PADB-logoLSSR - PepMap molecular information by study

Study ID 16948836
Species human
Disease healthy
Tissue / Source urine
Compartment whole

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseIPI00014439AAAAAAGEAR1 (delta mass [ppm])2 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseIPI00014439AAAAAAGEAR0.2 (delta mass [ppm])2 
A1164IPO5, KPNB3, RANBP5Importin 5IPI00329200AAAAAEQQQFYLLLGNLLSPDNVVR0.3 (delta mass [ppm])3 
A3698CYC1Cytochrome c1, heme protein, mitochondrialIPI00029264AAAAASLR3.8 (delta mass [ppm])2 
A8776FBXO28F-box only protein 28IPI00008542AAAAEER1.6 (delta mass [ppm])2 
A9482SORT1Sortilin 1IPI00217882AAAAGGAFPR0.3 (delta mass [ppm])2 
A9482SORT1Sortilin 1IPI00217882AAAAGGAFPR0.2 (delta mass [ppm])2 
A6321SORD, SORDLSorbitol dehydrogenaseIPI00216057AAAAKPNNLSLVVHGPGDLR0.7 (delta mass [ppm])3 
A6321SORD, SORDLSorbitol dehydrogenaseIPI00216057AAAAKPNNLSLVVHGPGDLR1 (delta mass [ppm])3 
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinIPI00465085AAAAQFQVPWLESVLIVVSNNIDEEALAR3.9 (delta mass [ppm])3 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR1.5 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR1.3 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR1.4 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR0.9 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR0.5 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR2 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR0.3 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR0.9 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR3.9 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR1.7 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AAAATGTIFTFR1.2 (delta mass [ppm])2 
A720CZFPL1Zinc-finger protein-like 1IPI00296374AAADSDPNLDPLMNPHIR0.5 (delta mass [ppm])3 
A720CZFPL1Zinc-finger protein-like 1IPI00296374AAADSDPNLDPLMNPHIR0.2 (delta mass [ppm])3 
A5173TACC2Transforming acidic coiled-coil-containing protein 2IPI00410127AAAFQVAPHSHGEEAVAQDR4 (delta mass [ppm])3 
A5300CRB2CRUMBS protein homolog 2 precursorIPI00410585AAAGALEGVWLAVR0.5 (delta mass [ppm])2 
A317CRAB21Ras-related protein Rab-21IPI00007755AAAGGGGGGAAAAGR0.5 (delta mass [ppm])2 
A7135NDST1, HSST, HSST1Bifunctional heparan sulfate N-deacetylase/N sulfotransferase 1IPI00005599AAALLPK1.7 (delta mass [ppm])2 
A157E Hypothetical proteinIPI00015506AAALPTR1.6 (delta mass [ppm])2 
A7357PEPD, PRDXaa-Pro dipeptidaseIPI00257882AAATGPSFWLGNETLK1.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AAAVSEAEADFYEQNSR0.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AAAVSEAEADFYEQNSR1.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AAAVSEAEADFYEQNSR1.9 (delta mass [ppm])2 
A1298PGLS6-phosphogluconolactonaseIPI00029997AACCLAGAR1.4 (delta mass [ppm])2 
A1298PGLS6-phosphogluconolactonaseIPI00029997AACCLAGAR0.8 (delta mass [ppm])2 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AACGPSSCYALFPR1 (delta mass [ppm])2 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AACGPSSCYALFPR1.5 (delta mass [ppm])2 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AACGPSSCYALFPR1.2 (delta mass [ppm])2 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AACGPSSCYALFPR2.5 (delta mass [ppm])2 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AACGPSSCYALFPR3.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK1.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK0 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK1.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK2.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK1.4 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK1.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK3.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPKLDELR0.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AACLLPKLDELRDEGK2.8 (delta mass [ppm])3 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK0.7 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK2.4 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK0.1 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK0.5 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK1 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK3.5 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK1.1 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432AADDTWEPFASGK1.2 (delta mass [ppm])2 
A8446PCSK1NPROSAAS precursorIPI00002280AADHDVGSELPPEGVLGALLR2 (delta mass [ppm])3 
A9481SORL1Sortilin-related receptor precursorIPI00022608AADLLLHSK0.3 (delta mass [ppm])2 
A9481SORL1Sortilin-related receptor precursorIPI00022608AADLLLHSK0.6 (delta mass [ppm])2 
A9481SORL1Sortilin-related receptor precursorIPI00022608AADLLLHSK0.9 (delta mass [ppm])2 
A2469ENPP2, PDNP2, ATXEctonucleotide pyrophosphatase/phosphodiesterase family member 2IPI00156171AAECPAGFVRPPLIIFSVDGFR0.1 (delta mass [ppm])3 
A2469ENPP2, PDNP2, ATXEctonucleotide pyrophosphatase/phosphodiesterase family member 2IPI00156171AAECPAGFVRPPLIIFSVDGFR0.6 (delta mass [ppm])3 
A1585NID1, NIDNidogen-1IPI00384542AAECVHR0 (delta mass [ppm])2 
A1585NID1, NIDNidogen-1IPI00384542AAECVHR2.7 (delta mass [ppm])2 
A1585NID1, NIDNidogen-1IPI00384542AAECVHR0.4 (delta mass [ppm])2 
A1423COL6A3Collagen alpha 3(VI) chain precursorIPI00220701AAEGIPK3.3 (delta mass [ppm])2 
A1141NOTCH1, TAN1Neurogenic locus notch homolog protein 1IPI00412982AAEGWAAPDALLGQVK1.7 (delta mass [ppm])2 
A1141NOTCH1, TAN1Neurogenic locus notch homolog protein 1IPI00412982AAEGWAAPDALLGQVK0.2 (delta mass [ppm])2 
A6950MAN2A1, MANA2Alpha-mannosidase IIIPI00003802AAEILYYFALR2.1 (delta mass [ppm])2 
A9744RAPSN, RNF205 43 kDa receptor-associated protein of the synapseIPI00013319AAELVNNYGK2.9 (delta mass [ppm])2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AAFDDAIAELDTLSEESYK0.9 (delta mass [ppm])2 
A0280YWHAE14-3-3 protein epsilonIPI00000816AAFDDAIAELDTLSEESYK0.7 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AAFGQGSGPIMLDEVQCTGTEASLADCK2.7 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AAFGQGSGPIMLDEVQCTGTEASLADCK0.2 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AAFGQGSGPIMLDEVQCTGTEASLADCK0.8 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AAFGQGSGPIMLDEVQCTGTEASLADCK0.6 (delta mass [ppm])2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018AAFNSGK0.3 (delta mass [ppm])2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663AAFQLGSPWR2.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK2.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK1.7 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK4.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK0.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK1.4 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADK2.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADKAACLLPK1.8 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AAFTECCQAADKAACLLPK4.5 (delta mass [ppm])3 
A825BAQP2Aquaporin-CDIPI00012818AAFYVAAQLLGAVAGAALLHEITPADIR1.2 (delta mass [ppm])3 
A825BAQP2Aquaporin-CDIPI00012818AAFYVAAQLLGAVAGAALLHEITPADIR2.3 (delta mass [ppm])3 
A825BAQP2Aquaporin-CDIPI00012818AAFYVAAQLLGAVAGAALLHEITPADIR0.2 (delta mass [ppm])3 
A825BAQP2Aquaporin-CDIPI00012818AAFYVAAQLLGAVAGAALLHEITPADIR2.4 (delta mass [ppm])3 
A825BAQP2Aquaporin-CDIPI00012818AAFYVAAQLLGAVAGAALLHEITPADIR1.3 (delta mass [ppm])3 
A6055CHPT1, CPT1, MSTP022Cholinephosphotransferase 1IPI00329548AAGAGAGSAPR1.4 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAGCDFTNVVK0.2 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAGCDFTNVVK2.7 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAGCDFTNVVK3.6 (delta mass [ppm])2 
A9445PGRMC2, DG6, PMBPMembrane associated progesterone receptor component 2IPI00005202AAGDGDVK0.1 (delta mass [ppm])1 
A013CSLC2A5, GLUT5Solute carrier family 2 (facilitated glucose/fructose transporter), member 5IPI00027452AAGFISVLK0.9 (delta mass [ppm])2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGAVCEQPLGLECR0.1 (delta mass [ppm])2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAGGHLCQQPK0.9 (delta mass [ppm])2 
A3792HNRNPM, HNRPM, NAGR1Heterogeneous nuclear ribonucleoprotein MIPI00171903AAGVEAAAEVAATEIK0.7 (delta mass [ppm])2 
A3884NCAM1, NCAMNeural cell adhesion molecule 1, 120/140 kDa isoform precursorIPI00185362AAHFVFR1.8 (delta mass [ppm])2 
A9385LILRB4, ILT3, LIR5Leukocyte immunoglobulin-like receptor subfamily B member 4IPI00289926AAHPLLHLR1.2 (delta mass [ppm])3 
A5817APRTAdenine phosphoribosyltransferaseIPI00218693AAIGLLAR0.5 (delta mass [ppm])2 
A2629SDK1Protein sidekick-1IPI00383951AAILNLLPITSYPR2.4 (delta mass [ppm])2 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AAINTYCSLAACVLTSVAISSALHK1.1 (delta mass [ppm])3 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AAINTYCSLAACVLTSVAISSALHK1.5 (delta mass [ppm])3 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AAINTYCSLAACVLTSVAISSALHK3 (delta mass [ppm])4 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AAINTYCSLAACVLTSVAISSALHK0.7 (delta mass [ppm])3 
A8431ITIH1, IGHEP1, PRO2769Inter-alpha (globulin) inhibitor H1IPI00292530AAISGENAGLVR1.3 (delta mass [ppm])2 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901AAIVEKLSSLPFQK2.5 (delta mass [ppm])2 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901AAIVEKLSSLPFQK1.9 (delta mass [ppm])2 
A7716RNF13, RZFE3 ubiquitin-protein ligase RNF13IPI00151036AAIVHNVDSDDLISMGSNDIEVLK0.8 (delta mass [ppm])3 
A7716RNF13, RZFE3 ubiquitin-protein ligase RNF13IPI00151036AAIVHNVDSDDLISMGSNDIEVLK0.6 (delta mass [ppm])3 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AALACSK1.7 (delta mass [ppm])1 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AALACSK1 (delta mass [ppm])2 
A2448FBXO15, FBX15F-box only protein 15IPI00168421AALADILK0.8 (delta mass [ppm])2 
A706CVTA1, HSPC228, My012Vacuolar protein sorting-associaterd protein VTA1 homologIPI00017160AALAPLPPLPAQFK0.1 (delta mass [ppm])2 
A706CVTA1, HSPC228, My012Vacuolar protein sorting-associaterd protein VTA1 homologIPI00017160AALAPLPPLPAQFK1.5 (delta mass [ppm])2 
A4817FLRT2, UNQ232/PRO265Leucine-rich repeat transmembrane protein FLRT2 precursorIPI00001633AALAQLLK0.3 (delta mass [ppm])2 
A6314QDPR, DHPR, HDHPRDihydropteridine reductaseIPI00014439AALDGTPGMIGYGMAK2.6 (delta mass [ppm])2 
A531DHEBP1, HBPHeme-binding protein 1IPI00148063AALEGTATYR0.9 (delta mass [ppm])2 
A635BRARRES1, TIG1Retinoic acid receptor responder protein 1IPI00410240AALHFFNFR0.1 (delta mass [ppm])2 
A635BRARRES1, TIG1Retinoic acid receptor responder protein 1IPI00410240AALHFFNFR0.8 (delta mass [ppm])2 
A2598SRRM2, SRL300, SRM300Serine/arginine repeptitive matrix protein 2IPI00099730AALLDGR0.9 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AALLTGR0.9 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AALLTGR1.1 (delta mass [ppm])2 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605AALLTGR0.1 (delta mass [ppm])2 
A8080TYMP, ECGF1Thymidine phosphorylase precursorIPI00292858AALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPK1 (delta mass [ppm])3 
A8080TYMP, ECGF1Thymidine phosphorylase precursorIPI00292858AALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPK1.6 (delta mass [ppm])3 
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50IPI00003527AALNAVR0.2 (delta mass [ppm])2 
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorIPI00437751AALPAQELEEYNK0.9 (delta mass [ppm])2 
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorIPI00437751AALPAQELEEYNK1.9 (delta mass [ppm])2 
A3415PAX7, HUP1, PAX7BPaired box protein 7IPI00004431AALPGTVPR0.7 (delta mass [ppm])2 
A870BCHMP4B, SHAX1, SNF7-2Charged multivesicular body protein 4BIPI00025974AALQALKR0 (delta mass [ppm])2 
A5026DCHS1, CDH19, CDH25Protocadherin 16 precursorIPI00064262AALQVPEHTAFGTR1.2 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK0.5 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK1.1 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK0.6 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK2.1 (delta mass [ppm])1 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK0.6 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK0.3 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK0.7 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AALSMCK1.6 (delta mass [ppm])2 
A020CHBM, HBAP2Hemoglobin subunit muIPI00456238AALSPLADLHALVLR0.6 (delta mass [ppm])2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654AALSYVSEIGK1.1 (delta mass [ppm])2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654AALSYVSEIGK1.7 (delta mass [ppm])2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00177728AALTTLFK1.8 (delta mass [ppm])1 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00177728AALTTLFK2.7 (delta mass [ppm])1 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00177728AALTTLFK1 (delta mass [ppm])2 
A8440LXN, MUMLatexin proteinIPI00106687AALVAQNYINYQQGTPHR2.3 (delta mass [ppm])3 
A989BFTL, FTLvariantFerritin light chainIPI00375676AAMALEK0.2 (delta mass [ppm])2 
A989BFTL, FTLvariantFerritin light chainIPI00375676AAMALEK0 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220AAMVGMLANFLGFR1.9 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220AAMVGMLANFLGFR2.3 (delta mass [ppm])2 
A4728CPXM2, UNQ676, UNQ676/PRO1310Inactive carboxypeptidase-like protein X2IPI00296558AANDDHSVR0.9 (delta mass [ppm])3 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1IPI00443898AANLIVLSLPVAR0.5 (delta mass [ppm])2 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1IPI00443898AANLIVLSLPVAR0.4 (delta mass [ppm])2 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1IPI00443898AANLIVLSLPVAR0.9 (delta mass [ppm])2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543AANMHAQIK1.3 (delta mass [ppm])2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543AANMHAQIK1 (delta mass [ppm])2 
A985ASATB2Special AT-rich sequence-binding protein 2IPI00010433AAPAEIDQR3 (delta mass [ppm])2 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR2 (delta mass [ppm])3 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR2.1 (delta mass [ppm])3 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR4 (delta mass [ppm])3 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR0.2 (delta mass [ppm])2 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR3.3 (delta mass [ppm])3 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR3.4 (delta mass [ppm])3 
A1298PGLS6-phosphogluconolactonaseIPI00029997AAPAPGLISVFSSSQELGAALAQLVAQR0.7 (delta mass [ppm])3 
A2164VGFNeurosecretory protein VGF precursorIPI00069058AAPAPTHVR0.2 (delta mass [ppm])2 
A2164VGFNeurosecretory protein VGF precursorIPI00069058AAPAPTHVR0.4 (delta mass [ppm])2 
A011AOXT, OTOxytocin-neurophysin 1 precursorIPI00000144AAPDLDVR0.4 (delta mass [ppm])2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AAPGQEPPEHMAELQR0.7 (delta mass [ppm])2 
A1423COL6A3Collagen alpha 3(VI) chain precursorIPI00220701AAPLQGMLPGLLAPLR2 (delta mass [ppm])2 
A1423COL6A3Collagen alpha 3(VI) chain precursorIPI00220701AAPLQGMLPGLLAPLR2.4 (delta mass [ppm])2 
A213ERNF113B, RNF161, ZNF183L1Zinc finger protein 183-like 1IPI00293832AAPPSPGR1.6 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386158AAPSVTLFPPSSEELQANK0.5 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK0.5 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK2.1 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK0.9 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK1.5 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK0.7 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK2.1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK0.1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK2.6 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK2.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANK1.5 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK2.8 (delta mass [ppm])4 
A6197CYP8B1, CYP127-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylaseIPI00009440AAPTLLR0.8 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR1 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR0.5 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR2.5 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR1.5 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR3.1 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AAQAAVASYNMGSNSIYYFR3.7 (delta mass [ppm])2 
A1675FBLN1, PP213Fibulin-1 precursorIPI00218803AAQAQGQSCEYSLMVGYQCGQVFR1.6 (delta mass [ppm])3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439AAQEEYVK0.7 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439AAQEEYVKR1.6 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR0.4 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR0.8 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR2.3 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR2.4 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR0.8 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR0.5 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085AAQGLLACGVAQGALR2.1 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AAQLPYDVQHADIDYMDER1 (delta mass [ppm])3 
A577DEFCAB14EF-hand domain-containing protein KIAA0494IPI00006130AAQLRPISLPGVSSTEDLQDLFR1.5 (delta mass [ppm])3 
A577DEFCAB14EF-hand domain-containing protein KIAA0494IPI00006130AAQLRPISLPGVSSTEDLQDLFRK1.8 (delta mass [ppm])3 
A4162MOCS1, MIG11Molybdenum cofactor biosynthesis protein 1 BIPI00232406AARPLSRMLR0.3 (delta mass [ppm])3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]IPI00220271AASCVLLHTGQK0.4 (delta mass [ppm])2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]IPI00220271AASCVLLHTGQK2.5 (delta mass [ppm])2 
A265ERSRC2, HSPC314Arginine/serine-rich coiled-coil 2IPI00419791AASDTER1.4 (delta mass [ppm])2 
A4734CLSTN1, CS1Calsyntenin-1 precursorIPI00007257AASEFESSEGVFLFPELR1.4 (delta mass [ppm])2 
A4575ANXA4, PIG28, ANX4Annexin A4IPI00221225AASGFNAMEDAQTLR1.8 (delta mass [ppm])2 
A4575ANXA4, PIG28, ANX4Annexin A4IPI00221225AASGFNAMEDAQTLR0.2 (delta mass [ppm])2 
A3950TOMM70A, TOM70Mitochondrial import receptor subunit TOM70IPI00015602AASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPR0.7 (delta mass [ppm])4 
A6365DPP7, DPP2, QPPDipeptidyl-peptidase 2IPI00296141AASNIIFSNGNLDPWAGGGIR2.4 (delta mass [ppm])2 
A6365DPP7, DPP2, QPPDipeptidyl-peptidase 2IPI00296141AASNIIFSNGNLDPWAGGGIR2.8 (delta mass [ppm])2 
A6004CPECarboxypeptidase E precursorIPI00031121AASQPGELK2.6 (delta mass [ppm])2 
A5647ABHD14B, CIBAlpha/beta hydrolase domain-containing protein 14BIPI00063827AASVEQR0.2 (delta mass [ppm])2 
A5647ABHD14B, CIBAlpha/beta hydrolase domain-containing protein 14BIPI00063827AASVEQR0.3 (delta mass [ppm])2 
A360AE2F8Transcription factor E2F8IPI00296318AASVNSR0.9 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK1.7 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK0 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK2.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK0.6 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK1 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK1.7 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGK2.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AATGECTATVGK1 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439AATGECTATVGK3.3 (delta mass [ppm])2 
A298ESEMG1, SEMGSemenogelin-1IPI00414684AATGECTATVGK2.8 (delta mass [ppm])2 
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1IPI00022204AATGECTATVGK1.5 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGKR1.9 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGKR0.4 (delta mass [ppm])3 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGKR1.7 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AATGECTATVGKR0.9 (delta mass [ppm])2 
A2401NOLC1, NS5ATP13Nucleolar phosphoprotein p130IPI00216654AATTPTR1.8 (delta mass [ppm])1 
A1176APOEApolipoprotein E precursorIPI00021842AATVGSLAGQPLQER1.3 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AATVGSLAGQPLQER2.2 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AATVGSLAGQPLQER1.1 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AATVGSLAGQPLQER0.9 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AATVGSLAGQPLQER0.6 (delta mass [ppm])2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00376838AAVALQRQR0.9 (delta mass [ppm])2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00376838AAVALQRQR2.7 (delta mass [ppm])2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00376838AAVALQRQR3.1 (delta mass [ppm])2 
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1IPI00645078AAVATFLQSVQVPEFTPK1.5 (delta mass [ppm])2 
A043CKPNB1, NTF97Importin beta-1 subunitIPI00001639AAVENLPTFLVELSR0.7 (delta mass [ppm])2 
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicIPI00104341AAVFDLDGVLALPAVFGVLGR1.6 (delta mass [ppm])3 
A0427PKLR, PK1, PKLPyruvate kinase, isozymes R/LIPI00027165AAVIAVTR2.4 (delta mass [ppm])2 
A3709BDH2, DHRS6, UNQ6308/PRO209333-hydroxybutyrate dehydrogenase type 2IPI00607799AAVIGLTK2.9 (delta mass [ppm])2 
A077CTMEM167B, AD-020Transmembrane protein 167BIPI00024521AAVIGTR0.3 (delta mass [ppm])2 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488AAVPAWEAVEMEIVAGQLVTEIR2.2 (delta mass [ppm])3 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488AAVPAWEAVEMEIVAGQLVTEIR1.6 (delta mass [ppm])3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR0.2 (delta mass [ppm])2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR2.7 (delta mass [ppm])2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AAVPSGASTGIYEALELR0.5 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AAVPSIK2.2 (delta mass [ppm])1 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AAVPSIK0.2 (delta mass [ppm])1 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AAVPSIK1.8 (delta mass [ppm])2 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605AAVVAATR2.6 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623AAVYHHFISDGVR1.4 (delta mass [ppm])3 
A1598C3, CPAMD1Complement C3 precursorIPI00164623AAVYHHFISDGVR0.2 (delta mass [ppm])3 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AAWPHFSWLLSQSER2.2 (delta mass [ppm])3 
A4298DNAJC17DNAJ homolog subfamily C member 17IPI00018798AAYDKVR1.1 (delta mass [ppm])2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AAYEDFNVQLR0.3 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918AAYLQETGKPLDETLK0.9 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918AAYLQETGKPLDETLKK1.8 (delta mass [ppm])2 
A4725COTL1, CLPCoactosin-like proteinIPI00017704AAYNLVR0.1 (delta mass [ppm])2 
A4725COTL1, CLPCoactosin-like proteinIPI00017704AAYNLVR0.7 (delta mass [ppm])2 
A4725COTL1, CLPCoactosin-like proteinIPI00017704AAYNLVR0.7 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAYQVAALPK0.9 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAYQVAALPK0.8 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038AAYQVAALPK0.3 (delta mass [ppm])2 
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1IPI00026268ACADATLSQITNNIDPVGR2.4 (delta mass [ppm])2 
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1IPI00026268ACADATLSQITNNIDPVGR0.7 (delta mass [ppm])2 
A548DIGFBP2, BP2, IBP2Insulin-like growth factor-binding protein 2IPI00297284ACAEFSFHVPSLEELAGVMQK4.7 (delta mass [ppm])3 
A9139UMODUromodulin precursorIPI00013945ACAHWSGHCCLWDASVQVK0.6 (delta mass [ppm])3 
A9139UMODUromodulin precursorIPI00013945ACAHWSGHCCLWDASVQVK2.2 (delta mass [ppm])3 
A9139UMODUromodulin precursorIPI00013945ACAHWSGHCCLWDASVQVK3.3 (delta mass [ppm])3 
A9139UMODUromodulin precursorIPI00013945ACAHWSGHCCLWDASVQVK3.2 (delta mass [ppm])3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ACANPAAGSVILLENLR2.4 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ACANPAAGSVILLENLR1.6 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ACANPAAGSVILLENLR1.7 (delta mass [ppm])2 
A725AMSL3P1, MSL3L2Putative Male-specific lethal-3 protein-like 2IPI00419519ACAVGSVAR0.2 (delta mass [ppm])2 
A725AMSL3P1, MSL3L2Putative Male-specific lethal-3 protein-like 2IPI00419519ACAVGSVAR1.5 (delta mass [ppm])2 
A9694CILP, UNQ602/PRO1188, UNQ602Cartilage intermediate layer protein 1IPI00289275ACEEAPPSAAHFR0.5 (delta mass [ppm])3 
A1598C3, CPAMD1Complement C3 precursorIPI00164623ACEPGVDYVYK1.4 (delta mass [ppm])2 
A1624C7Complement component C7 precursorIPI00296608ACGACPLWGK0.4 (delta mass [ppm])2 
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2IPI00003348ACGDSTLTQITAGLDPVGR2.2 (delta mass [ppm])2 
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2IPI00003348ACGDSTLTQITAGLDPVGR2.1 (delta mass [ppm])2 
A002AMYOF, FER1L3MyoferlinIPI00021048ACGDVLVTAELILR2.7 (delta mass [ppm])3 
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologIPI00156689ACGLNFADLMAR0 (delta mass [ppm])2 
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologIPI00156689ACGLNFADLMAR0.5 (delta mass [ppm])2 
A7674RETSAT, PPSIG, UNQ439/PRO872All-trans-retinol 13,14-reductase precursorIPI00296157ACGVSVK0.5 (delta mass [ppm])2 
