox
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RRFDEILEASDGIMVARG  modifications: 1Met-ox
A9811CAPSCalcyphosinQ13938RRFLDNFDSSEKD   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RRGVMLAVDAVIAELKK  modifications: 1Met-ox
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RRHPDYSVVLLLRL   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RRHPYFYAPELLFFAKR   
A0433TPI1, TPI, TIMTriosephosphate isomerase 1P60174RRHVFGESDELIGQKV   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930RRIPLAEWESRI   
A3205TPM3Tropomyosin alpha 3 chainP06753RRIQLVEEELDRA   
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2P32119RRLSEDYGVLKT   
A5185TUBA8, TUBAL2Tubulin alpha-8 chainQ9NY65RRNLDIERPTYTNLNRL   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RRPCFSALEVDETYVPKE   
A1581ALB, GIG20, GIG42Serum albumin precursorP02768RRPCFSALEVDETYVPKE  modifications: 1Cys-am
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RRQLETLGQEKL   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RRSDTSLTWNSVKG   
A9149GCVitamin D-binding protein precursorP02774RRTHLPEVFLSKV   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RRVEPYGENFNKA   
A643CTF, PRO1400Serotransferrin precursorP02787RSAGWNIPIGLLYCDLPEPRK   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RSAHQVARY   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RSAYGGPVGAGIRE   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RSCHLAMAPNHAVVSRM  modifications: 1Met-ox
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RSCLVRPLMNDEGLKV  modifications: 1Cys-am
A9149GCVitamin D-binding protein precursorP02774RSDFASNCCSINSPPLYCDSEIDAELKNIL   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RSDTSGHFERL   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RSDTSGHFERLLVSMCQGNRD  modifications: 1Met-ox
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicO75874RSDYLNTFEFMDKL  modifications: 1Met-ox
A0647ANXA1, ANX1, LPC1Annexin A1P04083RSEDFGVNEDLADSDARA   
A8385ANXA3, ANX3Annexin A3P12429RSEIDLLDIRT   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RSEIDLVQIKQMFAQMYQKT   
A0647ANXA1, ANX1, LPC1Annexin A1P04083RSEIDMNDIKA  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RSEVTDLRRT   
A9811CAPSCalcyphosinQ13938RSGDGVVTVDDLRG   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RSGETEDTFIADLVVGLCTGQIKT   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RSGETEDTFIADLVVGLCTGQIKT  modifications: 1Cys-am
A9811CAPSCalcyphosinQ13938RSGEWTEDEVLRR   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RSGNVHHQFQKL   
A9811CAPSCalcyphosinQ13938RSLDADEFRQ   
A9811CAPSCalcyphosinQ13938RSLDADEFRQGLAKL   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RSLDLDGIIAEVKAQYEEMAKC  modifications: 1Met-ox
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RSLDMDSIIAEVKA  modifications: 1Met-ox
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RSLEEAIQFINQRE   
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RSLHDALCVIRN   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RSLLEGQEDHYNNLSASKV   
A5959CA1Carbonic anhydrase 1P00915RSLLSNVEGDNAVPMQHNNRPTQPLKG   
A5959CA1Carbonic anhydrase 1P00915RSLLSNVEGDNAVPMQHNNRPTQPLKG  modifications: 1Met-ox
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RSNLCALCIGDEQGENKC   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RSNLCALCIGDEQGENKC  modifications: 1Cys-am
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RSNMDNMFESYINNLRR  modifications: 2Met-ox
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RSPAQILLRW   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RSQYEVMAEQNRK  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RSQYEVMAEQNRKD  modifications: 1Met-ox
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RSRAEAESMYQIKY  modifications: 1Met-ox
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AP48667RSRAEAESWYQTKY   
A8272IGJ, IGCJImmunoglobulin J chainP01591RSSEDPNEDIVERN   
A6935LYZ, LZMLysozyme C precursorP61626RSTDYGIFQINSRY   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RSTFSTNYRS   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RSTLEPVEKA   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RSVDETLRL   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RSYDVPPPPMEPDHPFYSNISKD  modifications: 1Met-ox