A296CPTTG1IPPituitary tumor-transforming gene 1 protein-interacting proteinIPI00023974ACLDYPVTSVLPPASLCK1 (delta mass [ppm])2 
A0536S100A6, CACYCalcyclinIPI00027463ACPLDQAIGLLVAIFHK3.7 (delta mass [ppm])2 
A0536S100A6, CACYCalcyclinIPI00027463ACPLDQAIGLLVAIFHK0.5 (delta mass [ppm])2 
A1558EPHB6Ephrin type-B receptor 6 precursorIPI00005222ACSSLGVSGGTCR0.6 (delta mass [ppm])2 
A4679CHL1, CALLNeural cell adhesion molecule L1-like proteinIPI00299059ACTSQGCGKPITEESSTLGEGSK2.3 (delta mass [ppm])3 
A5232THBS2, TSP2Thrombospondin 2 precursorIPI00018769ACVGDVQER0.1 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ADAAPDEK0.5 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143ADAAPDEK1 (delta mass [ppm])2 
A4576ANXA5, ANX5, ENX2Annexin A5IPI00329801ADAETLR0.6 (delta mass [ppm])2 
A9695CILP2, CLIP-2Cartilage intermediate layer protein 2 precursorIPI00216780ADAGTAVTFQCR0.9 (delta mass [ppm])2 
A669CVAMP2, SYB2Vesicle-associated membrane protein 2IPI00477183ADALQAGASQFETSAAK1.9 (delta mass [ppm])2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860ADAVTLDGGFIYEAGLAPYK0.5 (delta mass [ppm])2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860ADAVTLDGGFIYEAGLAPYK0.1 (delta mass [ppm])2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860ADAVTLDGGFIYEAGLAPYK1.8 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ADDGRPFPQVIK2.2 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ADDGRPFPQVIK1.3 (delta mass [ppm])3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ADDGRPFPQVIK1.6 (delta mass [ppm])3 
A1080COL18A1, MFPCollagen alpha 1(XVIII) chain precursorIPI00022822ADDILASPPR0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK0.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK1.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK0.3 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK1.1 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK1.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK1.1 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK1.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGK2.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.5 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK1.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK1.9 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.8 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.7 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK1.1 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.9 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK3.5 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK3.9 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADDKETCFAEEGKK0.4 (delta mass [ppm])3 
A7842SOD1Superoxide dismutase [Cu-Zn]IPI00218733ADDLGKGGNEESTK1 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00426007ADDTAVYYCAR2.7 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00426007ADDTAVYYCAR0.9 (delta mass [ppm])2 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901ADEDPIMGFHQMFLLK0.6 (delta mass [ppm])3 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901ADEDPIMGFHQMFLLK1.4 (delta mass [ppm])3 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901ADEDPIMGFHQMFLLK0.3 (delta mass [ppm])3 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901ADEDPIMGFHQMFLLK1.3 (delta mass [ppm])3 
A4067BORAProtein Aurora borealisIPI00015697ADEFADQSPGNLSSSSLR3 (delta mass [ppm])2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ADEGISFR0.2 (delta mass [ppm])2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ADEGISFR1.8 (delta mass [ppm])2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ADEGISFR1.2 (delta mass [ppm])2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573ADEGWYWCGVK0.2 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143ADEGWYWCGVK2 (delta mass [ppm])2 
A9139UMODUromodulin precursorIPI00013945ADEGWYWCGVK1.8 (delta mass [ppm])2 
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorIPI00016862ADFDNTVAIHPTSSEELVTLR0.8 (delta mass [ppm])3 
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorIPI00016862ADFDNTVAIHPTSSEELVTLR1.2 (delta mass [ppm])3 
A5925GUSB, F8Beta-glucuronidase precursorIPI00027745ADFSDNR0.2 (delta mass [ppm])2 
A5925GUSB, F8Beta-glucuronidase precursorIPI00027745ADFSDNR0.2 (delta mass [ppm])2 
A5925GUSB, F8Beta-glucuronidase precursorIPI00027745ADFSDNRR0.7 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00032179ADGESCSASMMYQEGK0.9 (delta mass [ppm])2 
A2268MFAP4Microfibril-associated glycoprotein 4 precursorIPI00022792ADGEYWLGLQNMHLLTLK1.5 (delta mass [ppm])3 
A2268MFAP4Microfibril-associated glycoprotein 4 precursorIPI00022792ADGEYWLGLQNMHLLTLK0.6 (delta mass [ppm])3 
A2268MFAP4Microfibril-associated glycoprotein 4 precursorIPI00022792ADGEYWLGLQNMHLLTLK2.5 (delta mass [ppm])3 
A1502THBD, THRMThrombomodulin precursorIPI00010737ADGFLCEFHFPATCR3.4 (delta mass [ppm])3 
A1502THBD, THRMThrombomodulin precursorIPI00010737ADGFLCEFHFPATCR0.2 (delta mass [ppm])3 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ADGGEMTVIR0.2 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ADGGEMTVIR2 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ADGGEMTVIR0.6 (delta mass [ppm])2 
A5959CA1Carbonic anhydrase 1IPI00215983ADGLAVIGVLMK0.3 (delta mass [ppm])2 
A5959CA1Carbonic anhydrase 1IPI00215983ADGLAVIGVLMK1.8 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095ADGSPVK1 (delta mass [ppm])2 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163ADGSYAAWLSR0.8 (delta mass [ppm])2 
A564BPDZK1IP1, MAP17PDZK1-interacting protein 1IPI00011858ADGVLVGTDGR1.1 (delta mass [ppm])2 
A564BPDZK1IP1, MAP17PDZK1-interacting protein 1IPI00011858ADGVLVGTDGR1.9 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661ADGVTVTCK1.9 (delta mass [ppm])1 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661ADGVTVTCK1.1 (delta mass [ppm])2 
A6892LHPPPhospholysine phosphohistidine inorganic pyrophosphate phosphataseIPI00005474ADGYVDNLAEAVDLLLQHADK0.8 (delta mass [ppm])3 
A5418NAP1L4, NAP1L4b, NAP2Nucleosome assembly protein 1-like 4IPI00017763ADHSFSDGVPSDSVEAAK0.1 (delta mass [ppm])2 
A5418NAP1L4, NAP1L4b, NAP2Nucleosome assembly protein 1-like 4IPI00017763ADHSFSDGVPSDSVEAAK1.4 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ADHTLSSLEPAYSAK1.3 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ADHTLSSLEPAYSAK2.4 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ADHTLSSLEPAYSAK0.9 (delta mass [ppm])2 
A376CSLC12A3, TSCSolute carrier family 12 member 3IPI00216438ADIFVQNLVPDWR0.4 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623ADIGCTPGSGK3.7 (delta mass [ppm])2 
A9478CD84, SLAMF5SLAM family member 5IPI00022039ADINTQADPYTTTK0.3 (delta mass [ppm])2 
A9478CD84, SLAMF5SLAM family member 5IPI00022039ADINTQADPYTTTK0.9 (delta mass [ppm])2 
A9478CD84, SLAMF5SLAM family member 5IPI00022039ADINTQADPYTTTK1.1 (delta mass [ppm])2 
A9478CD84, SLAMF5SLAM family member 5IPI00022039ADINTQADPYTTTKR2.5 (delta mass [ppm])2 
A004CGLTPGlycolipid transfer proteinIPI00184363ADISGNITK0.9 (delta mass [ppm])2 
A7891STK24, MST3, STK3Serine/threonine protein kinase 24IPI00002212ADIWSLGITAIELAR1.1 (delta mass [ppm])2 
A5237TMSB10, PTMB10, THYB10Thymosin beta-10IPI00220827ADKPDMGEIASFDK2.2 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR0.5 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR2.8 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR2.3 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR0.5 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR0.9 (delta mass [ppm])2 
A2486SGSH, HSSN-sulphoglucosamine sulphohydrolase precursorIPI00019988ADLAAQYTTVGR1.5 (delta mass [ppm])2 
A1246UBE2L3, UBCE7, UBCH7Ubiquitin-conjugating enzyme E2 L3IPI00021347ADLAEEYSK1.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADLAKYICENQDSISSK3.1 (delta mass [ppm])2 
A330CRAB5C, RABLRas-related protein Rab-5CIPI00016339ADLASKR0.2 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK0.6 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK1.5 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK1.5 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK0.8 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK0.8 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVK1 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVKALLETSEK0.7 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ADLDGVGVKALLETSEK1.2 (delta mass [ppm])3 
A310CRAB14Ras-related protein Rab-14IPI00291928ADLEAQR0.6 (delta mass [ppm])2 
A0417CAPZA2F-actin capping protein alpha-2 subunitIPI00026182ADLEEQLSDEEK2.7 (delta mass [ppm])2 
A0417CAPZA2F-actin capping protein alpha-2 subunitIPI00026182ADLEEQLSDEEKVR0.5 (delta mass [ppm])2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768ADLEMQIENLK0.5 (delta mass [ppm])2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768ADLEMQIENLKEELAYLKK0.4 (delta mass [ppm])3 
A5734hAO, AOX1, AOAldehyde oxidaseIPI00642489ADLEMQIESLKEELAYLK0.6 (delta mass [ppm])3 
A093CLMAN2Vesicular integral-membrane protein VIP36 precursorIPI00009950ADLEMQIESLKEELAYLKK1 (delta mass [ppm])3 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865ADLEMQIESLTEELAYLK1.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ADLEMQIESLTEELAYLK2.4 (delta mass [ppm])3 
A182AVMO1, UNQ6350/PRO21055, UNQ6350Vitteline membrane outer layer protein 1 homolog precursorIPI00216914ADLEMQIESLTEELAYLK1.2 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327ADLEMQIESLTEELAYLK2.2 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327ADLEMQIESLTEELAYLK0.1 (delta mass [ppm])3 
A6449ERO1L, UNQ434/PRO865, ERO1-LERO1-like protein alphaIPI00386755ADLEMQIESLTEELAYLK0.5 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088ADLEMQIESLTEELAYLK0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ADLEMQIESLTEELAYLK1.3 (delta mass [ppm])3 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327ADLEMQIESLTEELAYLKK0.5 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088ADLEMQIESLTEELAYLKK4.1 (delta mass [ppm])3 
A9482SORT1Sortilin 1IPI00217882ADLGALELWR1 (delta mass [ppm])2 
A9482SORT1Sortilin 1IPI00217882ADLGALELWR2.1 (delta mass [ppm])2 
A9482SORT1Sortilin 1IPI00217882ADLGALELWR0.5 (delta mass [ppm])2 
A931BCYCS, CYCCytochrome CIPI00465315ADLIAYLK1.3 (delta mass [ppm])2 
A931BCYCS, CYCCytochrome CIPI00465315ADLIAYLK1.4 (delta mass [ppm])2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470ADLINNLGTIAK2.7 (delta mass [ppm])2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00334775ADLINNLGTIAK0.1 (delta mass [ppm])2 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493ADLLLSTQPGR2.3 (delta mass [ppm])2 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493ADLLLSTQPGR2.9 (delta mass [ppm])2 
A0745SLC3A2, MDU14F2 cell-surface antigen heavy chainIPI00027493ADLLLSTQPGREEGSPLELER2.5 (delta mass [ppm])3 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR1.3 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR0.8 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR2.5 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR1.6 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR0.3 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR2.2 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991ADLSGITGAR0.1 (delta mass [ppm])2 
A8420SERPINB1, ELANH2, MNEILeukocyte elastase inhibitorIPI00027444ADLSGMSGAR0 (delta mass [ppm])2 
A8420SERPINB1, ELANH2, MNEILeukocyte elastase inhibitorIPI00027444ADLSGMSGAR3.1 (delta mass [ppm])2 
A8498SERPINB12Serpin B12IPI00643202ADLTGISPSPNLYLSK2.7 (delta mass [ppm])2 
A8498SERPINB12Serpin B12IPI00033583ADLTGISPSPNLYLSK0.4 (delta mass [ppm])2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772ADQAPFDTDVNTLTR0.1 (delta mass [ppm])2 
A1319EHD1, PAST, PAST1EH-domain containing protein 1IPI00017184ADQIETQQLMR1.1 (delta mass [ppm])2 
A0008CALM1, CALM2, CALM3CalmodulinIPI00075248ADQLTEEQIAEFK2.2 (delta mass [ppm])2 
A0008CALM1, CALM2, CALM3CalmodulinIPI00075248ADQLTEEQIAEFK1.6 (delta mass [ppm])2 
A0008CALM1, CALM2, CALM3CalmodulinIPI00075248ADQLTEEQIAEFK1 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR0.3 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR1.9 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR0.7 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR0.6 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR1.6 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR0.5 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR2.1 (delta mass [ppm])2 
A8774EFEMP1, FBLN3, FBNLEGF-containing fibulin-like extracellular matrix protein 1 precursorIPI00029658ADQVCINLR2.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR2.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR0.3 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR4.8 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR3.1 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR0.6 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR2.9 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ADRDQYELLCLDNTR1.2 (delta mass [ppm])3 
A1619CFI, IFComplement factor IIPI00291867ADSPMDDFFQCVNGK1.1 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867ADSPMDDFFQCVNGK1.6 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ADSQAQLLLSTVVGVFTAPGLHLK2.8 (delta mass [ppm])3 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ADSQAQLLLSTVVGVFTAPGLHLK1.5 (delta mass [ppm])3 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ADSQAQLLLSTVVGVFTAPGLHLK0.1 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ADSQAQLLLSTVVGVFTAPGLHLK1.1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386158ADSSPVK0.7 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0.1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0.4 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0.9 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVK0.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVKAGVETTTPSK1.1 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ADSSPVKAGVETTTPSK1.9 (delta mass [ppm])2 
A318ESH3GLB2, PP578, PP9455SH3 domain GRB2-like endophilin B2IPI00024540ADSTKNWTEKILR1.7 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR1.4 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR1.1 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR0.8 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR1.2 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR2.6 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADTDGGLIFR1.6 (delta mass [ppm])2 
A1149SEMA5A, SEMAFSemaphorin 5A precursorIPI00013880ADTLTDEINFLR0.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ADTLTDEINFLR0.7 (delta mass [ppm])2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230ADTLTDEINFLR0.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384401ADTLTDEINFLR2.5 (delta mass [ppm])2 
A598CTGOLN2, TGN46, TGN51Trans-Golgi network integral membrane protein 2 precursorIPI00012545ADTNQLADKGK0.8 (delta mass [ppm])2 
A4707COCH, COCH5B2, UNQ257/PRO294Cochlin precursorIPI00012386ADVLCPGGCPLEEFSVYGNIVYASVSSICGAAVHR1.3 (delta mass [ppm])3 
A5981CATCatalaseIPI00465436ADVLTTGAGNPVGDK3.5 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275ADVTEWR0.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00550048ADYEKHKVYACEVTHQGLSSPVTK0 (delta mass [ppm])4 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416AEAAASALADADADLEER0.9 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416AEAAASALADADADLEER2.4 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416AEAAASALADADADLEER0.3 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416AEAAASALADADADLEER1.4 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK0.9 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK1.4 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK0.6 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK2.1 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK0.7 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AEAESLYQSK1.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AEAESWYQTK1.2 (delta mass [ppm])2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541AEAESWYR0.7 (delta mass [ppm])2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795AEAESWYR0.3 (delta mass [ppm])2 
A8846JSRP1, JP45Junctional sarcoplasmic reticulum protein 1IPI00065501AEAEVRPK0.1 (delta mass [ppm])2 
A8846JSRP1, JP45Junctional sarcoplasmic reticulum protein 1IPI00065501AEAEVRPK1.1 (delta mass [ppm])2 
A1754EFNB1, EFL3, EPLG2Ephrin-B1 precursorIPI00024307AEAGRPYEYYK1 (delta mass [ppm])2 
A1754EFNB1, EFL3, EPLG2Ephrin-B1 precursorIPI00024307AEAGRPYEYYK2.9 (delta mass [ppm])2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592AEAGVPAEFSIWTR0.9 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766AEAIGYAYPTR0.9 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00234091AEALIQLLDVNDNDPVVK1.5 (delta mass [ppm])2 
A5300CRB2CRUMBS protein homolog 2 precursorIPI00410585AEAPGSPAVVLPGR1.8 (delta mass [ppm])2 
A1627C8GComplement component C8 gamma chain precursorIPI00011261AEATTLHVAPQGTAMAVSTFR0.5 (delta mass [ppm])3 
A4628CADM4, IGSF4C, NECL4Cell adhesion molecule 4IPI00176427AEAVGETLTLPGLVSADNGTYTCEASNK3.8 (delta mass [ppm])3 
A016ANOMO1, PM5Nodal modulator 1IPI00329352AEDDQPLPGVLLSLSGGLFR1.3 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073AEDDTWEPEQK0.1 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073AEDDTWEPEQK2.9 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073AEDDTWEPEQK0.3 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073AEDDTWEPEQK0.3 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073AEDDTWEPEQK0.3 (delta mass [ppm])2 
A403BHSPC323Transmembrane protein HSPC323IPI00000220AEDEEETTFR1.6 (delta mass [ppm])2 
A403BHSPC323Transmembrane protein HSPC323IPI00000220AEDEEETTFR2.8 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327AEDGGGQFTTIR0 (delta mass [ppm])2 
A7306PBLD, MAWBPPhenazine biosynthesis-like domain-containing proteinIPI00024896AEDGIVLDLPLYPAHPQDFHEVEDLIK0.7 (delta mass [ppm])4 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315AEDGSVIDYELIDQDAR0.3 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623AEDLVGK1.5 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901AEDMYSAQSHQAATPPK3 (delta mass [ppm])3 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00641034AEDTAIYYCAR4.2 (delta mass [ppm])2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00641034AEDTAIYYCAR0.5 (delta mass [ppm])2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00644891AEDTALYYCAK2.8 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363AEDTALYYCAK0.1 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363AEDTALYYCAK2.1 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00645363AEDTALYYCAK4 (delta mass [ppm])2 
A154ATINAGL1, GIS5, LCN7Tubulointerstitial nephritis antigen-related protein precursorIPI00005563AEDTAVYFCAK2 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708AEDTAVYYCAK0.2 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479708AEDTAVYYCAK0.8 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384406AEDTAVYYCAK0.4 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00384406AEDTAVYYCAK2.6 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478AEDTAVYYCAK1.1 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00472762AEDTAVYYCAR3.4 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549769AEDTAVYYCAR0.7 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549769AEDTAVYYCAR0.9 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00426057AEDTAVYYCAR0.5 (delta mass [ppm])2 
A8363IGHM, IgIg mu chain CIPI00472610AEDTAVYYCAR1.9 (delta mass [ppm])2 
A8363IGHM, IgIg mu chain CIPI00472610AEDTAVYYCAR2.5 (delta mass [ppm])2 
A8363IGHM, IgIg mu chain CIPI00472610AEDTAVYYCAR1.7 (delta mass [ppm])2 
B1X62 Putative uncharacterized protein ENSP00000390033IPI00399193AEDTAVYYCVK2.4 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00549462AEDTGVYYCAK3.4 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601AEEEHLGILGPQLHADVGDK2 (delta mass [ppm])3 
A9399LYVE1, CRSBP1, HARLymphatic vessel endothelial hyaluronic acid receptor 1 precursorIPI00290856AEELSIQVSCR2.1 (delta mass [ppm])2 
A4443CLIC1, G6, NCC27Chloride intracellular channel protein 1IPI00010896AEEQPQVELFVK3.7 (delta mass [ppm])2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1IPI00003815AEEYEFLTPVEEAPK1.8 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AEEYEFLTPVEEAPK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.7 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.4 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSKLVTDLTK0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSKLVTDLTK1.7 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSKLVTDLTK2.2 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSKLVTDLTK2 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AEFAEVSKLVTDLTK0.3 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327AEFLALEIAEER2.9 (delta mass [ppm])2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812AEGPEVDVNLPK0.9 (delta mass [ppm])2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00383237AEGSDVANAVLDGADCIMLSGETAK0.9 (delta mass [ppm])3 
A9149GCVitamin D-binding protein precursorIPI00555812AEGSDVANAVLDGADCIMLSGETAK2.4 (delta mass [ppm])2 
A4575ANXA4, PIG28, ANX4Annexin A4IPI00221225AEIDMLDIR1.4 (delta mass [ppm])2 
A4575ANXA4, PIG28, ANX4Annexin A4IPI00221225AEIDMLDIR0.6 (delta mass [ppm])2 
A4575ANXA4, PIG28, ANX4Annexin A4IPI00221225AEIDMLDIR2.3 (delta mass [ppm])2 
A696CVPS25, DERP9, EAP20Vacuolar protein sorting-associated protein 25IPI00031655AEIITVSDGR1.2 (delta mass [ppm])2 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871AEKSDEGTYMCVATNSAGHR0.8 (delta mass [ppm])3 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorIPI00025861AELDREDFEHVK1 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933AELIVQPELK0.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLQVLQSLEAVLIQTVYNTK1.3 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLQVLQSLEAVLIQTVYNTK1.8 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLQVLQSLEAVLIQTVYNTK1.9 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLQVLQSLEAVLIQTVYNTK0.4 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLQVLQSLEAVLIQTVYNTK1.1 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AELLVTEAPSKPITVTVEEQR0.9 (delta mass [ppm])3 
A376CSLC12A3, TSCSolute carrier family 12 member 3IPI00216438AELPTTETPGDATLCSGR0.5 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AELQEGAR0.2 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AELQEGAR0.3 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AELQEGAR0.7 (delta mass [ppm])2 
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5IPI00024664AELSEEALLSVLPTIR2.5 (delta mass [ppm])2 
A8720C4A, CO4, CPAMD2Complement C4 precursorIPI00643525AEMADQAAAWLTR2.4 (delta mass [ppm])2 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163AEMADQAAAWLTR0.4 (delta mass [ppm])2 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163AEMADQAAAWLTR4.8 (delta mass [ppm])2 
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorIPI00012426AEMIIEQNTDGVNFYNILTK1.5 (delta mass [ppm])2 
A845CTDRD15Tudor domain-containing protein 15IPI00397875AEMLNVSK4.6 (delta mass [ppm])2 
A845CTDRD15Tudor domain-containing protein 15IPI00397875AEMLNVSK0.6 (delta mass [ppm])2 
A0231ARPC4, ARC20, ARPC4-TTLL3Actin-related protein 2/3 complex subunit 4IPI00554811AENFFILR0.3 (delta mass [ppm])2 
A137ASOST, UNQ2976/PRO7455/PRO7476, UNQ2976Sclerostin precursorIPI00019272AENGGRPPHHPFETK0.9 (delta mass [ppm])3 
A4618CDH17Cadherin-17IPI00290089AENPEPLVFGVK0.7 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AEPAKIEAFR0.4 (delta mass [ppm])2 
A0234ACTR3, ARP3Actin-like protein 3IPI00028091AEPEDHYFLLTEPPLNTPENR3 (delta mass [ppm])3 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AEPPKAPEQEQAAPGPAAGGEAPK0.4 (delta mass [ppm])3 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1IPI00003815AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK4.2 (delta mass [ppm])3 
A839E PREDICTED: Hypothetical protein XP_498626IPI00456189AEQGRRQLSQEPSR3 (delta mass [ppm])4 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR0.3 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR1.6 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR1.6 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR2.8 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR0.7 (delta mass [ppm])2 
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorIPI00022661AEQVIFVR0.1 (delta mass [ppm])2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766AESAVIVANPREEIIVK0 (delta mass [ppm])2 
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5IPI00100796AESIDKK0.3 (delta mass [ppm])2 
A367CRPAIN, RIPRPA-interacting proteinIPI00465161AESLRSPR3.7 (delta mass [ppm])2 
A0742TTNTitinIPI00397522AETAPPNFVQR1.8 (delta mass [ppm])2 
A0742TTNTitinIPI00397522AETAPPNFVQR2.3 (delta mass [ppm])2 
A0742TTNTitinIPI00397522AETAPPNFVQR0 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327AETECQNTEYQQLLDIK0.2 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AETECQNTEYQQLLDIK3.1 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601AETGDKVYVHLK2.5 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AETTCHCQCAGMDWTGAR2.2 (delta mass [ppm])3 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AETTCHCQCAGMDWTGAR0.2 (delta mass [ppm])3 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AETTCHCQCAGMDWTGAR0.9 (delta mass [ppm])3 
A9932HAVCR2, TIM3, TIMD3Hepatitis A virus cellular receptor 2IPI00154807AEVGQNAYLPCFYTPAAPGNLVPVCWGK3.1 (delta mass [ppm])3 
A9932HAVCR2, TIM3, TIMD3Hepatitis A virus cellular receptor 2IPI00154807AEVGQNAYLPCFYTPAAPGNLVPVCWGK1.7 (delta mass [ppm])3 
A9932HAVCR2, TIM3, TIMD3Hepatitis A virus cellular receptor 2IPI00154807AEVGQNAYLPCFYTPAAPGNLVPVCWGK1.2 (delta mass [ppm])3 
A9932HAVCR2, TIM3, TIMD3Hepatitis A virus cellular receptor 2IPI00154807AEVGQNAYLPCFYTPAAPGNLVPVCWGK4.6 (delta mass [ppm])3 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334AEVSIQNNK0.7 (delta mass [ppm])2 
A4814FLNB, FLN3, TAPFilamin-BIPI00289334AEVSIQNNK0.8 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPR0.7 (delta mass [ppm])3 
A340CRAMP3Receptor activity-modifying protein 3 precursorIPI00032425AFADMMGK0.3 (delta mass [ppm])2 
A340CRAMP3Receptor activity-modifying protein 3 precursorIPI00032425AFADMMGK0.9 (delta mass [ppm])2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorIPI00005040AFAGDIANQLATDAVQILGGNGFNTEYPVEK0.7 (delta mass [ppm])3 
A1655MMP9, CLG4BMatrix metalloproteinase-9IPI00027509AFALWSAVTPLTFTR0.8 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK0.7 (delta mass [ppm])3 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK0.1 (delta mass [ppm])3 
A8401CST3Cystatin C precursorIPI00032293AFCSFQIYAVPWQGTMTLSK2.8 (delta mass [ppm])3 
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorIPI00298281AFDITYVR0.5 (delta mass [ppm])2 
A1518LAMC1, LAMB2Laminin gamma-1 chain precursorIPI00298281AFDITYVR1.3 (delta mass [ppm])2 
A6207CPVL, VLP, UNQ197/PRO223Probable serine carboxypeptidase CPVL precursorIPI00301395AFDMINR1.2 (delta mass [ppm])2 
A6207CPVL, VLP, UNQ197/PRO223Probable serine carboxypeptidase CPVL precursorIPI00301395AFDMINR0.9 (delta mass [ppm])2 
A577DEFCAB14EF-hand domain-containing protein KIAA0494IPI00006130AFDSDGDGR0.5 (delta mass [ppm])2 
A577DEFCAB14EF-hand domain-containing protein KIAA0494IPI00006130AFDSDGDGRYSFLELR1.7 (delta mass [ppm])3 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AFEEQLQSWCQAAGEGVTLEFAQK0.8 (delta mass [ppm])3 
A857BCALB1, CAB27CalbindinIPI00220361AFELYDQDGNGYIDENELDALLK2.1 (delta mass [ppm])2 
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1IPI00172579AFEPATGR0.1 (delta mass [ppm])2 
A0290L1CAM, CAML1, MIC5Neural cell adhesion molecule L1 precursorIPI00027087AFGAPVPSVQWLDEDGTTVLQDER1.3 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360AFGHHAVSLLDGGLR0.1 (delta mass [ppm])3 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360AFGHHAVSLLDGGLR0.2 (delta mass [ppm])3 
A7414PLBD2Putative Phospholipase B-like 2 precursorIPI00169285AFIPGGPSPGSR0.3 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.4 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.5 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.6 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK2.1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK0.1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK2.2 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.4 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK1.4 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK0.5 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK0.8 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVK0.4 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVKGK0.8 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVKGK1.9 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVKGK1.5 (delta mass [ppm])3 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVKGK3 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AFIQLWAFDAVKGK1.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AFKAWAVAR1.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AFKAWAVAR0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AFKAWAVAR1.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AFKAWAVAR1 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGK0.5 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGK0.2 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGK2 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGKQ0.7 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGKQ1.1 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGKQ1.8 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757AFLASPEYVNLPINGNGKQ0.7 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00032179AFLEVNEEGSEAAASTAVVIAGR1.5 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243AFLLSLAALR0.2 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243AFLLSLAALR0.1 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243AFLLSLAALR2.3 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243AFLLSLAALR3.4 (delta mass [ppm])2 
A821BAPOM, G3A, NG20Apolipoprotein MIPI00030739AFLLTPR0.1 (delta mass [ppm])2 
A821BAPOM, G3A, NG20Apolipoprotein MIPI00030739AFLLTPR0.4 (delta mass [ppm])2 
A821BAPOM, G3A, NG20Apolipoprotein MIPI00030739AFLLTPR1.1 (delta mass [ppm])2 
A821BAPOM, G3A, NG20Apolipoprotein MIPI00030739AFLLTPR0.6 (delta mass [ppm])2 
A3982CSF1Macrophage colony-stimulating factor 1IPI00015881AFLLVQDIMEDTMR3 (delta mass [ppm])2 
A3982CSF1Macrophage colony-stimulating factor 1IPI00015881AFLLVQDIMEDTMR2.2 (delta mass [ppm])2 
A3982CSF1Macrophage colony-stimulating factor 1IPI00015881AFLLVQDIMEDTMR2.1 (delta mass [ppm])2 
A3982CSF1Macrophage colony-stimulating factor 1IPI00015881AFLLVQDIMEDTMR2.1 (delta mass [ppm])2 
A3982CSF1Macrophage colony-stimulating factor 1IPI00015881AFLLVQDIMEDTMR2.3 (delta mass [ppm])2 
A0621RAB10Ras-related protein Rab-10IPI00016513AFLTLAEDILR2.7 (delta mass [ppm])2 
A0621RAB10Ras-related protein Rab-10IPI00016513AFLTLAEDILR0.3 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292AFMDGSNR0.1 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292AFMDGSNRK0.3 (delta mass [ppm])2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067AFMTADLPNELIELLEK4.1 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER0 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER2.6 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER2.3 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER1.4 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER2.3 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER1.9 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER0.4 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER0.5 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260AFPALTSLDLSDNPGLGER0 (delta mass [ppm])2 
A6260DDR1, CAK, EDDR1Epithelial discoidin domain receptor 1 precursorIPI00001477AFQAMQVHCNNMHTLGAR0.5 (delta mass [ppm])3 
A4823FREM2FRAS1-related extracellular matrix protein 2 precursorIPI00180707AFQELGVR2.7 (delta mass [ppm])2 
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinIPI00465085AFQGLLDTYSVWR1.6 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR0.4 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR1.2 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR0.8 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR3.5 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR2.4 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102AFQNVFAPR0.7 (delta mass [ppm])2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003AFQPFFVELTMPYSVIR2.4 (delta mass [ppm])2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348AFQPLVK1.4 (delta mass [ppm])2 
A4617CDH16, UNQ695/PRO1340, UNQ695Cadherin-16 precursorIPI00025240AFQVDPTSGSVTLGVLPLR2.2 (delta mass [ppm])2 
A2739ZNF700, ZNF69Zinc finger protein 700IPI00026524AFRCCNSLR0.4 (delta mass [ppm])2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AFSAVDTDGNGTINAQELGAALK0.1 (delta mass [ppm])2 
A6464ESDS-formylglutathione hydrolaseIPI00411706AFSGYLGTDQSK0 (delta mass [ppm])2 
A2698ZNF23, KOX16, ZNF359Zinc finger protein 23IPI00012365AFSINAK1.8 (delta mass [ppm])2 
A9331GPRC5B, RAIG2G protein-coupled receptor, family C, group 5, member BIPI00008239AFSMDEHNAALR0.2 (delta mass [ppm])2 
A9331GPRC5B, RAIG2G protein-coupled receptor, family C, group 5, member BIPI00008239AFSMDEHNAALR0.8 (delta mass [ppm])2 
A9331GPRC5B, RAIG2G protein-coupled receptor, family C, group 5, member BIPI00008239AFSMDEHNAALR1.4 (delta mass [ppm])2 
A9331GPRC5B, RAIG2G protein-coupled receptor, family C, group 5, member BIPI00008239AFSMDEHNAALR1.8 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901AFSMDEPVAAK1 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901AFSMDEPVAAK4.6 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901AFSMDEPVAAK0.6 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901AFSMDEPVAAK0.8 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00099883AFSMDEPVAAK0.4 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00099883AFSMDEPVAAK2.3 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503AFSVNIFK0 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503AFSVNIFK1.8 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503AFSVNIFK2 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503AFSVNIFK1.4 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503AFSVNIFK1.2 (delta mass [ppm])2 
A5100PROM1, PROML1, MSTP061Prominin 1 precursorIPI00012540AFTDLNSINSVLGGGILDR1.6 (delta mass [ppm])2 
A5100PROM1, PROML1, MSTP061Prominin 1 precursorIPI00012540AFTDLNSINSVLGGGILDR2.9 (delta mass [ppm])2 
A5100PROM1, PROML1, MSTP061Prominin 1 precursorIPI00012540AFTDLNSINSVLGGGILDR0.1 (delta mass [ppm])2 
A5100PROM1, PROML1, MSTP061Prominin 1 precursorIPI00012540AFTDLNSINSVLGGGILDR1.1 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933AFVNCDENSR1.5 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262AFVNCDENSR1.3 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AFVNCDENSR1.9 (delta mass [ppm])2 
A9139UMODUromodulin precursorIPI00013945AFVNCDENSR0.5 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459AFVSLGAPWGGVAK1.9 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459AFVSLGAPWGGVAK1.7 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459AFVSLGAPWGGVAK3.1 (delta mass [ppm])2 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1IPI00443898AFYAAVAADCFR0.7 (delta mass [ppm])2 
A8972PSME2Proteasome activator subunit 2IPI00384051AFYAELYHIISSNLEK1.9 (delta mass [ppm])3 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925AFYPEEISSMVLTK2.4 (delta mass [ppm])2 
A8271IGHG4Ig gamma-4 chainIPI00426069AFYPSDIAVEWESNGQPENNYK2.3 (delta mass [ppm])2 
A376CSLC12A3, TSCSolute carrier family 12 member 3IPI00216438AFYSDVIAEDLR0.2 (delta mass [ppm])2 
A376CSLC12A3, TSCSolute carrier family 12 member 3IPI00216438AFYSDVIAEDLRR1.2 (delta mass [ppm])2 
A5981CATCatalaseIPI00465436AFYVNVLNEEQR1.1 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCK2.5 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCK0.7 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCK2.2 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCK2.1 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCK1.3 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AGAAAGGPGVSGVCVCKSR1.4 (delta mass [ppm])3 
A4592BCAM, LU, MSK19Basal cell adhesion molecule precursorIPI00002406AGAAGTAEATAR0.5 (delta mass [ppm])2 
A4592BCAM, LU, MSK19Basal cell adhesion molecule precursorIPI00002406AGAAGTAEATAR1.2 (delta mass [ppm])2 
A4592BCAM, LU, MSK19Basal cell adhesion molecule precursorIPI00002406AGAAGTAEATAR1.7 (delta mass [ppm])2 
A4592BCAM, LU, MSK19Basal cell adhesion molecule precursorIPI00002406AGAAGTAEATAR4 (delta mass [ppm])2 
A4592BCAM, LU, MSK19Basal cell adhesion molecule precursorIPI00002406AGAAGTAEATAR4.4 (delta mass [ppm])2 
A4633CAP1, CAPAdenylyl cyclase-associated protein 1IPI00008274AGAAPYVQAFDSLLAGPVAEYLK0.2 (delta mass [ppm])3 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASER0.2 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASER0.1 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASER0.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASER1.6 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASER0.9 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASEREVS1.2 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASEREVS1.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AGAEPASEREVS0.7 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760AGAGLSSLCLVLSTRPHS1.8 (delta mass [ppm])3 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760AGAGLSSLCLVLSTRPHS1.3 (delta mass [ppm])3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018AGAHLQGGAK1.1 (delta mass [ppm])2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018AGAHLQGGAK0.4 (delta mass [ppm])2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018AGAHLQGGAK0.2 (delta mass [ppm])2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018AGAHLQGGAK0.2 (delta mass [ppm])2 
A0765EPHB2, DRT, EPHT3Ephrin type-B receptor 2 precursorIPI00021275AGAIYVFQVR0.4 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK1.7 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK1.2 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK1.4 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK0.2 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK1.2 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK3 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AGALNSNDAFVLK2.4 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGASIIGVNCHFDPTISLK1 (delta mass [ppm])3 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGASIIGVNCHFDPTISLK2.5 (delta mass [ppm])3 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGASIIGVNCHFDPTISLK2.9 (delta mass [ppm])2 
A5923GLB1, ELNR1Beta-galactosidase precursorIPI00441344AGATLDLLVENMGR0.2 (delta mass [ppm])2 
A5923GLB1, ELNR1Beta-galactosidase precursorIPI00441344AGATLDLLVENMGR0.3 (delta mass [ppm])2 
A5923GLB1, ELNR1Beta-galactosidase precursorIPI00441344AGATLDLLVENMGR2 (delta mass [ppm])2 
A6993ABCB1, MDR1, PGY1Multidrug resistance protein 1IPI00027481AGAVAEEVLAAIR1.2 (delta mass [ppm])2 
A6367DPP4, ADCP2, CD26Dipeptidyl peptidase 4IPI00018953AGAVNPTVK1.3 (delta mass [ppm])2 
A6367DPP4, ADCP2, CD26Dipeptidyl peptidase 4IPI00018953AGAVNPTVK0.9 (delta mass [ppm])2 
A6367DPP4, ADCP2, CD26Dipeptidyl peptidase 4IPI00018953AGAVNPTVK0.9 (delta mass [ppm])2 
A7153NEU1, NANHSialidase 1 precursorIPI00029817AGCQVASTMLVWSK1.2 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AGCVAESTAVCR1.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AGDEAVFAQYDSFHVDSAAEYYR2.9 (delta mass [ppm])3 
A231ERCN3, UNQ239/PRO272, UNQ239Reticulocalbin 3 precursorIPI00101037AGDGDGWVSLAELR0.2 (delta mass [ppm])2 
A8399CSTA, STF1, STFACystatin AIPI00032325AGDNKYMHLK1.9 (delta mass [ppm])2 
A8399CSTA, STF1, STFACystatin AIPI00032325AGDNKYMHLK1.3 (delta mass [ppm])2 
A6257DDC, AADCAromatic-L-amino-acid decarboxylaseIPI00025394AGEGGGVIQGSASEATLVALLAAR4.2 (delta mass [ppm])2 
A6257DDC, AADCAromatic-L-amino-acid decarboxylaseIPI00025394AGEGGGVIQGSASEATLVALLAAR0.1 (delta mass [ppm])2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AGELTPEEEAQYK0.3 (delta mass [ppm])2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AGELTPEEEAQYKK0.9 (delta mass [ppm])2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AGELTPEEEAQYKK0.3 (delta mass [ppm])2 
A920KDENND2CDENN domain-containing protein 2CIPI00470838AGEVANTKR3.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR1.6 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR0.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR0.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR0.1 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR0.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR2.2 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR0.8 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AGEVQEPELR3 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR0.8 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR0.4 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR0.3 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR0.7 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR2.2 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AGFAGDDAPR2.3 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AGFAGDDAPR1 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AGFAGDDAPR0.8 (delta mass [ppm])2 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AGFALDEGIANPTDAFTVFYSER0.3 (delta mass [ppm])2 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AGFALDEGIANPTDAFTVFYSER2 (delta mass [ppm])2 
A683DLRRC58Leucine-rich repeat-containing protein 58IPI00304207AGFAPAR0.6 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGFFGDAMK1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGFFGDAMK0.2 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AGFFGDAMK1.8 (delta mass [ppm])2 
A2261ANGPTL6, AGF, ARP5Angiopoietin-related protein 6 precursorIPI00289346AGFGRPDGEYWLGLEPVYQLTSR2.6 (delta mass [ppm])3 
A2261ANGPTL6, AGF, ARP5Angiopoietin-related protein 6 precursorIPI00289346AGFGRPDGEYWLGLEPVYQLTSR4.1 (delta mass [ppm])3 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK0.2 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK1.3 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK0.1 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK2.8 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK2 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK1.3 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK0.7 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK3.2 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFK0.2 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AGFSWIEVTFKNPLVWVHASPEHVVVTR0 (delta mass [ppm])4 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFKNPLVWVHASPEHVVVTR3 (delta mass [ppm])4 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFKNPLVWVHASPEHVVVTR1.5 (delta mass [ppm])3 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFKNPLVWVHASPEHVVVTR4.5 (delta mass [ppm])3 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AGFSWIEVTFKNPLVWVHASPEHVVVTR2.6 (delta mass [ppm])5 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AGFVGGQFWSVYTPCDTQNK1.4 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AGFVGGQFWSVYTPCDTQNK0.3 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AGFVGGQFWSVYTPCDTQNK2.4 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AGFVGGQFWSVYTPCDTQNKDAVR2.1 (delta mass [ppm])3 
A4725COTL1, CLPCoactosin-like proteinIPI00017704AGGANYDAQTE1.3 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AGGFLMK4.7 (delta mass [ppm])2 
A845E PREDICTED: Hypothetical protein XP_498916IPI00456511AGGGGGGGALLSR4.8 (delta mass [ppm])3 
A436CSLC38A10, PP1744Putative Sodium-coupled neutral amino acid transporter 10IPI00443799AGGNQAASQLEEAGR1.5 (delta mass [ppm])2 
A0130NRXN1Neurexin 1-alpha precursorIPI00428511AGGREPYPGSAEVIR0.6 (delta mass [ppm])2 
A0130NRXN1Neurexin 1-alpha precursorIPI00428511AGGREPYPGSAEVIR1.6 (delta mass [ppm])2 
A7526PSMB1, PSC5Proteasome subunit beta type 1IPI00025019AGGSASAMLQPLLDNQVGFK1.6 (delta mass [ppm])2 
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorIPI00479116AGGSWDLAVQER0.7 (delta mass [ppm])2 
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorIPI00479116AGGSWDLAVQER2.9 (delta mass [ppm])2 
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorIPI00479116AGGSWDLAVQER2.4 (delta mass [ppm])2 
A8729CPN2, ACBPCarboxypeptidase N subunit 2 precursorIPI00479116AGGSWDLAVQER3.2 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AGGVLAYELLPALDEVLASDSR1.4 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AGGVLAYELLPALDEVLASDSR2.7 (delta mass [ppm])2 
A3522SEPT1, DIFF6, PNUTL3Septin 1IPI00646888AGGVMDK2.3 (delta mass [ppm])1 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772AGIAHLYGIAGSTNVTGDQVK0.9 (delta mass [ppm])3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772AGIAHLYGIAGSTNVTGDQVK2.1 (delta mass [ppm])3 
A4823FREM2FRAS1-related extracellular matrix protein 2 precursorIPI00180707AGIAISAFNLK1 (delta mass [ppm])2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136AGIEIFVVVVGR1.5 (delta mass [ppm])2 
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidaseIPI00026216AGIISTVEVLK1.6 (delta mass [ppm])2 
A7738POLR2H, RPABC3DNA-directed RNA polymerases I, II, and III subunit RPABC3IPI00003309AGILFEDIFDVK1.9 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR1.8 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR2.3 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR0.7 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR0.8 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR1.4 (delta mass [ppm])3 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR0.2 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGLAASLAGPHSIVGR1.2 (delta mass [ppm])2 
A6478FBP2Fructose-1,6-bisphosphatase isozyme 2IPI00299456AGLAHLYGIAGSVNVTGDEVK0.1 (delta mass [ppm])3 
A314ACREB3L3, CREBH, HYST1481Cyclic AMP-responsive element-binding protein 3-like protein 3IPI00045957AGLEAAGDEL0.9 (delta mass [ppm])1 
A314ACREB3L3, CREBH, HYST1481Cyclic AMP-responsive element-binding protein 3-like protein 3IPI00045957AGLEAAGDEL2.3 (delta mass [ppm])1 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AGLEDLQVAFR1.7 (delta mass [ppm])2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536AGLEDLQVAFR0.8 (delta mass [ppm])2 
A857BCALB1, CAB27CalbindinIPI00220361AGLELSPEMK1.1 (delta mass [ppm])2 
A5807ANG, RNASE5, HEL168Angiogenin precursorIPI00008554AGLENTVAETECR1 (delta mass [ppm])2 
A8460PSMF1Proteasome (prosome, macropain) inhibitor subunit 1IPI00009949AGLEVLFASAAPAITCR0.4 (delta mass [ppm])2 
A0461DDAH1, DDAHN(G),N(G)-dimethylarginine dimethylaminohydrolase 1IPI00220342AGLGHPAAFGR0.1 (delta mass [ppm])2 
A0461DDAH1, DDAHN(G),N(G)-dimethylarginine dimethylaminohydrolase 1IPI00220342AGLGHPAAFGR0.3 (delta mass [ppm])2 
A8024TRHDE, UNQ2507/PRO5995, UNQ2507Thyrotropin-releasing hormone degrading ectoenzymeIPI00007798AGLIDDAFSLAR0.8 (delta mass [ppm])2 
A8024TRHDE, UNQ2507/PRO5995, UNQ2507Thyrotropin-releasing hormone degrading ectoenzymeIPI00007798AGLIDDAFSLAR0.2 (delta mass [ppm])2 
A3594ALDH1L1, FTHFDAldehyde dehydrogenase 1 family, member L1IPI00290553AGLILFGNDDK0.5 (delta mass [ppm])2 
A6366DPP3Dipeptidyl peptidase 3IPI00020672AGLLALEFYTPEAFNWR4.1 (delta mass [ppm])2 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR0.1 (delta mass [ppm])2 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR1.1 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR0.8 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR2.1 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR2.2 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR3.4 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR0 (delta mass [ppm])3 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207AGLLRPDYALLGHR0.8 (delta mass [ppm])3 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215AGLLTEEIR1 (delta mass [ppm])2 
A0038LPHN1, LEC2Latrophilin-1IPI00183445AGLPFGLMR0.3 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601AGLQAFFQVQECNK0.7 (delta mass [ppm])2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457AGLQFPVGR0.2 (delta mass [ppm])2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457AGLQFPVGR0 (delta mass [ppm])2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457AGLQFPVGR1.4 (delta mass [ppm])2 
A491AH2AFV, H2AVHistone H2A.F/Z variantIPI00018278AGLQFPVGR0.2 (delta mass [ppm])2 
A491AH2AFV, H2AVHistone H2A.F/Z variantIPI00018278AGLQFPVGR1.6 (delta mass [ppm])2 
A491AH2AFV, H2AVHistone H2A.F/Z variantIPI00018278AGLQFPVGR1.3 (delta mass [ppm])2 
A1558EPHB6Ephrin type-B receptor 6 precursorIPI00005222AGLQLNVK0.6 (delta mass [ppm])2 
A1558EPHB6Ephrin type-B receptor 6 precursorIPI00005222AGLQLNVK0.5 (delta mass [ppm])2 
A1558EPHB6Ephrin type-B receptor 6 precursorIPI00005222AGLQLNVK1.7 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK0.4 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.3 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.7 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.2 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.1 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK0.2 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.4 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.5 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK0.9 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNK1.6 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNKCWK2.4 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNKCWK0 (delta mass [ppm])2 
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorIPI00011302AGLQVYNKCWK1.1 (delta mass [ppm])2 
A6950MAN2A1, MANA2Alpha-mannosidase IIIPI00003802AGLSHMLIQR0.7 (delta mass [ppm])3 