A0647ANXA1, ANX1, LPC1Annexin A1P04083RSYPQLRR   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RSYTSGPGSRI   
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729RTAAENEFVVLKK   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RTADGIVSHLKK   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RTALLDAAGVASLLTTAEVVVTEIPKE   
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeP14618RTATESFASDPILYRPVAVALDTKG   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RTDLEMQIEGLKEELAYLKK  modifications: 1Met-ox
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RTDYNASVSVPDSSGPERI   
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorP30101RTEEEFKK   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RTEELNRE   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RTEMENEFVLIKK  modifications: 1Met-ox
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299RTETVQKL   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RTFYGLHQDFPSVVLVGLGKK   
A1552APOA1, A175PApolipoprotein A-I precursorP02647RTHLAPYSDELRQ   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RTHYYAVAVVKK   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RTIAMDGTEGLVRG   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RTIAMDGTEGLVRG  modifications: 1Met-ox
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RTIAQDYGVLKA   
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1Q06830RTIAQDYGVLKADEGISFRG   
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RTIPIDGNFFTYTRH   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RTKFETEQALRM   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RTKTEISEMNRN  modifications: 1Met-ox
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PP09211RTLGLYGKD   
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseP28838RTLIEFLLRF   
A0492STIP1Stress-induced-phosphoprotein 1P31948RTLLSDPTYRE   
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorP01009RTLNQPDSQLQLTTGNGLFLSEGLKL   
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RTLQGLEIELQSQLSMKA  modifications: 1Met-ox
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RTLSSSTQASIEIDSLYEGIDFYTSITRA   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441RTLVVHEKA   
A7842SOD1Superoxide dismutase [Cu-Zn]P00441RTLVVHEKADDLGKG   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RTMGMVDIFNGDADLSGMTGSRG   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RTMGMVDIFNGDADLSGMTGSRG  modifications: 1Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RTMGMVDIFNGDADLSGMTGSRG  modifications: 2Met-ox
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKA  modifications: 3Met-ox
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RTNQELQEINRV   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RTRPLQFRF   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL  modifications: 1Met-ox
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL  modifications: 1Met-ox
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RTTPSVVAFTADGERL   
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinP11142RTTPSYVAFTDTERL   
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1P08107RTTPSYVAFTDTERL   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RTVIIEQSWGSPKV   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RTVQSLEIDLDSMRN   
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RTVQSLEIDLDSMRN  modifications: 1Met-ox
A1322PIGRPolymeric immunoglobulin receptor precursorP01833RTVTINCPFKT   
A370ATUFMElongation factor Tu, mitochondrial precursorP49411RTVVTGIEMFHKS  modifications: 1Met-ox
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RTWNDPSVQQDIKF   
A0492STIP1Stress-induced-phosphoprotein 1P31948RTYEEGLKHEANNPQLKE   
A463CSELENBP1, SBPSelenium-binding protein 1Q13228RVAGGPQMIQLSLDGKR  modifications: 1Met-ox
A3543CCT5, CCTE, PNAS-102T-complex protein 1, epsilon subunitP48643RVAIEHLDKI   
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorP06576RVALTGLTVAEYFRD   
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1P60709RVAPEEHPVLLTEAPLNPKA   
A4552ACTG1, ACTGActin, cytoplasmic 2P63261RVAPEEHPVLLTEAPLNPKA   
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorP31930RVASEQSSQPTCTVGVWIDVGSRF   
A0432PRDX6, AOP2Peroxiredoxin 6P30041RVATPVDWKD   
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1P29508RVDLHLPRF   