A437CSLC39A4, ZIP4Zinc transporter ZIP4IPI00015689AGLWASHADHLLALLESPK0.4 (delta mass [ppm])3 
A4749DPTDermatopontin precursorIPI00292130AGMEWYQTCSNNGLVAGFQSR0.9 (delta mass [ppm])2 
A4749DPTDermatopontin precursorIPI00292130AGMEWYQTCSNNGLVAGFQSR2.1 (delta mass [ppm])2 
A5545EFEMP2, FBLN4, UNQ200/PRO226EGF-containing fibulin-like extracellular matrix protein 2 precursorIPI00296058AGNSQGDFYIR0.4 (delta mass [ppm])2 
A5545EFEMP2, FBLN4, UNQ200/PRO226EGF-containing fibulin-like extracellular matrix protein 2 precursorIPI00296058AGNSQGDFYIR1 (delta mass [ppm])2 
A5545EFEMP2, FBLN4, UNQ200/PRO226EGF-containing fibulin-like extracellular matrix protein 2 precursorIPI00296058AGNSQGDFYIR1.3 (delta mass [ppm])2 
A5545EFEMP2, FBLN4, UNQ200/PRO226EGF-containing fibulin-like extracellular matrix protein 2 precursorIPI00296058AGNSQGDFYIR2.2 (delta mass [ppm])2 
A5545EFEMP2, FBLN4, UNQ200/PRO226EGF-containing fibulin-like extracellular matrix protein 2 precursorIPI00296058AGNSQGDFYIR0.1 (delta mass [ppm])2 
A4823FREM2FRAS1-related extracellular matrix protein 2 precursorIPI00180707AGNVAPGTFTLYLHPVDNQPPEILNTGFTIQEK1.3 (delta mass [ppm])3 
A701CVPS4B, SKD1, VPS42Vacuolar sorting protein 4bIPI00182728AGNYEEALQLYQHAVQYFLHVVK2.1 (delta mass [ppm])3 
A199DTMEM256UPF0451 protein C17ORF61IPI00166483AGPAAAFR1 (delta mass [ppm])2 
A199DTMEM256UPF0451 protein C17ORF61IPI00166483AGPAAAFR0 (delta mass [ppm])1 
A199DTMEM256UPF0451 protein C17ORF61IPI00166483AGPAAAFR0 (delta mass [ppm])2 
A199DTMEM256UPF0451 protein C17ORF61IPI00166483AGPAAAFR3.2 (delta mass [ppm])2 
A1622ADM, AMADM precursorIPI00017968AGPAQTLIRPQDMK1.6 (delta mass [ppm])2 
A1622ADM, AMADM precursorIPI00017968AGPAQTLIRPQDMK0.6 (delta mass [ppm])3 
A3981EGFL9, DLK2, UNQ2903/PRO28633Protein delta homolog 2IPI00028381AGPCEQAGSPCR2 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AGPGPGGGSKDLLFWVALER0.2 (delta mass [ppm])3 
A353BCD248, CD164L1, TEM1Tumor endothelial marker 1 precursorIPI00006971AGPLCLGTGCSPDNGGCEHECVEEVDGHVSCR4.7 (delta mass [ppm])4 
A4805FBLN7, TM14Fibulin-7 precursorIPI00167710AGPNSLR1.5 (delta mass [ppm])2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00397191AGPNTNGSQFFICTAK2.8 (delta mass [ppm])2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00397191AGPNTNGSQFFICTAK0 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGPWTPEAAVEHPEAVR0.3 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGPWTPEAAVEHPEAVR2.6 (delta mass [ppm])2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525AGQAVDDFIEK2.4 (delta mass [ppm])2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525AGQAVDDFIEK1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AGQCVCVEGFR0.8 (delta mass [ppm])2 
A1849TNXB, HXBL, TNXTenascin-XIPI00025276AGQCVCVEGFR0.2 (delta mass [ppm])2 
A1849TNXB, HXBL, TNXTenascin-XIPI00025276AGQCVCVEGFR1.6 (delta mass [ppm])2 
A1849TNXB, HXBL, TNXTenascin-XIPI00025276AGQCVCVEGFR1 (delta mass [ppm])2 
A1627C8GComplement component C8 gamma chain precursorIPI00011261AGQLSVK0.2 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360AGQPLQLLDASWYLPK0.6 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360AGQPLQLLDASWYLPK0.7 (delta mass [ppm])2 
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseIPI00220993AGQVFLEELGNHK3.9 (delta mass [ppm])3 
A3484SLC8A2, NCX2Sodium/calcium exchanger 2 precursorIPI00010343AGSDYEYSEGTLVFKPGETQK0.1 (delta mass [ppm])3 
A1158SDC4Syndecan-4 precursorIPI00011564AGSGSQVPTEPK0.8 (delta mass [ppm])2 
A1158SDC4Syndecan-4 precursorIPI00011564AGSGSQVPTEPK0.9 (delta mass [ppm])2 
A1158SDC4Syndecan-4 precursorIPI00011564AGSGSQVPTEPK0.1 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGSNVMQTFTFYASEDKLENR0.4 (delta mass [ppm])3 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AGSNVMQTFTFYASEDKLENR2.4 (delta mass [ppm])3 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AGSPTAPVHDESLVGPVDPSSGQQSR2.2 (delta mass [ppm])3 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AGSPTAPVHDESLVGPVDPSSGQQSR1.4 (delta mass [ppm])3 
A809BAPOA2Apolipoprotein A-II precursorIPI00021854AGTELVNFLSYFVELGTQPATQ0.7 (delta mass [ppm])3 
A4792EPPK1, EPIPLEpiplakin 1IPI00010951AGTLTVEELGATLTSLLAQAQAQAR2.7 (delta mass [ppm])3 
A5768ALDH8A1, ALDH12Aldehyde dehydrogenase 12IPI00171391AGTNALLMLENFIDGK0.7 (delta mass [ppm])2 
A6984MCM3, HCC5DNA replication licensing factor MCM3IPI00013214AGTVVLDDVELR1.1 (delta mass [ppm])2 
A616BSUSD2 IPI00021302AGTWLAVHPNK2.1 (delta mass [ppm])2 
A616BSUSD2 IPI00021302AGTWLAVHPNK0.4 (delta mass [ppm])2 
A616BSUSD2 IPI00021302AGTWLAVHPNK2.2 (delta mass [ppm])2 
A616BSUSD2 IPI00021302AGTWLAVHPNK2.1 (delta mass [ppm])2 
A1587SLPI, WAP4, WFDC4Antileukoproteinase 1 precursorIPI00008580AGVCPPK0.8 (delta mass [ppm])2 
A0524PFN1Profilin IIPI00216691AGVETTKPSK1 (delta mass [ppm])2 
A1919GYPC, GLPC, GPCGlycophorin CIPI00026299AGVETTKPSK0.5 (delta mass [ppm])2 
A4013TENM4, ODZ4, TNM4Teneurin-4IPI00464973AGVETTKPSK0.8 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352AGVETTKPSK0.7 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095AGVETTKPSK0.1 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00441042AGVETTKPSK1.4 (delta mass [ppm])2 
A8930MZB1, PACAP, HSPC190Plasma cell-induced resident endoplasmic reticulum proteinIPI00102821AGVETTKPSK1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386158AGVETTTPSK1.7 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK0.6 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.1 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK0.9 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK0.6 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK2.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK2.4 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.9 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK0.4 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSK1.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005AGVETTTPSKQSNNK0.8 (delta mass [ppm])2 
A5651ABP1, AOC1, DAO1Amiloride-sensitive amine oxidase [copper-containing] precursorIPI00020982AGVFSDLSNQELK1.7 (delta mass [ppm])2 
A5651ABP1, AOC1, DAO1Amiloride-sensitive amine oxidase [copper-containing] precursorIPI00020982AGVFSDLSNQELK3.1 (delta mass [ppm])2 
A8197WNK2, PRKWNK2, SDCCAG43Serine/threonine-protein kinase WNK2IPI00398808AGVGMPR0.1 (delta mass [ppm])2 
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1IPI00026268AGVLAGHDNR1 (delta mass [ppm])2 
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2IPI00003348AGVLAGHDNR0.4 (delta mass [ppm])2 
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2IPI00003348AGVLAGHDNR2.6 (delta mass [ppm])2 
A033APDCD6, ALG2, AHRRProgrammed cell death protein 6IPI00025277AGVNFSEFTGVWK2.2 (delta mass [ppm])2 
A033APDCD6, ALG2, AHRRProgrammed cell death protein 6IPI00025277AGVNFSEFTGVWK2.9 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AGVQVWLGANGK0.6 (delta mass [ppm])2 
A6078CMBLCarboxymethylenebutenolidase homologIPI00383046AGVSVYGIVK0.3 (delta mass [ppm])2 
A6078CMBLCarboxymethylenebutenolidase homologIPI00383046AGVSVYGIVK1.1 (delta mass [ppm])2 
A0524PFN1Profilin IIPI00216691AGWNAYIDNLMADGTCQDAAIVGYK3.2 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR1.7 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR2.4 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR1 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR0.4 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR1.3 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR2.6 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR0.5 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR0.7 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AGYIIPLQGPGLTTTESR0 (delta mass [ppm])2 
A8024TRHDE, UNQ2507/PRO5995, UNQ2507Thyrotropin-releasing hormone degrading ectoenzymeIPI00007798AGYLPQNIPLEIIR1.7 (delta mass [ppm])2 
A8024TRHDE, UNQ2507/PRO5995, UNQ2507Thyrotropin-releasing hormone degrading ectoenzymeIPI00007798AGYLPQNIPLEIIR0.7 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR1.3 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR0.4 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR0.1 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR0.7 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR1.1 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113AGYQSTLTR2.5 (delta mass [ppm])2 
A1471VTNVitronectin precursorIPI00298971AGYVLHR0.2 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378AGYVLHR0.1 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378AGYVLHR0.2 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378AGYVLHR0.5 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378AGYVLHR0.3 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378AGYVLHR2 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AGYVLHR0.1 (delta mass [ppm])2 
A8826GUCA2BUroguanylin precursorIPI00003437AHELGGFTYETQASLSGPYLTSVMGK3.3 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR0.9 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR2.1 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR0.9 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR0.8 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR0.1 (delta mass [ppm])3 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR3.9 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR0 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AHFPLDVQWNDLDYMDSR1.7 (delta mass [ppm])3 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860AHFSISNSAED0.6 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAED1.6 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAED2.3 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAED2.7 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAED2.5 (delta mass [ppm])2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860AHFSISNSAEDPFIAIHAESK1.1 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK1.6 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK2.5 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK3 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK0.4 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK3.7 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK2.5 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESK2.9 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00480034AHFSISNSAEDPFIAIHAESK0.6 (delta mass [ppm])3 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860AHFSISNSAEDPFIAIHAESKL2.3 (delta mass [ppm])4 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESKL2.5 (delta mass [ppm])4 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESKL2.5 (delta mass [ppm])4 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESKL1.2 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AHFSISNSAEDPFIAIHAESKL2.5 (delta mass [ppm])3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR0.4 (delta mass [ppm])3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR0.2 (delta mass [ppm])3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AHFSPSNIILDFPAAGSAAR2.7 (delta mass [ppm])2 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605AHFWTWTNSWENFR0.1 (delta mass [ppm])3 
A1584COL4A1Collagen alpha 1(IV) chain precursorIPI00021034AHGQDLGTAGSCLR2.9 (delta mass [ppm])2 
A1673COL4A5Collagen alpha 5(IV) chain precursorIPI00021715AHGQDLGTAGSCLR0.4 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR0.1 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR0.6 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR2.6 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR2.8 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR4.3 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR1.4 (delta mass [ppm])2 
A114ASECTM1, K12Secreted and transmembrane protein 1 precursorIPI00170635AHGQESAIFNEVAPGYFSR0 (delta mass [ppm])3 
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseIPI00220993AHITLGCAADVEAVQTGLDLLEILR2.5 (delta mass [ppm])3 
A1521VWF, F8VWFVon Willebrand factor precursorIPI00023014AHLLSLVDVMQR0.2 (delta mass [ppm])3 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AHLMSQPLAYHTPDCNK2.5 (delta mass [ppm])3 
A4573ANXA11, ANX11Annexin A11IPI00185600AHLVAVFNEYQR1.8 (delta mass [ppm])2 
A4573ANXA11, ANX11Annexin A11IPI00185600AHLVAVFNEYQR2.3 (delta mass [ppm])2 
A1670COL4A2Collagen alpha 2(IV) chain precursorIPI00306322AHNQDLGLAGSCLAR4.9 (delta mass [ppm])3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479169AHNQDLGLAGSCLAR0.6 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751AHSDGGDGVVSQVK0.1 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751AHSDGGDGVVSQVK1.9 (delta mass [ppm])2 
A953D cDNA FLJ26785 fis, clone PRS04357IPI00442743AHSISLLK4.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AHSSAGQQVAR0.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AHSSAGQQVAR0.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AHSSAGQQVAR2 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AHSSAGQQVAR0 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AHSSAGQQVAR0 (delta mass [ppm])3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AHSSMVGVNLPQK0.1 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AHSSMVGVNLPQK2.7 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383AHSSMVGVNLPQK1.9 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AHTEGVTVVR1.3 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AHTEGVTVVR4 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AHTEGVTVVR2.1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLK1.2 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK2.8 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK3.9 (delta mass [ppm])4 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK3.4 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK3.5 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK1.9 (delta mass [ppm])4 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK4.2 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK2.7 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSK1.4 (delta mass [ppm])3 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AIAEELAPER1.5 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AIAEELAPER0.1 (delta mass [ppm])2 
A5926BHMTBetaine-homocysteine S-methyltransferase 1IPI00004101AIAEELAPER3.7 (delta mass [ppm])2 
A5927BHMT2Betaine-homocysteine methyltransferase 2IPI00014363AIAEELAPER0.7 (delta mass [ppm])2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476AIAELGIYPAVDPLDSTSR1.4 (delta mass [ppm])2 
A7149MME, EPNNeprilysinIPI00247063AIAQLNSK1.2 (delta mass [ppm])2 
A7149MME, EPNNeprilysinIPI00247063AIAQLNSK0.1 (delta mass [ppm])2 
A7149MME, EPNNeprilysinIPI00247063AIAQLNSK0.2 (delta mass [ppm])2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicIPI00291005AICDHVR0.4 (delta mass [ppm])2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicIPI00291005AICDHVR2.1 (delta mass [ppm])2 
A9806CAMP, CAP18, FALL39Cathelicidin antimicrobial peptide precursorIPI00292532AIDGINQR0.1 (delta mass [ppm])2 
A9806CAMP, CAP18, FALL39Cathelicidin antimicrobial peptide precursorIPI00292532AIDGINQR1.1 (delta mass [ppm])2 
A9806CAMP, CAP18, FALL39Cathelicidin antimicrobial peptide precursorIPI00292532AIDGINQR1.4 (delta mass [ppm])2 
A9806CAMP, CAP18, FALL39Cathelicidin antimicrobial peptide precursorIPI00292532AIDGINQR0.9 (delta mass [ppm])2 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605AIDGLNLLPTLLQGR0.8 (delta mass [ppm])2 
A701CVPS4B, SKD1, VPS42Vacuolar sorting protein 4bIPI00182728AIDLASK1.8 (delta mass [ppm])2 
A1226ST13, FAM10A1, HIPSuppression of tumorigenicity 13IPI00032826AIDLFTDAIK0.5 (delta mass [ppm])2 
A700CVPS4A, VPS4, VPS4-1Vacuolar protein sorting factor 4AIPI00411356AIDLVTK0.6 (delta mass [ppm])1 
A0641TSPAN3, TM4SF8, TSPAN-3Transmembrane 4 superfamily, member 8IPI00030941AIDYVQR1.2 (delta mass [ppm])2 
A0641TSPAN3, TM4SF8, TSPAN-3Transmembrane 4 superfamily, member 8IPI00030941AIDYVQR0.4 (delta mass [ppm])2 
A1628C9Complement component C9 precursorIPI00022395AIEDYINEFSVR2.4 (delta mass [ppm])2 
A1628C9Complement component C9 precursorIPI00022395AIEDYINEFSVR0.2 (delta mass [ppm])2 
A6663GSSGlutathione synthetaseIPI00010706AIENELLAR4.4 (delta mass [ppm])2 
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 7IPI00033600AIENIDTLTNLESLFLGK1.3 (delta mass [ppm])2 
A0981PPP1R7, SDS22Protein phosphatase 1, regulatory subunit 7IPI00033600AIENIDTLTNLESLFLGK0.6 (delta mass [ppm])2 
A6588GGCT, CRF21Gamma-glutamylcyclotransferaseIPI00031564AIEPNDYTGK1.3 (delta mass [ppm])2 
A6588GGCT, CRF21Gamma-glutamylcyclotransferaseIPI00031564AIEPNDYTGK1.8 (delta mass [ppm])2 
A7800SETDB2, CLLD8, KMT1FHistone-lysine N-methyltransferase SETDB2IPI00045922AIEVQIQK0.2 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK0.6 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK2 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK1.2 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK0.2 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK2.6 (delta mass [ppm])2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229AIGAVPLIQGEYMIPCEK3.7 (delta mass [ppm])2 
A1149SEMA5A, SEMAFSemaphorin 5A precursorIPI00013880AIGGGLSSVGGGSSTIK1.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AIGGGLSSVGGGSSTIK0.2 (delta mass [ppm])2 
A4804FBLN5, DANCE, UNQ184/PRO210Fibulin-5 precursorIPI00294615AIGGGLSSVGGGSSTIK0.5 (delta mass [ppm])2 
A979BFABP1, FABPLFatty acid-binding protein, liverIPI00010290AIGLPEELIQK0.4 (delta mass [ppm])2 
A979BFABP1, FABPLFatty acid-binding protein, liverIPI00010290AIGLPEELIQK2.4 (delta mass [ppm])2 
A979BFABP1, FABPLFatty acid-binding protein, liverIPI00010290AIGLPEELIQK0.6 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AIGYATAADCGR0.7 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AIGYATAADCGR1 (delta mass [ppm])2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473AIGYLNTGYQR1.1 (delta mass [ppm])2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003AIGYLNTGYQR0.7 (delta mass [ppm])2 
A1602CFB, BF, BFDComplement factor B precursorIPI00019591AIHCPRPHDFENGEYWPR2.4 (delta mass [ppm])4 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVR2.1 (delta mass [ppm])6 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVR2 (delta mass [ppm])5 
A7379PGPEP1, PGPIPyroglutamyl-peptidase 1IPI00020539AIIEEMLDLLEQSEGK1.9 (delta mass [ppm])3 
A7367CPQ, PGCP, LCH1Blood plasma glutamate carboxypeptidase precursorIPI00005794AIINLAVYGK1.1 (delta mass [ppm])2 
A7367CPQ, PGCP, LCH1Blood plasma glutamate carboxypeptidase precursorIPI00005794AIINLAVYGK4.4 (delta mass [ppm])2 
A7367CPQ, PGCP, LCH1Blood plasma glutamate carboxypeptidase precursorIPI00005794AIINLAVYGK2.9 (delta mass [ppm])2 
A376CSLC12A3, TSCSolute carrier family 12 member 3IPI00216438AIISLLSK1.3 (delta mass [ppm])2 
A0170MCF2L, BRSK2Guanine nucleotide exchange factor DBSIPI00004536AILDAASQK0.4 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AILDKLHNLNSNWFPAGSK0.2 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AILDKLHNLNSNWFPAGSK1.4 (delta mass [ppm])3 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476AILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIK1.3 (delta mass [ppm])4 
A6532FUCA2, UNQ227/PRO260, RPQE227Plasma alpha-L-fucosidase precursorIPI00012440AILGATEVK1.5 (delta mass [ppm])2 
A2134PWP2, PWP2HPeriodic tryptophan protein 2 homologIPI00300078AILMALR3.8 (delta mass [ppm])2 
A6666GSTA2, GST2Glutathione S-transferase A2IPI00655854AILNYIASK1.6 (delta mass [ppm])2 
A6666GSTA2, GST2Glutathione S-transferase A2IPI00655854AILNYIASK0.2 (delta mass [ppm])2 
A6666GSTA2, GST2Glutathione S-transferase A2IPI00655854AILNYIASK1.4 (delta mass [ppm])2 
A6666GSTA2, GST2Glutathione S-transferase A2IPI00655854AILNYIASK0.1 (delta mass [ppm])2 
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorIPI00437751AILQFYPK1.3 (delta mass [ppm])2 
A1805ACE, DCP, DCP1Angiotensin-converting enzyme, somatic isoform precursorIPI00437751AILQFYPK0.3 (delta mass [ppm])2 
A389D Uncharacterized proteinIPI00163459AILVDLEPGTMDSVR2.9 (delta mass [ppm])2 
A1591SERPING1, C1IN, C1NHSerine/cysteine proteinase inhibitor clade G member 1IPI00291866AIMEKLEMSK0.1 (delta mass [ppm])2 
A5983CTSC, CPPIDipeptidyl-peptidase 1 precursorIPI00022810AINAIQK0.1 (delta mass [ppm])2 
A7522PSMA6, PROS27Proteasome subunit alpha type 6IPI00029623AINQGGLTSVAVR0.9 (delta mass [ppm])2 
A7522PSMA6, PROS27Proteasome subunit alpha type 6IPI00029623AINQGGLTSVAVR1.8 (delta mass [ppm])2 
A0098VCLVinculinIPI00291175AIPDLTAPVAAVQAAVSNLVR1.1 (delta mass [ppm])2 
A6200CPPED1, CSTP1Calcineurin-like phosphoesterase domain-containing protein 1IPI00305010AIPLVLVSGNHDIGNTPTAETVEEFCR0.8 (delta mass [ppm])3 
A0609EGFPro-epidermal growth factor precursorIPI00000073AIPVAQDLNAPSDWDSR0.4 (delta mass [ppm])2 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00306339AIPVAQDLNAPSDWDSR0.6 (delta mass [ppm])2 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00306339AIPVAQDLNAPSDWDSR2.5 (delta mass [ppm])2 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00306339AIPVAQDLNAPSDWDSR3.1 (delta mass [ppm])2 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00218874AIPVAQDLNAPSDWDSR2.2 (delta mass [ppm])2 
A1567MADCAM1, MADCAM-1Mucosal addressin cell adhesion molecule-1 precursorIPI00289931AIPVAQDLNAPSDWDSR1.5 (delta mass [ppm])2 
A2452LRRC19Leucine-rich repeat-containing protein 19 precursorIPI00009653AIPVAQDLNAPSDWDSR0.7 (delta mass [ppm])2 
A2624PTPRS, PTPsigma, BPTP-2Receptor-type protein-tyrosine phosphatase S precursorIPI00289831AIPVAQDLNAPSDWDSR3.4 (delta mass [ppm])2 
A3490CNTFRCiliary neurotrophic factor receptor alpha precursorIPI00003102AIPVAQDLNAPSDWDSR1.8 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AIPVAQDLNAPSDWDSR2.2 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150AIPVAQDLNAPSDWDSR0.4 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192AIPVAQDLNAPSDWDSRGK0.2 (delta mass [ppm])2 
A7367CPQ, PGCP, LCH1Blood plasma glutamate carboxypeptidase precursorIPI00005794AIQIMYQNLQQDGLEK1.3 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766AIQYQQHFSR2 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766AIQYQQHFSR0.3 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AISGLTIDGHAVGAK1.6 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956AISGLTIDGHAVGAK1.9 (delta mass [ppm])2 
A8868LTBP2, LTBP-2, LTBP3Latent-transforming growth factor beta-binding protein 2IPI00292150AISMLQGLCYR0.7 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AISQSGVALSPWVIQK2.3 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AISQSGVALSPWVIQK2.7 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AISQSGVALSPWVIQK1.3 (delta mass [ppm])3 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AISQSGVALSPWVIQK2.2 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AISSIGLECQSVTSR1.9 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AISSIGLECQSVTSR0.5 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AISSIGLECQSVTSR0.4 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AISSIGLECQSVTSR0 (delta mass [ppm])2 
A088ARETN, FIZZ3, HXCP1Resistin precursorIPI00006988AISSIGLECQSVTSR0.1 (delta mass [ppm])2 
A9130UBE2V1, CROC1, UBE2VUbiquitin-conjugating enzyme E2 variant 1IPI00019599AISVLAK0.1 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933AITGFDDPFSGK0.5 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AITQEQCEAR0.4 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AITQEQCEAR2.8 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AITQEQCEAR2.2 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AITQEQCEAR1.1 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AITQVSK0.1 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AITQVSK0.2 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AITQVSK0.9 (delta mass [ppm])2 
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIPI00016915AITQVSK0.7 (delta mass [ppm])2 
A084ARAB11B, YPT3Ras-related protein Rab-11BIPI00020436AITSAYYR0.9 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563AIVDVHFDPTTAFR0.8 (delta mass [ppm])3 
A142D Hypothetical proteinIPI00018808AIVKEKMVSNTK5 (delta mass [ppm])3 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292AIVLDPCQGYLYWADWDTHAK2.4 (delta mass [ppm])2 
A0399ATP6V1B1, ATP6B1, VATBV-type proton ATPase subunit B, kidney isoformIPI00418418AIVQVFEGTSGIDAR2.2 (delta mass [ppm])2 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorIPI00022314AIWNVINWENVTER0.1 (delta mass [ppm])2 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorIPI00022314AIWNVINWENVTER1.8 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AKAYLEEECPATLR0.3 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359AKEAQDDLVK0.2 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327AKEQTFMFPENQPVSSLVTTITGSSLR1 (delta mass [ppm])3 
A8683ATRN, MGCAAttractin precursorIPI00162735AKEQYAVVGHSAHIVTLK1 (delta mass [ppm])3 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AKGFYISK1.3 (delta mass [ppm])2 
A8400CSTB, CST6, STFBCystatin BIPI00021828AKHDELTYF2.1 (delta mass [ppm])2 
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorIPI00179330AKIQDKEGIPPDQQR1 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR1.8 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR0.4 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR0.6 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR0.4 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AKLEEQAQQIR2.5 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793AKLGNFPWQAFTSIHGR1.8 (delta mass [ppm])3 
A9149GCVitamin D-binding protein precursorIPI00555812AKLPDATPK0.7 (delta mass [ppm])2 
A9149GCVitamin D-binding protein precursorIPI00555812AKLPDATPK1 (delta mass [ppm])2 
A9149GCVitamin D-binding protein precursorIPI00555812AKLPDATPK2.4 (delta mass [ppm])2 
A250CNUCB1, NUC, CALNUCNucleobindin 1 precursorIPI00295542AKMDAEQDPNVQVDHLNLLK0.9 (delta mass [ppm])3 
A3886OPCML, IGLON1, OBCAMOpioid binding protein/cell adhesion molecule precursorIPI00001662AKNTGVSVGQK2 (delta mass [ppm])2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorIPI00384016AKPAEAPAAAAPK1 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AKPALEDLR1 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AKPALEDLR0.9 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AKPALEDLR0.1 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AKPALEDLR0.9 (delta mass [ppm])3 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841AKPALEDLR0.7 (delta mass [ppm])3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887AKPSAPVVSGPAAR1.4 (delta mass [ppm])2 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887AKPSAPVVSGPAAR1.1 (delta mass [ppm])3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887AKPSAPVVSGPAAR1.1 (delta mass [ppm])2 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887AKPSAPVVSGPAAR2.1 (delta mass [ppm])2 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887AKPSAPVVSGPAAR2.6 (delta mass [ppm])3 
A9055SIRPB1Signal-regulatory protein beta-1IPI00299724AKPSAPVVSGPAVR0.6 (delta mass [ppm])2 
A9055SIRPB1Signal-regulatory protein beta-1IPI00299724AKPSAPVVSGPAVR2.9 (delta mass [ppm])2 
A9055SIRPB1Signal-regulatory protein beta-1IPI00299724AKPSAPVVSGPAVR2.3 (delta mass [ppm])2 
A9055SIRPB1Signal-regulatory protein beta-1IPI00412212AKPSAPVVSGPAVR0.1 (delta mass [ppm])2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541AKQDMACLLK1.4 (delta mass [ppm])2 
A903ARAVER1Ribonucleoprotein PTB-binding 1IPI00217670AKSDLLGK3 (delta mass [ppm])2 
A0641TSPAN3, TM4SF8, TSPAN-3Transmembrane 4 superfamily, member 8IPI00030941AKVENEVDR2.5 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AKWDAWNELK1.7 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AKWDAWNELK1.1 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AKWEMPFDPQDTHQSR0.6 (delta mass [ppm])4 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AKWETSFNHK0.1 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AKWETSFNHK0.4 (delta mass [ppm])3 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AKWETSFNHK0.5 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AKWETSFNHK1.6 (delta mass [ppm])2 
A1523ITGB6Integrin beta-6 precursorIPI00000151AKWQTGTNPLYR4.4 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY1.3 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY1.7 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY1.6 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AKYPDYEVTWANDGY0.8 (delta mass [ppm])2 
A702DLYPD2, LYPDC2, UNQ430/PRO788LY6/PLAUR domain-containing protein 2 precursorIPI00066856ALAAGGVGSIVR0.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787ALAAKPGLDTYSLGGGGAAR1.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787ALAAKPGLDTYSLGGGGAAR2.6 (delta mass [ppm])2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590ALAEDVK0.5 (delta mass [ppm])2 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590ALAEDVK1.6 (delta mass [ppm])2 
A6663GSSGlutathione synthetaseIPI00010706ALAEGVLLR0.9 (delta mass [ppm])2 
A7947TALH, TALDO1, TALTransaldolaseIPI00550488ALAGCDFLTISPK1.1 (delta mass [ppm])2 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ALAGNPK0.8 (delta mass [ppm])2 
A504CSHBGSex hormone-binding globulin precursorIPI00023019ALALPPLGLAPLLNLWAK1.6 (delta mass [ppm])3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ALANSLACQGK1.5 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ALANSLACQGK3.1 (delta mass [ppm])2 
A549DIGFBP3, IBP3Insulin-like growth factor binding protein 3 precursorIPI00018305ALAQCAPPPAVCAELVR1.8 (delta mass [ppm])2 
A549DIGFBP3, IBP3Insulin-like growth factor binding protein 3 precursorIPI00018305ALAQCAPPPAVCAELVR0.3 (delta mass [ppm])2 
A549DIGFBP3, IBP3Insulin-like growth factor binding protein 3 precursorIPI00018305ALAQCAPPPAVCAELVR2 (delta mass [ppm])3 
A7447NAPRT1, FHIP, PP3856Nicotinate phosphoribosyltransferase-like proteinIPI00465085ALAQLSLSR2.1 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221ALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTK1.8 (delta mass [ppm])3 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221ALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTK0.9 (delta mass [ppm])3 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221ALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTK2.3 (delta mass [ppm])3 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR0.1 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR0.5 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR2.4 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR1.5 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR0.9 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR1 (delta mass [ppm])2 
A043APGLYRP1, PGLYRP, PGRPPeptidoglycan recognition protein 1IPI00021085ALASECAQHLSLPLR0.7 (delta mass [ppm])2 
A5503TWSG1, TSGTwisted gastrulation-like protein precursorIPI00410487ALCASDVSK0.1 (delta mass [ppm])2 
A5503TWSG1, TSGTwisted gastrulation-like protein precursorIPI00410487ALCASDVSK1.5 (delta mass [ppm])2 
A5503TWSG1, TSGTwisted gastrulation-like protein precursorIPI00410487ALCASDVSK0 (delta mass [ppm])2 
A5503TWSG1, TSGTwisted gastrulation-like protein precursorIPI00410487ALCASDVSK3.9 (delta mass [ppm])2 
A5651ABP1, AOC1, DAO1Amiloride-sensitive amine oxidase [copper-containing] precursorIPI00020982ALCLFEMPTGVPLR2.6 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2.1 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK0 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK2.7 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1.9 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK0.3 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNK1.1 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNKASNDMYHSR0.6 (delta mass [ppm])3 
A8401CST3Cystatin C precursorIPI00032293ALDFAVGEYNKASNDMYHSR0.9 (delta mass [ppm])3 
A2344ACTN4Alpha-actinin 4IPI00013808ALDFIASK1.7 (delta mass [ppm])2 
A7773AHCY, SAHHAdenosylhomocysteinaseIPI00012007ALDIAENEMPGLMR2.1 (delta mass [ppm])2 
A7773AHCY, SAHHAdenosylhomocysteinaseIPI00012007ALDIAENEMPGLMR3.7 (delta mass [ppm])2 
A351CRBP2, CRBP2Retinol-binding protein II, cellularIPI00419986ALDIDFATR0.2 (delta mass [ppm])2 
A1611HRGHistidine-rich glycoprotein precursorIPI00022371ALDLINK3.8 (delta mass [ppm])2 
A1611HRGHistidine-rich glycoprotein precursorIPI00022371ALDLINKR0.5 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327ALDYELCQK2.1 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327ALDYELCQK0.5 (delta mass [ppm])2 
A6321SORD, SORDLSorbitol dehydrogenaseIPI00216057ALEAFETFK0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALEEANADLEVK1.8 (delta mass [ppm])2 
A5734hAO, AOX1, AOAldehyde oxidaseIPI00642489ALEEANADLEVK0.2 (delta mass [ppm])2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00455326ALEEANTELEVK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALEESNYELEGK0.3 (delta mass [ppm])2 
A182AVMO1, UNQ6350/PRO21055, UNQ6350Vitteline membrane outer layer protein 1 homolog precursorIPI00216914ALEESNYELEGK0.5 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327ALEESNYELEGK1.7 (delta mass [ppm])2 
A3849KRT1, KRTAKeratin, type II cytoskeletal 1IPI00220327ALEESNYELEGK0.7 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088ALEESNYELEGK1.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ALEESNYELEGK0.7 (delta mass [ppm])2 
A8856LGALS9, HUATGalectin-9IPI00010477ALEESNYELEGK1.1 (delta mass [ppm])2 
A9149GCVitamin D-binding protein precursorIPI00555812ALEESNYELEGK2.3 (delta mass [ppm])2 
A3166MYH9Myosin heavy chain 9, non-muscleIPI00019502ALELDSNLYR2 (delta mass [ppm])2 
A5770GPT, AAT1, GPT1Alanine aminotransferase 1IPI00217458ALELEQELR2.2 (delta mass [ppm])2 
A5086LCP1, PLS2Plastin-2IPI00010471ALENDPDCR1.5 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALENPQPHPGWQGTLK2.2 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALENPQPHPGWQGTLK0.8 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALENPQPHPGWQGTLK0.2 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALEPQGLLLYNGNAR2 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALEPQGLLLYNGNAR1.9 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0.1 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0.2 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0.3 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0.9 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224ALEQALEK0.2 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALESPERPFLAILGGAK0.3 (delta mass [ppm])3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALESPERPFLAILGGAK2.1 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALESPERPFLAILGGAK1.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ALEVEECR0.2 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ALEVEECR1.2 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ALEVEECR3.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ALEVEECR0.7 (delta mass [ppm])2 
A1411IGM, SNC73, IGHA1Ig alpha-1 chain C regionIPI00550663ALEWLAR0.1 (delta mass [ppm])2 
A5489TMEM176B, LR8Transmembrane protein 176BIPI00106808ALFLAVCVLK1.3 (delta mass [ppm])2 
A4642ALCAM, MEMDCD166 antigen precursorIPI00015102ALFLETEQLK1.6 (delta mass [ppm])2 
A989BFTL, FTLvariantFerritin light chainIPI00375676ALFQDIK0.5 (delta mass [ppm])2 
A989BFTL, FTLvariantFerritin light chainIPI00375676ALFQDIK0.2 (delta mass [ppm])2 
A989BFTL, FTLvariantFerritin light chainIPI00375676ALFQDIK2 (delta mass [ppm])2 
A9249NPRC, NPR3, ANPRCAtrial natriuretic peptide receptor 3IPI00013826ALFSLVDR0.9 (delta mass [ppm])2 
A7701RNF167, LP2254E3 ubiquitin-protein ligase RNF167IPI00023511ALFVYEK2.2 (delta mass [ppm])2 
A7701RNF167, LP2254E3 ubiquitin-protein ligase RNF167IPI00023511ALFVYEK0.1 (delta mass [ppm])2 
A6903LIPT2Putative Octanoyltransferase, mitochondrialIPI00398926ALGAEVR0.6 (delta mass [ppm])2 
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorIPI00022417ALGHLDLSGNR0.7 (delta mass [ppm])3 
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorIPI00022417ALGHLDLSGNR3.9 (delta mass [ppm])2 
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorIPI00022417ALGHLDLSGNR1.8 (delta mass [ppm])2 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432ALGISPFHEHAEVVFTANDSGPR1.4 (delta mass [ppm])3 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432ALGISPFHEHAEVVFTANDSGPR1 (delta mass [ppm])3 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432ALGISPFHEHAEVVFTANDSGPR4.3 (delta mass [ppm])4 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432ALGISPFHEHAEVVFTANDSGPR3.9 (delta mass [ppm])3 
A648CTTR, PALB, TBPATransthyretin precursorIPI00022432ALGISPFHEHAEVVFTANDSGPR0.2 (delta mass [ppm])3 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150ALGITEIFIK2.2 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150ALGITEIFIK1.3 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150ALGITEIFIK2.6 (delta mass [ppm])2 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDD1.6 (delta mass [ppm])2 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDDPPR1.5 (delta mass [ppm])3 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDDPPR0.9 (delta mass [ppm])2 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDDPPR1.9 (delta mass [ppm])2 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDDPPR1.9 (delta mass [ppm])2 
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinIPI00217253ALGNNFYEYYVDDPPR0.8 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALGPAGCEADASAPATCAEMR1.9 (delta mass [ppm])2 
A165CMYL6B, MLC1SAMyosin light chain 6BIPI00027255ALGQNPTNAEVLK0.5 (delta mass [ppm])2 
A165CMYL6B, MLC1SAMyosin light chain 6BIPI00027255ALGQNPTNAEVLK0.9 (delta mass [ppm])2 
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorIPI00001593ALGSLHLPTNPTSLPAVAK0.4 (delta mass [ppm])3 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095ALGSVGPVDLLVNNAAVALLQPFLEVTK3.2 (delta mass [ppm])3 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095ALGSVGPVDLLVNNAAVALLQPFLEVTK4 (delta mass [ppm])3 
A3688CSCitrate synthase, mitochondrial precursorIPI00025366ALGVLAQLIWSR1.7 (delta mass [ppm])2 
A8406CST4Cystatin S precursorIPI00032294ALHFAISEYNK1 (delta mass [ppm])2 
A8406CST4Cystatin S precursorIPI00032294ALHFAISEYNK1.5 (delta mass [ppm])2 
A8406CST4Cystatin S precursorIPI00032294ALHFAISEYNK0.4 (delta mass [ppm])2 
A8407CST2Cystatin SA precursorIPI00013382ALHFVISEYNK1.1 (delta mass [ppm])2 
A8407CST2Cystatin SA precursorIPI00013382ALHFVISEYNK1.3 (delta mass [ppm])2 
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevicanIPI00456623ALHPEED1.3 (delta mass [ppm])2 
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevicanIPI00456623ALHPEEDPEGR2.1 (delta mass [ppm])2 
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevicanIPI00456623ALHPEEDPEGR1.4 (delta mass [ppm])2 
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1IPI00007321ALIDQEVK1.2 (delta mass [ppm])2 
A526CSNX5Sorting nexin 5IPI00455834ALIDYENSNEALDK3.2 (delta mass [ppm])2 
A0029ANXA6, ANX6Annexin A6IPI00002459ALIEILATR0.2 (delta mass [ppm])2 
A774DOAF, NS5ATP13TP2Out at first protein homolog precursorIPI00328703ALILGELEK1.7 (delta mass [ppm])2 
A774DOAF, NS5ATP13TP2Out at first protein homolog precursorIPI00328703ALILGELEK0.1 (delta mass [ppm])2 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainIPI00413728ALINADELASDVAGAEALLDR1 (delta mass [ppm])3 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR0.9 (delta mass [ppm])2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR0.2 (delta mass [ppm])2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR1.4 (delta mass [ppm])2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR1.4 (delta mass [ppm])2 
A6350DNASE2, DNASE2A, DNL2Deoxyribonuclease-2 alphaIPI00010348ALINSPEGAVGR0.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00022890ALIYSTSNK0.6 (delta mass [ppm])2 
A5268AMN, UNQ513, UNQ513/PRO1028Protein amnionlessIPI00008857ALLADVAENGEALGVLEATMR0.7 (delta mass [ppm])3 
A004CGLTPGlycolipid transfer proteinIPI00184363ALLAEHLLKPLPADK1.2 (delta mass [ppm])3 
A004CGLTPGlycolipid transfer proteinIPI00184363ALLAEHLLKPLPADK1 (delta mass [ppm])3 
A925BCUBN, IFCRCubilinIPI00160130ALLATGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSR2.8 (delta mass [ppm])4 
A925BCUBN, IFCRCubilinIPI00160130ALLATGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSR0.5 (delta mass [ppm])3 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003ALLAYAFALAGNQDK0.6 (delta mass [ppm])2 
A8390SERPINA6, CBGCorticosteroid-binding globulin precursorIPI00027482ALLAYAFALAGNQDK2.6 (delta mass [ppm])2 
A3804EEF2, EF2Elongation factor 2IPI00186290ALLELQLEPEELYQTFQR1.5 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ALLETSEK0.1 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ALLETSEK0.2 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ALLETSEK1.2 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ALLETSEK1.3 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ALLETSEK3.2 (delta mass [ppm])2 
A4981MSLN, MPFMesothelin precursorIPI00025110ALLEVNK1 (delta mass [ppm])2 
A7523PSMA7, HSPCProteasome subunit alpha type 7IPI00024175ALLEVVQSGGK0.1 (delta mass [ppm])2 
A7523PSMA7, HSPCProteasome subunit alpha type 7IPI00024175ALLEVVQSGGK2.2 (delta mass [ppm])2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00334775ALLFIPR0.1 (delta mass [ppm])2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470ALLFVPR1 (delta mass [ppm])2 
A4576ANXA5, ANX5, ENX2Annexin A5IPI00329801ALLLLCGEDD2.2 (delta mass [ppm])1 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALLLLNPASFSIQLTPGGGPLSLR0.3 (delta mass [ppm])3 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALLLLNPASFSIQLTPGGGPLSLR3.6 (delta mass [ppm])2 
A5300CRB2CRUMBS protein homolog 2 precursorIPI00410585ALLNELASVK0.1 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243ALLNVVDNAR0 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243ALLNVVDNAR2.2 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243ALLNVVDNAR4.4 (delta mass [ppm])2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243ALLNVVDNAR0.5 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933ALLQAILQTEDMLK2.9 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933ALLQAILQTEDMLK2.7 (delta mass [ppm])2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2.8 (delta mass [ppm])2 
A5744GLA, alpha-GalAGalactosidase, alphaIPI00025869ALLQDKDVIAINQDPLGK2 (delta mass [ppm])3 
A6720HEXABeta-hexosaminidase subunit alphaIPI00027851ALLSAPWYLNR0.3 (delta mass [ppm])2 
A6720HEXABeta-hexosaminidase subunit alphaIPI00027851ALLSAPWYLNR2.9 (delta mass [ppm])2 
A6720HEXABeta-hexosaminidase subunit alphaIPI00027851ALLSAPWYLNR0 (delta mass [ppm])2 
A6720HEXABeta-hexosaminidase subunit alphaIPI00027851ALLSAPWYLNR0.2 (delta mass [ppm])2 
A6720HEXABeta-hexosaminidase subunit alphaIPI00027851ALLSAPWYLNR1.5 (delta mass [ppm])2 
A4823FREM2FRAS1-related extracellular matrix protein 2 precursorIPI00180707ALLSPGLAGAAGVPAEEAIVLANR0.6 (delta mass [ppm])3 
A332DEPDR1, MERP1, UCC1Mammalian ependymin related protein-1 precursorIPI00259102ALLSYDGLNQR1.3 (delta mass [ppm])2 
A332DEPDR1, MERP1, UCC1Mammalian ependymin related protein-1 precursorIPI00259102ALLSYDGLNQR2 (delta mass [ppm])2 
A332DEPDR1, MERP1, UCC1Mammalian ependymin related protein-1 precursorIPI00259102ALLSYDGLNQR0.8 (delta mass [ppm])2 
A332DEPDR1, MERP1, UCC1Mammalian ependymin related protein-1 precursorIPI00259102ALLSYDGLNQR2.3 (delta mass [ppm])2 
A8385ANXA3, ANX3Annexin A3IPI00024095ALLTLADGR0.7 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842ALMDETMK1.1 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842ALMDETMK1.3 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842ALMDETMK0.8 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALMDEVVK0.9 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALMDEVVK0.7 (delta mass [ppm])2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383ALMDEVVK0.3 (delta mass [ppm])2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00554711ALMGSPQLVAAVVR0.2 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ALMLCEGLFVADVTDFEGWK0.5 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR0.9 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR0.6 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR0.7 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR2.2 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR3.6 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131ALMSPAGMLR1.1 (delta mass [ppm])2 
A824BAQP1, CHIP28Aquaporin 1IPI00024689ALMYIIAQCVGAIVATAILSGITSSLTGNSLGR4.3 (delta mass [ppm])3 
A478BGLG1, CFR1, ESL1Golgi apparatus protein 1 precursorIPI00414717ALNEACESVIQTACK0.1 (delta mass [ppm])2 
A7481CTSA, PPGBCathepsin AIPI00021794ALNIPEQLPQWDMCNFLVNLQYR0.1 (delta mass [ppm])3 
A7481CTSA, PPGBCathepsin AIPI00021794ALNIPEQLPQWDMCNFLVNLQYR1.9 (delta mass [ppm])3 
A1654MMP7, MPSL1, PUMP1Matrilysin precursorIPI00013400ALNMWGK0.2 (delta mass [ppm])1 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK1.1 (delta mass [ppm])2 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK1.5 (delta mass [ppm])2 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK0.7 (delta mass [ppm])2 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK0.4 (delta mass [ppm])2 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK1.5 (delta mass [ppm])3 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK1.6 (delta mass [ppm])3 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK0.6 (delta mass [ppm])3 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHK0.7 (delta mass [ppm])2 
A1550S100A8, CAGA, CFAGCalgranulin AIPI00007047ALNSIIDVYHKYSLIK1.5 (delta mass [ppm])3 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialIPI00024915ALNVEPDGTGLTCSLAPNIISQL1.8 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00472762ALPAPIEK0.8 (delta mass [ppm])1 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00472762ALPAPIEK1.1 (delta mass [ppm])2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00384938ALPAPIEK0.2 (delta mass [ppm])1 
A8363IGHM, IgIg mu chain CIPI00472610ALPAPIEK2.1 (delta mass [ppm])1 
A8363IGHM, IgIg mu chain CIPI00472610ALPAPIEK0.3 (delta mass [ppm])1 
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1IPI00645078ALPAVQQNNLDEDLIR0.4 (delta mass [ppm])2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00554711ALPELTK4.8 (delta mass [ppm])2 
A4853HMCN1, FIBL6, FIBL-6Hemicentin-1IPI00045512ALPFWNEEIVPQIK2.8 (delta mass [ppm])2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00177728ALPFWNEEIVPQIK0.5 (delta mass [ppm])2 
A7364PGAM2, PGAMMPhosphoglycerate mutase 2IPI00218570ALPFWNEEIVPQIK1.3 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK1.6 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK0.3 (delta mass [ppm])3 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK1.2 (delta mass [ppm])3 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ALPGQLKPFETLLSQNQGGK0.6 (delta mass [ppm])2 
A9964ISLR, UNQ189/PRO215, UNQ189Immunoglobulin superfamily containing leucine-rich repeat protein precursorIPI00023648ALPGTPVASSQPR1 (delta mass [ppm])2 
A9964ISLR, UNQ189/PRO215, UNQ189Immunoglobulin superfamily containing leucine-rich repeat protein precursorIPI00023648ALPGTPVASSQPR1.7 (delta mass [ppm])2 
A9964ISLR, UNQ189/PRO215, UNQ189Immunoglobulin superfamily containing leucine-rich repeat protein precursorIPI00023648ALPGTPVASSQPR0.8 (delta mass [ppm])2 
A9964ISLR, UNQ189/PRO215, UNQ189Immunoglobulin superfamily containing leucine-rich repeat protein precursorIPI00023648ALPGTPVASSQPR0.8 (delta mass [ppm])2 
A9964ISLR, UNQ189/PRO215, UNQ189Immunoglobulin superfamily containing leucine-rich repeat protein precursorIPI00023648ALPGTPVASSQPR4.8 (delta mass [ppm])2 
A8525VASN, SLITL2, UNQ314/PRO357/PRO1282VasorinIPI00395488ALPPLRLPR1 (delta mass [ppm])2 
A8525VASN, SLITL2, UNQ314/PRO357/PRO1282VasorinIPI00395488ALPPLRLPR1.9 (delta mass [ppm])2 
A696CVPS25, DERP9, EAP20Vacuolar protein sorting-associated protein 25IPI00031655ALQALQQEHK1.5 (delta mass [ppm])2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BIPI00218407ALQASALAAWGGK0.8 (delta mass [ppm])2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BIPI00218407ALQASALAAWGGK2.1 (delta mass [ppm])2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BIPI00218407ALQASALAAWGGK2.8 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ALQASALK0.4 (delta mass [ppm])1 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503ALQATVGNSYK1.6 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503ALQATVGNSYK0.4 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503ALQATVGNSYK1.8 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503ALQATVGNSYK0.8 (delta mass [ppm])2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503ALQATVGNSYK1.1 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760ALQDLGLR0 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760ALQDLGLR0 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760ALQDLGLR0.4 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760ALQDLGLR0 (delta mass [ppm])2 
A6256DDAH2, DDAH, G6ANG,NG-dimethylarginine dimethylaminohydrolase 2IPI00000760ALQDLGLR0.7 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ALQDQLVLVAAK0.3 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ALQDQLVLVAAK0.2 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ALQDQLVLVAAK4.3 (delta mass [ppm])2 
A1702AGT, SERPINA8AngiotensinogenIPI00032220ALQDQLVLVAAK3.6 (delta mass [ppm])2 
A3480RYR2, RyRRyanodine receptor 2IPI00023217ALQEMLANTVEKSEGQVDVEK3.9 (delta mass [ppm])3 
A374CSLC12A1, NKCC2Solute carrier family 12 member 1IPI00443898ALQFFAK0 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359ALQLEEER0.2 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359ALQLEEER2 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359ALQLEEER3.8 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359ALQLEEER0.3 (delta mass [ppm])2 
A4149LZTS1, FEZ1Leucine zipper putative tumor suppressor 1IPI00026058ALQQLAR1.4 (delta mass [ppm])2 