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905RVDPVNFKL   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RVEAVNMAEGIIHDTETKM  modifications: 1Met-ox
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RVEIIANDQGNRI   
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorP06727RVEPYGENFNKA   
A1531KRT8, CYK8Keratin, type II cytoskeletal 8P05787RVGSSNFRG   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406RVIISAPSADAPMFVMGVNHEKY   
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorP38646RVINEPTAAALAYGLDKS   
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RVINQILTEMDGMSTKKN  modifications: 1Met-ox
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727RVLDELTLART   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RVLIAAHGNSLRG   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RVLIEILCTRT   
A4577ANXA7, ANX7, SNXAnnexin A7P20073RVLIEILCTRT  modifications: 1Cys-am
A3793PHBProhibitinP35232RVLPSITTEILKS   
A0451HSPA5, GRP78Heat shock 70kDa protein 5P11021RVMEHFIKLYKK   
A5762ALDH3A1, ALDH3Aldehyde dehydrogenase, dimeric NADP-preferringP30838RVMGLIEGQKV  modifications: 1Met-ox
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RVPFSLLRG   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RVPSHAVVARS   
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseP04406RVPTANVSVVDLTCRL   
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitP78371RVQDDEVGDGTTSVTVLAAELLRE   
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1P04792RVSLDVNHFAPDELTVKT   
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorP10809RVTDALNATRA   
A0432PRDX6, AOP2Peroxiredoxin 6P30041RVVFVFGPDKK   
A0432PRDX6, AOP2Peroxiredoxin 6P30041RVVISLQLTAEKR   
A0717HNRNPK, HNRPKHeterogeneous nuclear ribonucleoprotein KP61978RVVLIGGKPDRV   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RVVWCAVGEQELRK   
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355RVYKEMYKT  modifications: 1Met-ox
A3918VCPTransitional endoplasmic reticulum ATPaseP55072RWALSQSNPSALRE   
A643CTF, PRO1400Serotransferrin precursorP02787RWCAVSEHEATKC   
A1949GSTA1, GST2Glutathione S-transferase A1P08263RWLLAAAGVEFEEKF   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RWQVQRK   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RYADLTEDQLPSCESLKD   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RYADLTEDQLPSCESLKD  modifications: 1Cys-am
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RYADLTEDQLPSCESLKDTIARA   
A7363PGAM1, PGAMAPhosphoglycerate mutase 1P18669RYADLTEDQLPSCESLKDTIARA  modifications: 1Cys-am
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18P05783RYALQMEQLNGILLHLESELAQTRA  modifications: 1Met-ox
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352RYCAGWADKI   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseQ05524RYISPDQLADLYKG   
A3615ENO1, ENO1L1, MBPB1Alpha enolaseP06733RYISPDQLADLYKS   
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]P14550RYIVPMLTVDGKR  modifications: 1Met-ox
A1587SLPI, WAP4, WFDC4Antileukoproteinase 1 precursorP03973RYKKPECQSDWQ    
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1O00299RYLSNAYARE   
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainP68371RYLTVAAVFRG   
A6935LYZ, LZMLysozyme C precursorP61626RYWCNDGKT   
A6935LYZ, LZMLysozyme C precursorP61626RYWCNDGKT  modifications: 1Cys-am
A021CHPXHemopexin precursorP02790RYYCFQGNQFLRF   
A1712LTF, LF, GIG12Lactotransferrin precursorP02788RYYGYTGAFRC   
A1587SLPI, WAP4, WFDC4Antileukoproteinase 1 precursorP03973SGKSFKAGV    
A3848KRT7, SCLKeratin, type II cytoskeletal 7P08729SIHFSSPVFTSRS  modifications: AcetN
A2403PRB1, PRB1L, PRB1MBasic Salivary proline-rich protein 1 precursorP02811SPPGKQGPPP    
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1P00352SSSGTPDLPVLLTDLKI  modifications: AcetN
A1071PTPN13, PNP1, PTP1EProtein tyrosine phosphatase, non-receptor type 13Q12923SSVNTSNKMNFK    
A0537ANXA2, ANX2, ANX2L4Annexin A2P07355STVHEILCKL  modifications: AcetN
A3787KRT19, K19Keratin, type I cytoskeletal 19P08727TSYSYRQ  modifications: AcetN
A9190OBP2AOdorant-binding protein 2a precursorQ9NY56;Q9NPH6TWYVKAMVVDKD    
A1742HBB, beta-globinHemoglobin beta chainP68871VHLTPEEKSAV    
A1741HBA1, HBA2, HBZHemoglobin subunit alphaP69905VLSPADKTNVK    
A427BEMP2, XMPEpithelial membrane protein-2P54851WWVGDEFFADVW    

Compile date 12-23-2014© PADB initiative