A4149LZTS1, FEZ1Leucine zipper putative tumor suppressor 1IPI00026058ALQQLAR0.8 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALQSNHFELSLR1.5 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALQSNHFELSLR2.2 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563ALQSNHFELSLR1.7 (delta mass [ppm])2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654ALQVTVPHFLDWSGEALQPTR1.3 (delta mass [ppm])3 
A7187NT5C, DNT1, UMPH25'(3')-deoxyribonucleotidase, cytosolic typeIPI00005573ALRPDLADK0.5 (delta mass [ppm])3 
A185BZC3H7A, ZC3H7, ZC3HDC7Zinc finger CCCH domain-containing protein 7AIPI00217355ALSDLGR2.8 (delta mass [ppm])2 
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolicIPI00002519ALSEALTELGYK0.8 (delta mass [ppm])2 
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolicIPI00002519ALSEALTELGYK0.8 (delta mass [ppm])2 
A6979MBTPS1, S1P, SKI1Membrane-bound transcription factor site-1 protease precursorIPI00021569ALSGTSVASPVVAGAVTLLVSTVQK1.9 (delta mass [ppm])3 
A0204FLNA, FLN, FLN1Filamin AIPI00302592ALSIGFETCR0.9 (delta mass [ppm])2 
A0821CD44, LHR, MDU2CD44 antigenIPI00305064ALSIGFETCR1 (delta mass [ppm])2 
A0821CD44, LHR, MDU2CD44 antigenIPI00305064ALSIGFETCR0.2 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439ALSIGFETCR1.2 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALSIGFETCR0.7 (delta mass [ppm])2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00383237ALSIGFETCR1.2 (delta mass [ppm])2 
A690CVPS37BVacuolar protein sorting-associated protein 37BIPI00002926ALSIGFETCR0 (delta mass [ppm])2 
A7515PRSS8Prostasin precursorIPI00329538ALSIGFETCR0.1 (delta mass [ppm])2 
A8050PRSS2, TRY2, TRYP2Protease serine 2IPI00011695ALSIGFETCR1.6 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992ALSIGFETCR1.2 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192ALSIGFETCR4.9 (delta mass [ppm])2 
A1705IGFBP5, IBP5Insulin-like growth factor binding protein 5 precursorIPI00029236ALSMCPPSPLGCELVK1.6 (delta mass [ppm])2 
A5314DLK1, DLK, FA1Protein delta homolog 1IPI00160384ALSPQQVTR0.9 (delta mass [ppm])2 
A5314DLK1, DLK, FA1Protein delta homolog 1IPI00160384ALSPQQVTR0.5 (delta mass [ppm])2 
A5314DLK1, DLK, FA1Protein delta homolog 1IPI00160384ALSPQQVTR3.9 (delta mass [ppm])2 
A3884NCAM1, NCAMNeural cell adhesion molecule 1, 120/140 kDa isoform precursorIPI00185362ALSSEWKPEIR0.2 (delta mass [ppm])2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00419585ALSTGEK2.5 (delta mass [ppm])1 
A521BLRRN4Leucine-rich repeat neuronal protein 4IPI00216345ALSTSELGHLEQLQVLTLR1.4 (delta mass [ppm])3 
A4848GCA, GCLGrancalcinIPI00004524ALTDFFR1.5 (delta mass [ppm])2 
A4848GCA, GCLGrancalcinIPI00004524ALTDFFR0 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK2.6 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK0.7 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK1.1 (delta mass [ppm])3 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALTGHLEEVVLALLK1.8 (delta mass [ppm])2 
A6716HPN, TMPRSS1Serine protease HepsinIPI00395826ALTHSELDVR0.4 (delta mass [ppm])2 
A6716HPN, TMPRSS1Serine protease HepsinIPI00395826ALTHSELDVR1.9 (delta mass [ppm])2 
A6716HPN, TMPRSS1Serine protease HepsinIPI00395826ALTHSELDVR0.8 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALTLAYK0 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALTLAYK1.6 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALTLAYK1 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALTLAYK1.5 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670ALTLAYK2.7 (delta mass [ppm])2 
A9789BDNF, BDNF 2-5, BDNF 1-5Brain-derived neurotrophic factor precursorIPI00012058ALTMDSKK4.9 (delta mass [ppm])2 
A437CSLC39A4, ZIP4Zinc transporter ZIP4IPI00015689ALTPGLSWLLQR1.3 (delta mass [ppm])2 
A6423ENDOD1Endonuclease domain-containing 1 protein precursorIPI00001952ALTPQCGSGEDLYILTGTVPSDYR0.1 (delta mass [ppm])2 
A0808MSNMoesinIPI00219365ALTSELANAR1.2 (delta mass [ppm])2 
A9060SRISorcinIPI00027175ALTTMGFR0.7 (delta mass [ppm])2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752ALTVPELTQQMFDAK0.6 (delta mass [ppm])2 
A4540TTYH3Protein tweety homolog 3IPI00438848ALVEMQDVVAELLR1.1 (delta mass [ppm])2 
A4540TTYH3Protein tweety homolog 3IPI00438848ALVEMQDVVAELLR3.6 (delta mass [ppm])2 
A1712LTF, LF, GIG12Lactotransferrin precursorIPI00298860ALVFVDNHDNQR1.4 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476ALVFVDNHDNQR1.9 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476ALVFVDNHDNQR2.4 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476ALVFVDNHDNQR2.9 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476ALVFVDNHDNQR0.9 (delta mass [ppm])2 
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorIPI00025476ALVFVDNHDNQR1.7 (delta mass [ppm])2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitIPI00298547ALVILAK0.5 (delta mass [ppm])2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitIPI00298547ALVILAK0.4 (delta mass [ppm])2 
A8415IL18BPInterleukin-18 binding protein precursorIPI00220525ALVLEQLTPALHSTNFSCVLVDPEQVVQR1.9 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK0.2 (delta mass [ppm])4 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK2.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK2.1 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK3.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK1.6 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK1.3 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK2.1 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK0.9 (delta mass [ppm])4 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK4.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK1.5 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK3.5 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK1.7 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ALVLIAFAQYLQQCPFEDHVK0.6 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALVQAQHPDWPAPQVEAVAQDQFQGAAR1.5 (delta mass [ppm])3 
A8403CST7Cystatin F precursorIPI00216569ALVQIVK1.3 (delta mass [ppm])2 
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorIPI00304273ALVQQMEQLR2.4 (delta mass [ppm])2 
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorIPI00304273ALVQQMEQLR1.6 (delta mass [ppm])2 
A810BAPOA4, ApoA-IV, APOA-IVApolipoprotein A-IV precursorIPI00304273ALVQQMEQLR0.6 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360ALVSAQWVAEALR1.4 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360ALVSAQWVAEALR2.6 (delta mass [ppm])2 
A0046GNA13Guanine nucleotide-binding protein, alpha-13 subunitIPI00290928ALWADSGIQNAYDR0.2 (delta mass [ppm])2 
A8814GNAS, GSA, GNAS1Guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1IPI00095891ALWEDEGVR1.2 (delta mass [ppm])2 
A8814GNAS, GSA, GNAS1Guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1IPI00095891ALWEDEGVR3.5 (delta mass [ppm])2 
A8438SERPINA4, KST, PI4Kallistatin precursorIPI00328609ALWEKPFISSR0.5 (delta mass [ppm])2 
A8438SERPINA4, KST, PI4Kallistatin precursorIPI00328609ALWEKPFISSR4.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ALYDAELSQMQTHISDTSVVLSMDNNR0.2 (delta mass [ppm])3 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918ALYEAGER1.3 (delta mass [ppm])2 
A7149MME, EPNNeprilysinIPI00247063ALYGTTSETATWR1 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601ALYLQYTDETFR0.8 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601ALYLQYTDETFR2.3 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601ALYLQYTDETFR2.4 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601ALYLQYTDETFR0.5 (delta mass [ppm])2 
A6042CPCeruloplasmin precursorIPI00017601ALYLQYTDETFR2.2 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALYPSIYMPAVLEGTGK2.5 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALYPSIYMPAVLEGTGK0.6 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALYPSIYMPAVLEGTGK2.2 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847ALYPSIYMPAVLEGTGK3.7 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ALYQLGMR0.9 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ALYQLGMR0.8 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ALYQLGMR0.4 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ALYQLGMR2.7 (delta mass [ppm])2 
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorIPI00012426ALYSDPK1.1 (delta mass [ppm])2 
A1631HPHaptoglobin precursorIPI00641737ALYVHGGYK0.9 (delta mass [ppm])2 
A8683ATRN, MGCAAttractin precursorIPI00162735ALYVHGGYK1.1 (delta mass [ppm])2 
A8683ATRN, MGCAAttractin precursorIPI00162735ALYVHGGYK0.4 (delta mass [ppm])2 
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorIPI00006114ALYYDLISSPDIHGTYK2.1 (delta mass [ppm])2 
A8448SERPINF1, PEDF, PIG35Pigment epithelium-derived factor precursorIPI00006114ALYYDLISSPDIHGTYK2.6 (delta mass [ppm])2 
A9074STOM, BND7, EPB72Erythrocyte band 7 integral membrane proteinIPI00219682AMAAEAEASR0.4 (delta mass [ppm])2 
A9074STOM, BND7, EPB72Erythrocyte band 7 integral membrane proteinIPI00219682AMAAEAEASR1.2 (delta mass [ppm])2 
A1924ALDOB, ALDBFructose-bisphosphate aldolase BIPI00218407AMANCQAAK1.9 (delta mass [ppm])2 
A697CVPS28, FP3517Vacuolar sorting protein 28IPI00007155AMDEIQPDLR0.4 (delta mass [ppm])2 
A697CVPS28, FP3517Vacuolar sorting protein 28IPI00007155AMDEIQPDLR2.2 (delta mass [ppm])2 
A697CVPS28, FP3517Vacuolar sorting protein 28IPI00007155AMDEIQPDLR1.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AMDFNGILTIR0 (delta mass [ppm])2 
A6802IP6K2, IHPK2, TCCCIA00113Inositol hexakisphosphate kinase 2IPI00426289AMDVEPR1.3 (delta mass [ppm])2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00177728AMEAVAAQGK1.8 (delta mass [ppm])2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00549725AMEAVAAQGK0.1 (delta mass [ppm])2 
A9693CCDC40Coiled-coil domain-containing protein 40IPI00288939AMELAVAR3.2 (delta mass [ppm])2 
A6321SORD, SORDLSorbitol dehydrogenaseIPI00216057AMGAAQVVVTDLSATR0.7 (delta mass [ppm])2 
A1467FGAFibrinogen alpha/alpha-E chain precursorIPI00021885AMGIMNSFVNDIFER0.8 (delta mass [ppm])2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101AMGIMNSFVNDIFER2.1 (delta mass [ppm])2 
A978BFABP2, FABPIFatty acid-binding protein 2, intestinalIPI00218477AMGIMNSFVNDIFER1.2 (delta mass [ppm])2 
A9867Em:AF200455.10, DEFA1, Em:AF200455.12Neutrophil defensin 1 precursorIPI00005721AMGIMNSFVNDIFER0.7 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AMIAYWTNFAK1.2 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AMIAYWTNFAK2.1 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AMIAYWTNFAK1.8 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AMIAYWTNFAK1.2 (delta mass [ppm])2 
A6039CEL, CELP, CELLBile salt-activated lipaseIPI00099670AMIAYWTNFAK1.9 (delta mass [ppm])2 
A0029ANXA6, ANX6Annexin A6IPI00002459AMKGLGTRDNTLIR2.7 (delta mass [ppm])2 
A6997MEP1AMeprin A alpha-subunit precursorIPI00004372AMLEEALPVSLSQGQPSR1 (delta mass [ppm])2 
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorIPI00001593AMLVFAEHR0.7 (delta mass [ppm])2 
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorIPI00001593AMLVFAEHR1.6 (delta mass [ppm])2 
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorIPI00001593AMLVFAEHR2.6 (delta mass [ppm])2 
A7313PRCP, PCPLysosomal Pro-X carboxypeptidase precursorIPI00001593AMLVFAEHR2.4 (delta mass [ppm])2 
A866BCETPCholesteryl ester transfer protein precursorIPI00006173AMMLLGQVK0.9 (delta mass [ppm])2 
A4577ANXA7, ANX7, SNXAnnexin A7IPI00002460AMQGAGTQER2.7 (delta mass [ppm])2 
A7518PSMA1, HC2, NUProteasome subunit alpha type 1IPI00016832AMSIGAR1 (delta mass [ppm])2 
A778DOTUD3OTU domain-containing protein 3IPI00158268AMSRKQAAK0.1 (delta mass [ppm])2 
A778DOTUD3OTU domain-containing protein 3IPI00158268AMSRKQAAK0.4 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764AMTHTLLR0.8 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764AMTHTLLR3.8 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AMVAFSMR0.7 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AMVAFSMR0.7 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131AMVGSDVELSCACPEGSR1.3 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131AMVGSDVELSCACPEGSR1.3 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131AMVGSDVELSCACPEGSR1.9 (delta mass [ppm])2 
A9938ICOSLG, B7H2, B7RP1ICOS ligand precursorIPI00219131AMVGSDVELSCACPEGSR2.7 (delta mass [ppm])2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918AMVSEFLK0.9 (delta mass [ppm])2 
A4634CAPG, AFCP, MCPGelsolin-like capping proteinIPI00643576ANAQAAALYK0.3 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ANDESNEHSDVIDSQELSK1.6 (delta mass [ppm])2 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00306339ANDESNEHSDVIDSQELSK0.2 (delta mass [ppm])3 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00218874ANDESNEHSDVIDSQELSK0.7 (delta mass [ppm])3 
A1530MRC1L1, CLEC13DL, MRC1Macrophage mannose receptor 1-like protein 1IPI00027848ANDESNEHSDVIDSQELSK1.1 (delta mass [ppm])3 
A2624PTPRS, PTPsigma, BPTP-2Receptor-type protein-tyrosine phosphatase S precursorIPI00289831ANDESNEHSDVIDSQELSK0.4 (delta mass [ppm])3 
A3490CNTFRCiliary neurotrophic factor receptor alpha precursorIPI00003102ANDESNEHSDVIDSQELSK5 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192ANDESNEHSDVIDSQELSK0.2 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150ANDESNEHSDVIDSQELSK4.4 (delta mass [ppm])3 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00234091ANDQAVPIETR1.6 (delta mass [ppm])2 
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1IPI00172579ANDTTFGLAAGVFTR1.6 (delta mass [ppm])2 
A7476ALPLAlkaline phosphatase, tissue-nonspecific isozyme precursorIPI00419916ANEGTVGVSAATER0.4 (delta mass [ppm])2 
A9370KIR2DS3, NKAT7Killer cell immunoglobulin-like receptor 2DS3 precursorIPI00001584ANFSIGRMR2 (delta mass [ppm])2 
A7450NP, PNP, PRO1837Purine nucleoside phosphorylaseIPI00017672ANHEEVLAAGK0.8 (delta mass [ppm])2 
A7450NP, PNP, PRO1837Purine nucleoside phosphorylaseIPI00017672ANHEEVLAAGK1.5 (delta mass [ppm])2 
A5789PAMPeptidyl-glycine alpha-amidating monooxygenase precursorIPI00177543ANILYAWAR0.6 (delta mass [ppm])2 
A0621RAB10Ras-related protein Rab-10IPI00016513ANINIEK1 (delta mass [ppm])2 
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8AIPI00028481ANINVENAFFTLAR1.8 (delta mass [ppm])2 
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8AIPI00028481ANINVENAFFTLAR3.1 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416ANIQAVSLK0 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416ANIQAVSLK1.8 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416ANIQAVSLK0.9 (delta mass [ppm])2 
A867BCHMP2A, BC2, CHMP2BC-2 proteinIPI00004416ANIQAVSLK2.1 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ANKYDGSGQIAMTTNLLSQPR1.4 (delta mass [ppm])3 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ANKYDGSGQIAMTTNLLSQPR2.6 (delta mass [ppm])3 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382478ANLINNIFELAGLGK0.5 (delta mass [ppm])2 
A1110EPS8Epidermal growth factor receptor kinase substrate 8IPI00290337ANLISEDIESAISDSK0.1 (delta mass [ppm])2 
A1110EPS8Epidermal growth factor receptor kinase substrate 8IPI00290337ANLISEDIESAISDSK3 (delta mass [ppm])2 
A1110EPS8Epidermal growth factor receptor kinase substrate 8IPI00290337ANLISEDIESAISDSK2.2 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ANMDGSQR0 (delta mass [ppm])2 
A0609EGFPro-epidermal growth factor precursorIPI00000073ANMDGSQR0.3 (delta mass [ppm])2 
A7355PGA4Pepsin A-4IPI00019641ANNQVGLAPVA1.9 (delta mass [ppm])2 
A7355PGA4Pepsin A-4IPI00019641ANNQVGLAPVA0.4 (delta mass [ppm])2 
A7355PGA4Pepsin A-4IPI00019641ANNQVGLAPVA2.2 (delta mass [ppm])2 
A3585ALDH1A1, ALDC, ALDH1Aldehyde dehydrogenase 1A1IPI00218914ANNTFYGLSAGVFTK2.9 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ANPSQPPSDLGYTWNIPVK2.6 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ANPSQPPSDLGYTWNIPVK3.9 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ANPSQPPSDLGYTWNIPVK1.1 (delta mass [ppm])2 
A0524PFN1Profilin IIPI00216691ANPTVTLFPPSSEELQANK1.2 (delta mass [ppm])2 
A4013TENM4, ODZ4, TNM4Teneurin-4IPI00464973ANPTVTLFPPSSEELQANK1.7 (delta mass [ppm])2 
A4853HMCN1, FIBL6, FIBL-6Hemicentin-1IPI00045512ANPTVTLFPPSSEELQANK1.9 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095ANPTVTLFPPSSEELQANK1.6 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00441042ANPTVTLFPPSSEELQANK1.2 (delta mass [ppm])2 
A9399LYVE1, CRSBP1, HARLymphatic vessel endothelial hyaluronic acid receptor 1 precursorIPI00290856ANQQLNFTEAK0.7 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421ANRPFLVFIR0 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421ANRPFLVFIR0.8 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421ANRPFLVFIR0.1 (delta mass [ppm])3 
A085DCHI3L1Chitinase-3 like protein 1 precursorIPI00556431ANSFLGEK0.2 (delta mass [ppm])1 
A1526SPP1, BNSP, OPNOsteopontin precursorIPI00218874ANSFLGEK2.3 (delta mass [ppm])2 
A0412ATP6AP2, ATP6IP2, CAPERRenin receptorIPI00168884ANSVFEDLSVTLR1.3 (delta mass [ppm])2 
A0497SDCBP, MDA9, SYCLSyntenin 1IPI00479018ANVAVVSGAPLQGLVAR2.2 (delta mass [ppm])2 
A0497SDCBP, MDA9, SYCLSyntenin 1IPI00479018ANVAVVSGAPLQGLVAR0.2 (delta mass [ppm])3 
A1619CFI, IFComplement factor IIPI00291867ANVAVVSGAPLQGQLVAR0.5 (delta mass [ppm])3 
A1742HBB, beta-globinHemoglobin beta chainIPI00382950ANVAVVSGAPLQGQLVAR0.8 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK2 (delta mass [ppm])3 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ANYGLVEPIPFEFPPTSVQWTPETLAAFDLTK2.2 (delta mass [ppm])3 
A250CNUCB1, NUC, CALNUCNucleobindin 1 precursorIPI00295542APAAHPEGQLK0.6 (delta mass [ppm])3 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143APAFEGR0.7 (delta mass [ppm])2 
A9139UMODUromodulin precursorIPI00013945APAFEGR1 (delta mass [ppm])2 
A4609CD99L2, MIC2L1, UNQ1964/PRO4486CD99 antigen-like 2IPI00185662APAKPPGSGLDLADALDDQDDGR0.6 (delta mass [ppm])3 
A4609CD99L2, MIC2L1, UNQ1964/PRO4486CD99 antigen-like 2IPI00185662APAKPPGSGLDLADALDDQDDGRR1.5 (delta mass [ppm])4 
A797ANR1D1, EAR1, HREVNuclear receptor subfamily 1 group D member 1IPI00023603APANSPR0.6 (delta mass [ppm])2 
A550DIGFBP6, IBP6Insulin-like growth factor binding protein 6 precursorIPI00029235APAVAEENPK0.9 (delta mass [ppm])2 
A550DIGFBP6, IBP6Insulin-like growth factor binding protein 6 precursorIPI00029235APAVAEENPK0.1 (delta mass [ppm])2 
A550DIGFBP6, IBP6Insulin-like growth factor binding protein 6 precursorIPI00029235APAVAEENPK0.5 (delta mass [ppm])2 
A550DIGFBP6, IBP6Insulin-like growth factor binding protein 6 precursorIPI00029235APAVAEENPK1.6 (delta mass [ppm])2 
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorIPI00218192APAVPAPIQAPSAILPLPGQSVER2 (delta mass [ppm])2 
A2641KBP-1, HIVEP3, KBP1Transcription factor HIVEP3IPI00328089APCPLIPIGGIQMVQAR2.2 (delta mass [ppm])2 
A6472EXTL2, EXTR2Exostosin-like 2IPI00002732APDELWNSLGPHPIPVIFK0.7 (delta mass [ppm])3 
A6472EXTL2, EXTR2Exostosin-like 2IPI00002732APDELWNSLGPHPIPVIFK2.2 (delta mass [ppm])3 
A0326VIL2, EZREzrinIPI00479359APDFVFYAPR1 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359APDFVFYAPR2.3 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359APDFVFYAPR1.8 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359APDFVFYAPR0.7 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK0 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK2 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK0.6 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK1.1 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK2.3 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK3.2 (delta mass [ppm])2 
A1544PROZVitamin K-dependent protein Z precursorIPI00027843APDLQDLPWQVK1.2 (delta mass [ppm])2 
A6365DPP7, DPP2, QPPDipeptidyl-peptidase 2IPI00296141APDPGFQER3.7 (delta mass [ppm])2 
A4991MCAM, MUC18Cell surface glycoprotein MUC18 precursorIPI00016334APEEPNIQVNPLGIPVNSK0 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR0 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR0.2 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR0.3 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR1.3 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR0.7 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR0.6 (delta mass [ppm])2 
A5952C1RL, C1RL1, C1RLPComplement C1r-like proteinaseIPI00009793APEGFAVR1.4 (delta mass [ppm])2 
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2IPI00003817APEPHVEEDDDDELDSK1.9 (delta mass [ppm])3 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654APEPLELTLPVELLADTR2 (delta mass [ppm])2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654APEPLELTLPVELLADTR1.7 (delta mass [ppm])2 
A865CBPIL1, LPLUNC2, UNQ2489/PRO5776Bactericidal/permeability-increasing protein-like 1 precursorIPI00296654APEPLELTLPVELLADTR0.8 (delta mass [ppm])2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470APFDLFENR0.3 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR0.3 (delta mass [ppm])3 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR1.7 (delta mass [ppm])3 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR2.4 (delta mass [ppm])3 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR1.8 (delta mass [ppm])3 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR0.2 (delta mass [ppm])3 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345APFQLHSAALDFSPPGTEVSALCR0.4 (delta mass [ppm])3 
A5628GGACT, A2LD1Gamma-glutamylaminecyclotransferaseIPI00042295APGAEEPPAPTAVQCFVYSR1 (delta mass [ppm])3 
A5628GGACT, A2LD1Gamma-glutamylaminecyclotransferaseIPI00042295APGAEEPPAPTAVQCFVYSR3.3 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038APGAIGPYSQAVLVDR1.5 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038APGAIGPYSQAVLVDR0.9 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038APGAIGPYSQAVLVDR1.1 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038APGAIGPYSQAVLVDR2.9 (delta mass [ppm])2 
A8170UK114, HRSP12, PSPRibonuclease UK114IPI00005038APGAIGPYSQAVLVDR2.1 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378APGKDTFYSLGSSLDITFR0.8 (delta mass [ppm])3 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378APGKDTFYSLGSSLDITFR2.3 (delta mass [ppm])2 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378APGKDTFYSLGSSLDITFR0.2 (delta mass [ppm])3 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378APGKDTFYSLGSSLDITFR1.9 (delta mass [ppm])3 
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2IPI00306378APGKDTFYSLGSSLDITFR1.7 (delta mass [ppm])3 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827APGKDTFYSLGSSLDITFR0.3 (delta mass [ppm])3 
A5300CRB2CRUMBS protein homolog 2 precursorIPI00410585APGLLDSLYGTVR0.1 (delta mass [ppm])2 
A570BPROM2, PROML2, UNQ2521/PRO6014Prominin-2IPI00177880APGLLDSLYGTVR0.6 (delta mass [ppm])2 
A570BPROM2, PROML2, UNQ2521/PRO6014Prominin-2IPI00177880APGLLDSLYGTVR0.4 (delta mass [ppm])2 
A5196TUBB6, TUBB-5Tubulin, beta 6IPI00646972APGLPAR1.2 (delta mass [ppm])2 
A5196TUBB6, TUBB-5Tubulin, beta 6IPI00646972APGLPAR3.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387025APGTYSCYYHTPSAPYVLSQR0.8 (delta mass [ppm])3 
A9713FCGBPIgG Fc binding proteinIPI00242956APGWDPLCWDECR0.4 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956APGWDPLCWDECR1.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00472961APKRLIFAASSLQSGVPSR4.4 (delta mass [ppm])3 
A381CSLC13A2, NADC1, SDCT1Solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2IPI00011981APLGLLDWK0.2 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR1.9 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR0.1 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR0.4 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR1.9 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR3.7 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR4.5 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR4.8 (delta mass [ppm])2 
A8164ufo, AXL, UFOTyrosine-protein kinase receptor UFO precursorIPI00296992APLQGTLLGYR0.4 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352APLQVAVLGPTGVAEPVEVR1.4 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352APLQVAVLGPTGVAEPVEVR1.9 (delta mass [ppm])3 
A354CRBP5Retinol binding protein 5, cellularIPI00219782APLVCLPVFVSR2.6 (delta mass [ppm])2 
A6071LP4947, PTD012Ester hydrolase C11ORF54IPI00072044APLVCLPVFVSR2.3 (delta mass [ppm])2 
A7300PARK7, DJ-1RNA-binding protein regulatory subunitIPI00298547APLVLKD2.4 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459APNENGPYFLALR2.4 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459APNENGPYFLALR0.1 (delta mass [ppm])2 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459APNENGPYFLALR3.1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.9 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.8 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.4 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.2 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTR0.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTRK0.9 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTRK0.5 (delta mass [ppm])3 
A643CTF, PRO1400Serotransferrin precursorIPI00022463APNHAVVTRK0.2 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430839APNLLIYAASSLQSGVPSR0.4 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430839APNLLIYAASSLQSGVPSR2.3 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430839APNLLIYAASSLQSGVPSR1.5 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220APNLLIYAASSLQSGVPSR1.3 (delta mass [ppm])3 
A6739holEDNA polymerase III subunit thetaGI:123456APNTPASGANGDGSMSQTQSGSTVK1.9 (delta mass [ppm])2 
A5842ASS1, ASSArgininosuccinate synthaseIPI00020632APNTPDILEIEFK0.5 (delta mass [ppm])2 
A5842ASS1, ASSArgininosuccinate synthaseIPI00020632APNTPDILEIEFK3.6 (delta mass [ppm])2 
A5842ASS1, ASSArgininosuccinate synthaseIPI00020632APNTPDILEIEFKK1.9 (delta mass [ppm])3 
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2IPI00003817APNVVVTR0.5 (delta mass [ppm])2 
A5979CASP7, MCH3Caspase-7 precursorIPI00645246APPAKQR1.5 (delta mass [ppm])2 
A5979CASP7, MCH3Caspase-7 precursorIPI00645246APPAKQR1.6 (delta mass [ppm])2 
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5IPI00100796APPPSLTDCIGTVDSR0.9 (delta mass [ppm])2 
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5IPI00100796APPPSLTDCIGTVDSR0.9 (delta mass [ppm])2 
A873BCHMP5, SNF7DC2, CGI-34Charged multivesicular body protein 5IPI00100796APPPSLTDCIGTVDSR0.4 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751APPSQPPR0.1 (delta mass [ppm])2 
A519E Hypothetical proteinIPI00647525APPSTPR0.5 (delta mass [ppm])2 
A5635GOT1, GIG18Aspartate aminotransferase, cytoplasmicIPI00219029APPSVFAEVPQAQPVLVFK1.3 (delta mass [ppm])2 
A5635GOT1, GIG18Aspartate aminotransferase, cytoplasmicIPI00219029APPSVFAEVPQAQPVLVFK1.4 (delta mass [ppm])2 
A9427OSCAR, PIGR3Osteoclast-associated immunoglobulin-like receptorIPI00647357APQPAWR0.2 (delta mass [ppm])2 
A9929GRNGranulins precursorIPI00296713APQPAWR0.2 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260APQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACAR1.4 (delta mass [ppm])4 
A531BMEGF8, EGFL4Multiple epidermal growth factor-like domain protein 8IPI00027310APQTVELPAVAGHTLTAR1 (delta mass [ppm])3 
A531BMEGF8, EGFL4Multiple epidermal growth factor-like domain protein 8IPI00027310APQTVELPAVAGHTLTAR1.7 (delta mass [ppm])3 
A6423ENDOD1Endonuclease domain-containing 1 protein precursorIPI00001952APRPAPGGAEQR1.8 (delta mass [ppm])2 
A6423ENDOD1Endonuclease domain-containing 1 protein precursorIPI00001952APRPAPGGAEQR0.4 (delta mass [ppm])2 
A6423ENDOD1Endonuclease domain-containing 1 protein precursorIPI00001952APRPAPGGAEQR1.5 (delta mass [ppm])3 
A0317CAPN1, CANPL1, PIG30Calpain 1, large [catalytic] subunitIPI00011285APSDLYQIILK1 (delta mass [ppm])2 
A9361gp130, IL6ST, GP130Interleukin-6 receptor beta chain precursorIPI00297124APSFWYK0.5 (delta mass [ppm])2 
A0210NUTF2, NTF2, PP15Nuclear transport factor 2IPI00009901APSPAPR1.9 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088APSPLYSVEFSEEPFGVIVR4.1 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088APSPLYSVEFSEEPFGVIVR0.7 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088APSPLYSVEFSEEPFGVIVR0.8 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623APSTWLTAYVVK2.7 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623APSTWLTAYVVK2.9 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623APSTWLTAYVVK0.4 (delta mass [ppm])2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623APSTWLTAYVVK0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434APSTYGGGLSVSSR1.8 (delta mass [ppm])2 
A028DCYSTM1, PSD2PH and SEC7 domain-containing protein 2IPI00382821APSTYGGGLSVSSSR1 (delta mass [ppm])2 
A093CLMAN2Vesicular integral-membrane protein VIP36 precursorIPI00009950APSTYGGGLSVSSSR2.9 (delta mass [ppm])2 
A5734hAO, AOX1, AOAldehyde oxidaseIPI00642489APSTYGGGLSVSSSR1 (delta mass [ppm])2 
A5541CRYAB, CRYA2Alpha crystallin B chainIPI00021369APSWFDTGLSEMR0.2 (delta mass [ppm])2 
A5541CRYAB, CRYA2Alpha crystallin B chainIPI00021369APSWFDTGLSEMR2.1 (delta mass [ppm])2 
A1525TNC, HXBTenascin precursorIPI00031008APTAQVESFR0.5 (delta mass [ppm])2 
A1525TNC, HXBTenascin precursorIPI00031008APTAQVESFR2.1 (delta mass [ppm])2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446APVAGTCYQAEWDDYVPK2.4 (delta mass [ppm])2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446APVAGTCYQAEWDDYVPK1.6 (delta mass [ppm])2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446APVAGTCYQAEWDDYVPK1.1 (delta mass [ppm])2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446APVAGTCYQAEWDDYVPK0.5 (delta mass [ppm])2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446APVAGTCYQAEWDDYVPK1.7 (delta mass [ppm])2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVK3.9 (delta mass [ppm])4 
A5768ALDH8A1, ALDH12Aldehyde dehydrogenase 12IPI00171391APVGVAGLISPWNLPLYLLTWK2 (delta mass [ppm])3 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476APVIFSHSSAYSVCASR2.4 (delta mass [ppm])3 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476APVIFSHSSAYSVCASR3 (delta mass [ppm])3 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476APVIFSHSSAYSVCASR4.9 (delta mass [ppm])3 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772APVILGSPDDVLEFLK1 (delta mass [ppm])2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772APVILGSPDDVLEFLK1.4 (delta mass [ppm])2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772APVILGSPDDVLEFLK0.2 (delta mass [ppm])2 
A3892NCAN, CSPG3, NEURNeurocan core protein precursorIPI00159927APVLELEK0.2 (delta mass [ppm])2 
A4461FXYD5, DYSAD, IWU1FXYD domain-containing ion transport regulator 5 precursorGI:12345679APVLSDSSCK2.2 (delta mass [ppm])2 
A4461FXYD5, DYSAD, IWU1FXYD domain-containing ion transport regulator 5 precursorGI:12345679APVLSDSSCK2.2 (delta mass [ppm])2 
A4461FXYD5, DYSAD, IWU1FXYD domain-containing ion transport regulator 5 precursorGI:12345679APVLSDSSCK0.1 (delta mass [ppm])2 
A4461FXYD5, DYSAD, IWU1FXYD domain-containing ion transport regulator 5 precursorGI:12345679APVLSDSSCK1.8 (delta mass [ppm])2 
A4461FXYD5, DYSAD, IWU1FXYD domain-containing ion transport regulator 5 precursorGI:12345679APVLSDSSCK1.6 (delta mass [ppm])2 
A0452CANXCalnexin precursorIPI00020984APVPTGEVYFADSFDR4.7 (delta mass [ppm])2 
A1821HLA-AHLA class I histocompatibility antigen, A-2 alpha chain precursorIPI00472151APWIEQEGPEYWDEETGKVK0.6 (delta mass [ppm])3 
A7471ACP2Lysosomal acid phosphatase precursorIPI00003807APWPLSLPGCPHR1.8 (delta mass [ppm])3 
A7471ACP2Lysosomal acid phosphatase precursorIPI00003807APWPLSLPGCPHR4.6 (delta mass [ppm])3 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778APYYNYK0.3 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778APYYNYK1.2 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778APYYNYK1.3 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AQAELNALK4.5 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AQAELNALKR1.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS1.2 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS0.9 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS0.8 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS1.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS0.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS1.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQAGANTRPCPS1.7 (delta mass [ppm])2 
A9064SPOPLSpeckle-type POZ protein-likeIPI00419928AQAIDFINR0.9 (delta mass [ppm])2 
A793E cDNA FLJ43013 fis, clone BRTHA2016215IPI00445856AQANPAPR0.6 (delta mass [ppm])2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR1 (delta mass [ppm])2 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AQAQPGVPLR1.6 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00419327AQATDPDSGPNSYIEYTLLNPLGNK1.9 (delta mass [ppm])3 
A1176APOEApolipoprotein E precursorIPI00021842AQAWGER0.8 (delta mass [ppm])2 
A0326VIL2, EZREzrinIPI00479359AQEEAERLEADR0.7 (delta mass [ppm])2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK2 (delta mass [ppm])2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK1.5 (delta mass [ppm])2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AQEENTWFSYLK3.5 (delta mass [ppm])2 
A002CGLRX, GRXGlutaredoxin-1IPI00219025AQEFVNCK2.1 (delta mass [ppm])2 
A002CGLRX, GRXGlutaredoxin-1IPI00219025AQEFVNCK1.1 (delta mass [ppm])2 
A002CGLRX, GRXGlutaredoxin-1IPI00219025AQEILSQLPIK0.8 (delta mass [ppm])2 
A002CGLRX, GRXGlutaredoxin-1IPI00219025AQEILSQLPIK1.7 (delta mass [ppm])2 
A002CGLRX, GRXGlutaredoxin-1IPI00219025AQEILSQLPIK0.6 (delta mass [ppm])2 
A5770GPT, AAT1, GPT1Alanine aminotransferase 1IPI00217458AQELGLAPDMFFCLR1.1 (delta mass [ppm])2 
A1744EPHA1, EPH, EPHTEphrin type-A receptor 1IPI00294250AQGELGWLLDPPK1.8 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK0.4 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK0.4 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK0.2 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK0.9 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK0.8 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK1.9 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK1.4 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK2.6 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK1.7 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK2.3 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDK1.7 (delta mass [ppm])2 
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorIPI00013179AQGFTEDTIVFLPQTDKCMTEQ1.1 (delta mass [ppm])2 
A3574BASP1, NAP22Brain acid soluble protein 1IPI00299024AQGPAASAEEPKPVEAPAANSDQTVTVKE2.1 (delta mass [ppm])3 
A1470THBS1, TSP, TSP1Thrombospondin 1 precursorIPI00296099AQGYSGLSVK1.3 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR1.3 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR0.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR1.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR1.9 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILR1.7 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQIHGGILRLPAVEPTDQAQYLCR2.3 (delta mass [ppm])4 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK2 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK1.5 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK0.1 (delta mass [ppm])2 
A5800CD13, ANPEP, APNAminopeptidase NIPI00221224AQIINDAFNLASAHK0.9 (delta mass [ppm])2 
A1466FN1, FNFibronectinIPI00022418AQITGYR0.8 (delta mass [ppm])2 
A1466FN1, FNFibronectinIPI00022418AQITGYR0.8 (delta mass [ppm])2 
A7015MGAM, MGA, MGAMLMaltase-glucoamylase, intestinalIPI00220143AQITGYR0.2 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AQITGYR0.4 (delta mass [ppm])2 
A084ARAB11B, YPT3Ras-related protein Rab-11BIPI00020436AQIWDTAGQER0.9 (delta mass [ppm])2 
A084ARAB11B, YPT3Ras-related protein Rab-11BIPI00020436AQIWDTAGQER0.2 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AQLDAAVTFGPSQVAR0.2 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AQLDAAVTFGPSQVAR0.2 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AQLDAAVTFGPSQVAR0.9 (delta mass [ppm])2 
A2481ARSAArylsulfatase A precursorIPI00329685AQLDAAVTFGPSQVAR2.8 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360AQLDPAFIK0.6 (delta mass [ppm])2 
A8453PI15, CRISP8, P25TIPeptidase inhibitor 15 precursorIPI00026303AQLDSADIPK1.9 (delta mass [ppm])2 
A8453PI15, CRISP8, P25TIPeptidase inhibitor 15 precursorIPI00026303AQLDSADIPK1.3 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867AQLGDLPWQVAIK1.6 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867AQLGDLPWQVAIK1.8 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867AQLGDLPWQVAIK0.1 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867AQLGDLPWQVAIK3.1 (delta mass [ppm])2 
A1619CFI, IFComplement factor IIPI00291867AQLGDLPWQVAIK0.3 (delta mass [ppm])2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512AQLGGPEAAK0.2 (delta mass [ppm])2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512AQLGGPEAAK0.1 (delta mass [ppm])2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512AQLGGPEAAK1.4 (delta mass [ppm])2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512AQLGGPEAAK0.8 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHR2.9 (delta mass [ppm])5 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHR0.2 (delta mass [ppm])5 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHR0 (delta mass [ppm])5 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQLHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSFHR0.1 (delta mass [ppm])5 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375AQLLDYK2.4 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375AQLLDYK2.3 (delta mass [ppm])2 
A0290L1CAM, CAML1, MIC5Neural cell adhesion molecule L1 precursorIPI00027087AQLLVVGSPGPVPR0.4 (delta mass [ppm])2 
A0290L1CAM, CAML1, MIC5Neural cell adhesion molecule L1 precursorIPI00027087AQLLVVGSPGPVPR1.8 (delta mass [ppm])2 
A5229TRIM67, TNLTripartite motif-containing protein 67IPI00455477AQLSQALNGVSDKAKEAK1.7 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150AQLVEEWANSVK0.3 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150AQLVEEWANSVK2.9 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150AQLVEEWANSVK4.5 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150AQLVEEWANSVK3 (delta mass [ppm])2 
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorIPI00022431AQLVPLPPSTYVEFTVSGTDCVAK0.5 (delta mass [ppm])2 
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorIPI00022431AQLVPLPPSTYVEFTVSGTDCVAK0.3 (delta mass [ppm])3 
A8783AHSG, FETUA, PRO2743Alpha-2-HS-glycoprotein precursorIPI00022431AQLVPLPPSTYVEFTVSGTDCVAK1.4 (delta mass [ppm])3 
A7105NAGAAlpha-N-acetylgalactosaminidase precursorIPI00414909AQMALWTVLAAPLLMSTDLR0.6 (delta mass [ppm])3 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AQNDQLGWLWGQSR1.6 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AQNDQLGWLWGQSR3.9 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AQNDQLGWLWGQSR2.2 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AQPVQVAEGSEPDGFWEALGGK1.8 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AQPVQVAEGSEPDGFWEALGGK1.5 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AQPVQVAEGSEPDGFWEALGGK0.6 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AQPVQVAEGSEPDGFWEALGGK2.7 (delta mass [ppm])2 
A5608HSD3B1, 3BH, HSDB3A3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase type IIPI00383756AQQDLAYK3 (delta mass [ppm])1 
A1216PRKCSH, G19P1Glucosidase 2 subunit beta precursorIPI00026154AQQEQELAADAFK2 (delta mass [ppm])2 
A306BANKLE2, LEM4Ankyrin repeat and LEM domain-containing protein 2IPI00329245AQQETGER0.7 (delta mass [ppm])2 
A344ESPARCL1, PIG33SPARC-like protein 1 precursorIPI00296777AQSIAYHLK0.6 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.3 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.2 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK1.7 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.4 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.2 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.3 (delta mass [ppm])2 
A8404CST6Cystatin M precursorIPI00019954AQSQLVAGIK0.7 (delta mass [ppm])2 
A4634CAPG, AFCP, MCPGelsolin-like capping proteinIPI00643576AQVEIVTDGEEPAEMIQVLGPK1.8 (delta mass [ppm])3 
A8454PI16, CRISP9, PSPBPPeptidase inhibitor 16 precursorIPI00301143AQVSPTASDMLHMR0.7 (delta mass [ppm])3 
A8454PI16, CRISP9, PSPBPPeptidase inhibitor 16 precursorIPI00301143AQVSPTASDMLHMR2.8 (delta mass [ppm])3 
A8454PI16, CRISP9, PSPBPPeptidase inhibitor 16 precursorIPI00301143AQVSPTASDMLHMR0.2 (delta mass [ppm])3 
A8454PI16, CRISP9, PSPBPPeptidase inhibitor 16 precursorIPI00301143AQVSPTASDMLHMR3 (delta mass [ppm])2 
A8515SERPINA7, TBGThyroxine-binding globulin precursorIPI00292946AQWANPFDPSK4.7 (delta mass [ppm])2 
A8515SERPINA7, TBGThyroxine-binding globulin precursorIPI00292946AQWANPFDPSK0.6 (delta mass [ppm])2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053AQYDDIASR0.9 (delta mass [ppm])2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053AQYDDIASR0.4 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK0.5 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK1.5 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK0.8 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK2.2 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK0.5 (delta mass [ppm])2 
A1577KRT18, CYK18, PIG46Keratin, type I cytoskeletal 18IPI00455689AQYDELAQK1.7 (delta mass [ppm])2 
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75IPI00005859AQYEDIANR2.1 (delta mass [ppm])2 
A1669KRT5Keratin, type II cytoskeletal 5IPI00009867AQYEEIANR0.4 (delta mass [ppm])2 
A1669KRT5Keratin, type II cytoskeletal 5IPI00009867AQYEEIANR1.5 (delta mass [ppm])2 
A021CHPXHemopexin precursorIPI00022488AQYEEIAQR0.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AQYEEIAQR0.8 (delta mass [ppm])2 
A1591SERPING1, C1IN, C1NHSerine/cysteine proteinase inhibitor clade G member 1IPI00291866AQYEEIAQR0.5 (delta mass [ppm])2 
A5842ASS1, ASSArgininosuccinate synthaseIPI00020632AQYEEIAQR0.8 (delta mass [ppm])2 
A4614CDH11Cadherin-11 precursorIPI00386476AQYTLMAQAVDR0.3 (delta mass [ppm])2 
A127ASFRP4, FRPHESecreted frizzled-related protein 4IPI00017557ARDDCEPLMK1.6 (delta mass [ppm])2 
A4649CDHR2, PCDH24, PCLKCProtocadherin-24IPI00307446ARDDDSGNNGVILFSILR0.9 (delta mass [ppm])3 
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EIPI00003856ARDDLITDLLNEAK2.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK1.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK1.6 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK1.2 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK0.2 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK1.8 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK1.9 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AREDIFMETLK0.4 (delta mass [ppm])3 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871ARGPDSNVLLLR1 (delta mass [ppm])2 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871ARGPDSNVLLLR0.9 (delta mass [ppm])2 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871ARGPDSNVLLLR0.2 (delta mass [ppm])2 
A9758TIFA, T2BPTRAF-interacting protein with FHA domain-containing protein AIPI00514147ARGSAGGSAAR4.9 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ARKQIVAGVNYFLDVELGR0.3 (delta mass [ppm])3 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759ARLECEINTYR1.5 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360ARPEDVISEGR1.1 (delta mass [ppm])2 
A7982MPST, TST2Mercaptopyruvate sulfurtransferaseIPI00165360ARPEDVISEGR1.3 (delta mass [ppm])2 
A3804EEF2, EF2Elongation factor 2IPI00186290ARPFPDGLAEDIDKGEVSAR1.3 (delta mass [ppm])3 
A8986RTN4RL2, NGRH1, NGRL3Reticulon-4 receptor-like 2 precursorIPI00328746ARPLWAWFQR2.1 (delta mass [ppm])2 
A8986RTN4RL2, NGRH1, NGRL3Reticulon-4 receptor-like 2 precursorIPI00328746ARPLWAWFQR1 (delta mass [ppm])2 
A8986RTN4RL2, NGRH1, NGRL3Reticulon-4 receptor-like 2 precursorIPI00328746ARPLWAWFQR0.9 (delta mass [ppm])3 
A2482GALNSN-acetylgalactosamine-6-sulfatase precursorIPI00029605ARPNIPVYR0.2 (delta mass [ppm])3 
A1539KNG1, BDK, KNGKininogen-1IPI00215894ARVQVVAGK1.5 (delta mass [ppm])2 
A0067GNG12Guanine nucleotide-binding protein G(i)/G(s)/G(o) gamma-12 subunitIPI00221232ASADLMSYCEEHAR1 (delta mass [ppm])2 
A2624PTPRS, PTPsigma, BPTP-2Receptor-type protein-tyrosine phosphatase S precursorIPI00289831ASAGLLGAHAAAITAYALTLTK1.5 (delta mass [ppm])3 
A8720C4A, CO4, CPAMD2Complement C4 precursorIPI00643525ASAGLLGAHAAAITAYALTLTK0.5 (delta mass [ppm])3 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163ASAGLLGAHAAAITAYALTLTK1.6 (delta mass [ppm])3 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163ASAGLLGAHAAAITAYALTLTK0.2 (delta mass [ppm])3 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488ASALLYAGESMFTR0 (delta mass [ppm])2 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488ASALLYAGESMFTR0.4 (delta mass [ppm])2 
A6257DDC, AADCAromatic-L-amino-acid decarboxylaseIPI00025394ASALQEALER1.8 (delta mass [ppm])2 
A6257DDC, AADCAromatic-L-amino-acid decarboxylaseIPI00025394ASALQEALER3.7 (delta mass [ppm])2 
A6257DDC, AADCAromatic-L-amino-acid decarboxylaseIPI00025394ASALQEALER2.2 (delta mass [ppm])2 
A7105NAGAAlpha-N-acetylgalactosaminidase precursorIPI00414909ASALVFFSCR2.1 (delta mass [ppm])2 
A7105NAGAAlpha-N-acetylgalactosaminidase precursorIPI00414909ASALVFFSCR3 (delta mass [ppm])2 
A480DGLIPR2, GAPR1Golgi-associated plant pathogenesis-related protein 1IPI00007067ASASDGSSFVVAR1.2 (delta mass [ppm])2 
A4806FBN1, FBNFibrillin-1IPI00328113ASCCCSLGK0.4 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK2.1 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK0.1 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK2 (delta mass [ppm])2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757ASCLYGQLPK1.6 (delta mass [ppm])2 
A8204XPNPEP2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-boundIPI00439344ASDIPYNPFFYSYTLLTDSSIR1.7 (delta mass [ppm])2 
A8204XPNPEP2X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-boundIPI00439344ASDIPYNPFFYSYTLLTDSSIR3.7 (delta mass [ppm])2 
A0610CSPG4, MCSPChondroitin sulfate proteoglycan 4IPI00019157ASEAVEDTFR0 (delta mass [ppm])2 
A7132NME2, NM23B, NME1-NME2Nucleoside diphosphate kinase BIPI00604590ASEEHLK0.2 (delta mass [ppm])2 
A9805PPP3R2, CBLP, PPP3RLCalcineurin B subunitIPI00000914ASELEQEQEREGSSLDSPR0.7 (delta mass [ppm])3 
A4570ANTXR1, ATR, TEM8Anthrax toxin receptor 1 precursorIPI00030431ASEQIYYENR2.1 (delta mass [ppm])2 
A726DMXRA5AdlicanIPI00012347ASESPSIFWVLPDGSILK2.7 (delta mass [ppm])2 
A592AEIF6, EIF3A, ITGB4BPEukaryotic translation initiation factor 6IPI00010105ASFENNCEIGCFAK1 (delta mass [ppm])2 
A592AEIF6, EIF3A, ITGB4BPEukaryotic translation initiation factor 6IPI00010105ASFENNCEIGCFAK2.1 (delta mass [ppm])2 
A592AEIF6, EIF3A, ITGB4BPEukaryotic translation initiation factor 6IPI00010105ASFENNCEIGCFAK1.3 (delta mass [ppm])2 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ASFHIPQVQVR0.6 (delta mass [ppm])3 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ASFHIPQVQVR0.1 (delta mass [ppm])3 
A0994GP6, GPVIPlatelet glycoprotein VI precursorIPI00102300ASFPIITVTAAHSGTYR2.2 (delta mass [ppm])3 
A0994GP6, GPVIPlatelet glycoprotein VI precursorIPI00102300ASFPIITVTAAHSGTYR2.8 (delta mass [ppm])2 
A0994GP6, GPVIPlatelet glycoprotein VI precursorIPI00102300ASFPIITVTAAHSGTYR4.3 (delta mass [ppm])2 
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1IPI00007321ASFPQGPIGGANR1.7 (delta mass [ppm])2 
A5792RNPEP, APBAminopeptidase BIPI00642211ASGEHSPGSGAAR2.3 (delta mass [ppm])2 
A9548RPL22, RPL22L260S ribosomal protein L22IPI00456782ASGIPAR0.2 (delta mass [ppm])2 
A016DFAM218AHypothetical proteinIPI00043543ASGLPNR0.8 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352ASGPGLER0.3 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352ASGPGLER1.3 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352ASGPGLER0.5 (delta mass [ppm])2 
A4815FLNC, ABPL, FLN2Filamin CIPI00178352ASGPGLNASGIPASLPVEFTIDAR0.1 (delta mass [ppm])3 
A0204FLNA, FLN, FLN1Filamin AIPI00302592ASGPGLNTTGVPASLPVEFTIDAK2.3 (delta mass [ppm])2 
A0204FLNA, FLN, FLN1Filamin AIPI00302592ASGPGLNTTGVPASLPVEFTIDAK3.3 (delta mass [ppm])2 
A746E PREDICTED: Similar to Lwamide neuropeptide precursor proteinIPI00376411ASGQGGKEGLK0.3 (delta mass [ppm])3 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00457307ASGVAVSDGVIK0.8 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00457307ASGVAVSDGVIK0.8 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00457307ASGVAVSDGVIK0.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR0.7 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR0.2 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR1.2 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR1.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR0.7 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDR0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419424ASGVPDRFSGSGSGTDFTLK1.8 (delta mass [ppm])2 
A4750DSTN, ACTDP, DSNDestrinIPI00473014ASGVQVADEVCR0.2 (delta mass [ppm])2 
A4710CFL2Cofilin 2IPI00413344ASGVTVNDEVIK2.6 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1.8 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1.1 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1.3 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK0.7 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK0.7 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2.3 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK2 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK0.1 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673ASHEEVEGLVEK1.1 (delta mass [ppm])2 
A6365DPP7, DPP2, QPPDipeptidyl-peptidase 2IPI00296141ASHPEDPASVVEAR0.7 (delta mass [ppm])3 
A7556PAICS, ADE2, AIRCMultifunctional protein ADE2IPI00217223ASILNTWISLK4 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102ASILTGK0.6 (delta mass [ppm])1 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102ASILTGK2.2 (delta mass [ppm])2 
A2489GNSN-acetylglucosamine-6-sulfatase precursorIPI00012102ASILTGK0.7 (delta mass [ppm])2 
A9256CD160, BY55CD160 antigen precursorIPI00027466ASISGGGLPAPYQAK1.1 (delta mass [ppm])2 
A430CSLC36A2, PAT2, TRAMD1Solute carrier family 36 (proton/amino acid symporter), member 2IPI00376258ASISLNLPNCWLYQSVK2.6 (delta mass [ppm])2 
A430CSLC36A2, PAT2, TRAMD1Solute carrier family 36 (proton/amino acid symporter), member 2IPI00376258ASISLNLPNCWLYQSVK2.8 (delta mass [ppm])2 
A8385ANXA3, ANX3Annexin A3IPI00024095ASIWVGHR0 (delta mass [ppm])2 
A9915GDF15, MIC1, PDFGrowth/differentiation factor 15 precursorIPI00306543ASLEDLGWADWVLSPR1.2 (delta mass [ppm])2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00450768ASLEGNLAETENR0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ASLENSLEETK0.6 (delta mass [ppm])2 
A5734hAO, AOX1, AOAldehyde oxidaseIPI00642489ASLENSLEETK3.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ASLENSLEETKGR1.6 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ASLIDDAFALAR2.1 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ASLIDDAFALAR1.4 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ASLIDDAFALAR0.4 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK0.4 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK1.4 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK1.5 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK2.3 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK0.9 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK0.1 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK0.4 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK1.1 (delta mass [ppm])2 
A6005CPMCarboxypeptidase M precursorIPI00026270ASLIEYIK3.8 (delta mass [ppm])2 
A6436ERAP1, APPILS, ARTS1Endoplasmic reticulum aminopeptidase 1IPI00165949ASLINNAFQLVSIGK1.8 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434ASLISAVSDK0.8 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434ASLISAVSDK0.1 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434ASLISAVSDKLR1.6 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434ASLISAVSDKLR2.3 (delta mass [ppm])2 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207ASLLTMAFLNGALDGVILGDYLSR1.3 (delta mass [ppm])2 
A7381PGLYRP2, PGLYRPL, PGRPLN-acetylmuramoyl-L-alanine amidase precursorIPI00163207ASLLTMAFLNGALDGVILGDYLSR2.8 (delta mass [ppm])3 
A444BAD021, FAM198B, ENEDProtein ENEDIPI00165044ASLQHGQAAEK0.5 (delta mass [ppm])2 
A444BAD021, FAM198B, ENEDProtein ENEDIPI00165044ASLQHGQAAEK2 (delta mass [ppm])2 
A444BAD021, FAM198B, ENEDProtein ENEDIPI00165044ASLQHGQAAEKGPHR1.8 (delta mass [ppm])3 
A444BAD021, FAM198B, ENEDProtein ENEDIPI00165044ASLQHGQAAEKGPHR0.4 (delta mass [ppm])2 
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitIPI00297779ASLSLAPVNIFK1.5 (delta mass [ppm])2 
A344ESPARCL1, PIG33SPARC-like protein 1 precursorIPI00296777ASLVPMEHCITR0.7 (delta mass [ppm])3 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ASMDGSMR1 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR0.6 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR0.3 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR0.3 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR1.2 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR2.6 (delta mass [ppm])2 
A8401CST3Cystatin C precursorIPI00032293ASNDMYHSR1.6 (delta mass [ppm])2 
A9845MIEN1, RDX12, XTP4Chromosome 17 open reading frame 37IPI00031616ASNGETLEK0.3 (delta mass [ppm])2 
A9481SORL1Sortilin-related receptor precursorIPI00022608ASNLLLGFDR1.4 (delta mass [ppm])2 
A8006TNIK, AD 2, AD2TRAF2 and NCK interacting protein kinaseIPI00145805ASNPDLR0.2 (delta mass [ppm])2 
A8864LRRC25, MAPA, UNQ6169/PRO20174Leucine-rich repeat-containing protein 25 precursorIPI00296351ASNVILLDLSGNGLR0 (delta mass [ppm])2 
A074BTAF10, TAF2A, TAF2HTranscription initiation factor TFIID 30 kDa subunitIPI00030364ASPAGTAGGPGAGAAAGGTGPLAAR3 (delta mass [ppm])2 
A074BTAF10, TAF2A, TAF2HTranscription initiation factor TFIID 30 kDa subunitIPI00030364ASPAGTAGGPGAGAAAGGTGPLAAR1.6 (delta mass [ppm])2 
A5959CA1Carbonic anhydrase 1IPI00215983ASPDWGYDDK0.2 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751ASPFPVYK1.6 (delta mass [ppm])2 
A557BOXA1LInner membrane protein OXA1L, mitochondrial precursorIPI00014301ASPLPGK1.6 (delta mass [ppm])2 
A7224OBSCNObscurinIPI00288940ASPPLDSK0.8 (delta mass [ppm])2 
A6767EPHX2, CYTEPOXEpoxide hydrolase 2, cytoplasmicIPI00104341ASPSEVVFLDDIGANLKPAR2.9 (delta mass [ppm])3 
A4014SPINK5Serine protease inhibitor Kazal-type 5 precursorIPI00299453ASQEEDSPDSFSSLDSEMCK2.9 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00161229ASQGISNYLAWFQQKPGK0.8 (delta mass [ppm])3 
BY629 PREDICTED: Similar to IG kappa chain V regionIPI00007852ASQGISNYLAWYQQK0.4 (delta mass [ppm])2 
A9713FCGBPIgG Fc binding proteinIPI00242956ASQHGSDVVIETDFGLR1.8 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00473097ASQSIGSYLAWYQQK1.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384398ASQSISNYLNWYQQK0.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600ASQSISSWLAWYQQK0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600ASQSISSWLAWYQQKPGK0.3 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600ASQSISSWLAWYQQKPGK0.1 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00478600ASQSISSWLAWYQQKPGK0.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00398220ASQSISSYLNWYQQK2.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ASQSLSSSYLAWYQQKPGQAPR1.7 (delta mass [ppm])3 
A0406ATP6V1G1, ATP6G, ATP6G1Vacuolar ATP synthase subunit G 1IPI00025285ASQSQGIQQLLQAEK1.5 (delta mass [ppm])2 
A0406ATP6V1G1, ATP6G, ATP6G1Vacuolar ATP synthase subunit G 1IPI00025285ASQSQGIQQLLQAEK0.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00385253ASQSVSNNLAWYQQK0.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00385253ASQSVSNNLAWYQQK0.9 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115ASQSVSNSYLAWYQQK3.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115ASQSVSNSYLAWYQQKPGQAPR0.6 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115ASQSVSNSYLAWYQQKPGQAPR2 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387115ASQSVSNSYLAWYQQKPGQAPR0.9 (delta mass [ppm])3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQK0.7 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQK2.9 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQK2.6 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQK0.6 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQK0.5 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR1.6 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR1.6 (delta mass [ppm])3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR0.1 (delta mass [ppm])3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR1 (delta mass [ppm])3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR5 (delta mass [ppm])3 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ASQSVSSNLAWYQQKPGQAPR1.6 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384576ASQSVSSSYLAWYQQK1.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00384576ASQSVSSSYLAWYQQKPGQAPR2 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205ASQSVSSSYLAWYQQKPGQAPR1.4 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205ASQSVSSSYLAWYQQKPGQAPR2.2 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205ASQSVSSSYLAWYQQKPGQAPR1.7 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00030205ASQSVSSSYLAWYQQKPGQAPR0.3 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419453ASQSVSSYLAWYQQK2.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419453ASQSVSSYLAWYQQKPGQAPR1.3 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419453ASQSVSSYLAWYQQKPGQAPR1.5 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419453ASQSVSSYLAWYQQKPGQAPR1.4 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00419453ASQSVSSYLAWYQQKPGQAPR1.6 (delta mass [ppm])3 
A2126DNAI1Dynein intermediate chain 1, axonemalIPI00006030ASQTYNNPVR1.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ASSAKQR1.8 (delta mass [ppm])2 
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorIPI00013698ASSFAGYVGMLTGFK3.5 (delta mass [ppm])2 
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorIPI00013698ASSFAGYVGMLTGFKPGLFSLTLNER0.4 (delta mass [ppm])3 
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorIPI00013698ASSFAGYVGMLTGFKPGLFSLTLNER3.5 (delta mass [ppm])3 
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorIPI00013698ASSFAGYVGMLTGFKPGLFSLTLNER0.7 (delta mass [ppm])3 
A8720C4A, CO4, CPAMD2Complement C4 precursorIPI00643525ASSFLGEK2.6 (delta mass [ppm])1 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163ASSFLGEK1.1 (delta mass [ppm])1 
A8721C4B, C4B12, C4B-1Complement C4-B precursorIPI00418163ASSFLGEK0.7 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR0.8 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR1.7 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR0 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR2 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR0.2 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR1 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR2.5 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR3.1 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR0.8 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDR0.7 (delta mass [ppm])2 
A1276CLU, APOJ, CLIClusterin precursorIPI00291262ASSIIDELFQDRFFTR1.4 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR2.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR1.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR0.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR1.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387026ASSLESGVPSR0.5 (delta mass [ppm])2 
A8771FAIM3, TOSO, FCMRFAS apoptotic inhibitory molecule 3IPI00023119ASSVAGDKPR1.4 (delta mass [ppm])2 
A6483FAHFumarylacetoacetaseIPI00031708ASSVVVSGTPIR1.1 (delta mass [ppm])2 
A6483FAHFumarylacetoacetaseIPI00031708ASSVVVSGTPIR1.5 (delta mass [ppm])2 
A6483FAHFumarylacetoacetaseIPI00031708ASSVVVSGTPIR1.7 (delta mass [ppm])2 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180ASTDTMGR0.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387096ASTLETGVPSR0.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387096ASTLETGVPSR2.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387096ASTLETGVPSR2.2 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00387096ASTLETGVPSR0.4 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426ASTSTTIR0.9 (delta mass [ppm])2 
A080ARAP2BRas-related protein Rap-2bIPI00018364ASVDELFAEIVR0 (delta mass [ppm])2 
A080ARAP2BRas-related protein Rap-2bIPI00018364ASVDELFAEIVR0.9 (delta mass [ppm])2 
A0454DSPDesmoplakinIPI00013933ASVDSGSSEEQGGSSR0.7 (delta mass [ppm])2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573ASVDSGSSEEQGGSSR0.9 (delta mass [ppm])2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573ASVDSGSSEEQGGSSR0.2 (delta mass [ppm])2 
A1322PIGRPolymeric immunoglobulin receptor precursorIPI00004573ASVDSGSSEEQGGSSR2.3 (delta mass [ppm])2 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871ASVDSGSSEEQGGSSR1.6 (delta mass [ppm])2 
A581BPLXDC2, TEM7R, UNQ2514/PRO6003Plexin domain-containing protein 2 precursorIPI00044369ASVGQDSPEPR0.8 (delta mass [ppm])2 
A069D Uncharacterized protein C7orf57IPI00302368ASVLSQSPR4.3 (delta mass [ppm])2 
A0827ICAM1, P3.58, sICAM-1Intercellular adhesion molecule-1 precursorIPI00008494ASVSVTAEDEGTQR1.6 (delta mass [ppm])2 
A0827ICAM1, P3.58, sICAM-1Intercellular adhesion molecule-1 precursorIPI00008494ASVSVTAEDEGTQR0.6 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ASWIAQK1.5 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ASWIAQK2.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR1.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR1.5 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR0.9 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR0.6 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR0.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ASYAQQPAESR1.3 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR0.8 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR1.3 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR1.1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR1.4 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR1 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR0.8 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR2 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR3.2 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR3.3 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463ASYLDCIR1 (delta mass [ppm])2 
A6932LYPLA1, APT1, LPL1Acyl-protein thioesterase-1IPI00007321ATAAVIFLHGLGDTGHGWAEAFAGIR0.5 (delta mass [ppm])4 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ATAENEFVALK1.2 (delta mass [ppm])2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ATAENEFVALKK1.1 (delta mass [ppm])2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ATAENEFVALKK0.6 (delta mass [ppm])2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541ATAENEFVVLK1.1 (delta mass [ppm])2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541ATAENEFVVLKK1 (delta mass [ppm])2 
A7530PSMB5, LMPX, MB1Proteasome subunit beta type 5 precursorIPI00375704ATAGAYIASQTVK0.8 (delta mass [ppm])2 
A4343HSPA7, HSP70BHeat shock 70 kDa protein 7IPI00011134ATAGDTHLGGEDFDNR0 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901ATANSQVMGSANSTLR0.5 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00004901ATANSQVMGSANSTLR2.2 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00099883ATANSQVMGSANSTLR1.5 (delta mass [ppm])2 
A9332GPRC5C, RAIG3G protein-coupled receptor family C, group 5, member CIPI00099883ATANSQVMGSANSTLR2.4 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ATAPVSFNYYGVVTGPSASK0.4 (delta mass [ppm])2 
A869CBROX, BROFTIBRO1 domain-containing protein BROXIPI00065500ATAPVSFNYYGVVTGPSASK1.9 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR0.7 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATATSCRPCPCPYIDASR1.5 (delta mass [ppm])3 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ATAVMPDGQFK1.8 (delta mass [ppm])2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ATAVMPDGQFK0.1 (delta mass [ppm])2 
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1IPI00000874ATAVMPDGQFK0.9 (delta mass [ppm])2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350ATAVVDGAFK1.3 (delta mass [ppm])2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350ATAVVDGAFK0.6 (delta mass [ppm])2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350ATAVVDGAFK1.4 (delta mass [ppm])2 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIPI00027223ATDFVVPGPGK2 (delta mass [ppm])2 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIPI00027223ATDFVVPGPGK0.1 (delta mass [ppm])2 
A3661IDH1, PICDIsocitrate dehydrogenase [NADP] cytoplasmicIPI00027223ATDFVVPGPGK4.4 (delta mass [ppm])2 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421ATEDEGSEQKIPEATNR1.3 (delta mass [ppm])3 
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorIPI00165421ATEDEGSEQKIPEATNR1.1 (delta mass [ppm])3 
A8406CST4Cystatin S precursorIPI00032294ATEDEYYR0.7 (delta mass [ppm])2 
A8406CST4Cystatin S precursorIPI00032294ATEDEYYR0.2 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841ATEHLSTLSEK0.2 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841ATEHLSTLSEK0.5 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841ATEHLSTLSEK1.9 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841ATEHLSTLSEK1.1 (delta mass [ppm])2 
A1552APOA1, A175PApolipoprotein A-I precursorIPI00021841ATEHLSTLSEK0.6 (delta mass [ppm])2 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATFGCHDGYSLDGPEEIECTK0.6 (delta mass [ppm])3 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATFGCHDGYSLDGPEEIECTK1.5 (delta mass [ppm])3 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATFGCHDGYSLDGPEEIECTK1.9 (delta mass [ppm])3 
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinIPI00246058ATFISVQLK0.2 (delta mass [ppm])2 
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinIPI00246058ATFISVQLKK1.6 (delta mass [ppm])2 
A5751AKR1B10, AKR1B11Aldo-keto reductase family 1 member B10IPI00105407ATFLDAWEAMEELVDEGLVK1.6 (delta mass [ppm])3 
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorIPI00299116ATFNPAQDK1.4 (delta mass [ppm])2 
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorIPI00299116ATFNPAQDK0.8 (delta mass [ppm])2 
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorIPI00299116ATFNPAQDK0.6 (delta mass [ppm])2 
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorIPI00299116ATFNPAQDK1.7 (delta mass [ppm])2 
A5088PODXL, PCLP, PCLP1Podocalyxin-like protein 1 precursorIPI00299116ATFNPAQDK0.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR0.4 (delta mass [ppm])4 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR0.9 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR1.4 (delta mass [ppm])4 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284ATFSSVPLVASISAVSLEVAQPGPSNRPR1.1 (delta mass [ppm])3 
A9148VTCN1, B7H4, UNQ659/PRO1291v-SET domain containing T cell activation inhibitor 1IPI00302614ATGDIKVTESEIK2.3 (delta mass [ppm])2 
A9148VTCN1, B7H4, UNQ659/PRO1291v-SET domain containing T cell activation inhibitor 1IPI00302614ATGDIKVTESEIKR0.9 (delta mass [ppm])2 
A8443SERPINI1, PI12Neuroserpin precursorIPI00016150ATGEDENILFSPLSIALAMGMMELGAQGSTQK1.4 (delta mass [ppm])3 
A9845MIEN1, RDX12, XTP4Chromosome 17 open reading frame 37IPI00031616ATGGGLSSVGGGSSTIK0.1 (delta mass [ppm])2 
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionIPI00007884ATGIPAR0.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00385253ATGIPAR0.9 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00385253ATGIPAR2.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00385253ATGIPAR0.5 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00441043ATGIPDR0.7 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00441043ATGIPDR0.7 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808ATGIPDR1.5 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808ATGIPDR1.8 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808ATGIPDR0.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808ATGIPDR3.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00430808ATGIPDR3.3 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00448985ATGIPDR0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ATGIPDR0 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ATGIPDR0.9 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ATGIPDR1.2 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00549747ATGIPDRFSGSGSGTDFTLTISR2.3 (delta mass [ppm])3 
A8273IGK, SDNK1, A30Ig kappa chainIPI00644379ATGVPDR0.6 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00644379ATGVPDR0.4 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00644379ATGVPDR1.1 (delta mass [ppm])2 
A8273IGK, SDNK1, A30Ig kappa chainIPI00644379ATGVPDR0.6 (delta mass [ppm])2 
A1715APOA, LPAApolipoprotein(A) precursorIPI00029168ATIADLILSALER0.8 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATIADLILSALER2.3 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATIADLILSALER0.2 (delta mass [ppm])2 
A332CRAB7A, RAB7Ras-related protein Rab-7AIPI00016342ATIGADFLTK0.6 (delta mass [ppm])2 
A332CRAB7A, RAB7Ras-related protein Rab-7AIPI00016342ATIGADFLTK2.5 (delta mass [ppm])2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00554711ATIGLIR0.8 (delta mass [ppm])2 
A7292PAPPA2, PLAC3, PAPPEPappalysin-2 precursorIPI00013569ATILISHSR1.6 (delta mass [ppm])2 
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BIPI00550181ATISDEEIER0.4 (delta mass [ppm])2 
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BIPI00550181ATISDEEIER2.3 (delta mass [ppm])2 
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BIPI00550181ATISDEEIER0 (delta mass [ppm])2 
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BIPI00550181ATISDEEIER0 (delta mass [ppm])2 
A868BCHMP2B, CGI-84Charged multivesicular body protein 2BIPI00550181ATISDEEIER0.3 (delta mass [ppm])2 
A1203PTPRG, PTPGProtein-tyrosine phosphatase gamma precursorIPI00011651ATISHVSPDSLYLFR0.9 (delta mass [ppm])3 
A1203PTPRG, PTPGProtein-tyrosine phosphatase gamma precursorIPI00011651ATISHVSPDSLYLFR2.2 (delta mass [ppm])2 
A1203PTPRG, PTPGProtein-tyrosine phosphatase gamma precursorIPI00011651ATISHVSPDSLYLFR2.9 (delta mass [ppm])3 
A1203PTPRG, PTPGProtein-tyrosine phosphatase gamma precursorIPI00011651ATISHVSPDSLYLFR3 (delta mass [ppm])3 
A1203PTPRG, PTPGProtein-tyrosine phosphatase gamma precursorIPI00011651ATISHVSPDSLYLFR0.4 (delta mass [ppm])3 
A1466FN1, FNFibronectinIPI00022418ATITGYR0.7 (delta mass [ppm])2 
A5448REG1A, PSPS, PSPS1Lithostathine 1 alpha precursorIPI00009027ATITGYR0.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLK0.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLK0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLK2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLK1.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLK2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434ATKEQLKAVMDDFAAFVEK1 (delta mass [ppm])3 
A8438SERPINA4, KST, PI4Kallistatin precursorIPI00328609ATLDVDEAGTEAAAATSFAIK0.2 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ATLGGNFR1.5 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292ATLGGNFR2.5 (delta mass [ppm])2 
A1620CFD, DF, PFDComplement factor D precursorIPI00019579ATLGPAVR0.4 (delta mass [ppm])2 
A131CIGF2R, MPRI, igf2RCation-independent mannose-6-phosphate receptor precursorIPI00289819ATLITFLCDR0.1 (delta mass [ppm])2 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ATLLEEQLPLGK2.1 (delta mass [ppm])2 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ATLLEEQLPLGK2.1 (delta mass [ppm])2 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ATLLEEQLPLGK0.5 (delta mass [ppm])2 
A8925PDCD1LG2, B7DC, CD273Programmed cell death 1 ligand 2 precursorIPI00414542ATLLEEQLPLGK2.1 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ATLQLSR0 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ATLQLSR0.1 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476ATLQLSR1.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00386158ATLVCLISDFYPGAVTVAWK1.4 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0.4 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0.6 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK3.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0.2 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK1.5 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK3.3 (delta mass [ppm])2 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWK0.6 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095ATLVCLISDFYPGAVTVAWKADGSPVK1.8 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00551005ATLVCLISDFYPGAVTVAWKADSSPVK3.4 (delta mass [ppm])3 
A8364IGL, IGLV3-22, V2-15Ig lambda chainIPI00645569ATLVCLISDFYPGVVTVAWK2.3 (delta mass [ppm])2 
A8274IGLL1, IGL1, IGLJ14.1Immunoglobulin lambda-like polypeptide 1 precursorIPI00642632ATLVCLVSDFYPGAVTVAWK1.6 (delta mass [ppm])2 
A9381LILRA5, ILT11, LILRB7Leukocyte immunoglobulin-like receptor subfamily A member 5IPI00158145ATLWAEPGSVISR0.6 (delta mass [ppm])2 
A9381LILRA5, ILT11, LILRB7Leukocyte immunoglobulin-like receptor subfamily A member 5IPI00158145ATLWAEPGSVISR2.8 (delta mass [ppm])2 
A9381LILRA5, ILT11, LILRB7Leukocyte immunoglobulin-like receptor subfamily A member 5IPI00158145ATLWAEPGSVISR0.2 (delta mass [ppm])2 
A9381LILRA5, ILT11, LILRB7Leukocyte immunoglobulin-like receptor subfamily A member 5IPI00158145ATLWAEPGSVISR0.4 (delta mass [ppm])2 
A9381LILRA5, ILT11, LILRB7Leukocyte immunoglobulin-like receptor subfamily A member 5IPI00158145ATLWAEPGSVISR2.8 (delta mass [ppm])2 
A3743KRT17Keratin, type I cytoskeletal 17IPI00411506ATMQNLNDR1.8 (delta mass [ppm])2 
A0742TTNTitinIPI00397522ATNGSGQATSTAELLVK0.7 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR1.1 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR1.7 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR1 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR0.6 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR4.4 (delta mass [ppm])2 
A1945GGT6Gamma-glutamyltransferase 6IPI00440764ATNPQLAAVLR1.8 (delta mass [ppm])2 
A6663GSSGlutathione synthetaseIPI00010706ATNWGSLLQDK4.9 (delta mass [ppm])2 
A6935LYZ, LZMLysozyme C precursorIPI00019038ATNYNAGDR1.4 (delta mass [ppm])2 
A6935LYZ, LZMLysozyme C precursorIPI00019038ATNYNAGDR1.1 (delta mass [ppm])2 
A0285BSN, ZNF231Bassoon proteinIPI00020153ATPAELR1.9 (delta mass [ppm])2 
A9055SIRPB1Signal-regulatory protein beta-1IPI00299724ATPEHTVSFTCESHGFSPR2.2 (delta mass [ppm])3 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIPI00479169ATPFIECNGGR0.1 (delta mass [ppm])2 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK2.7 (delta mass [ppm])3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK3.2 (delta mass [ppm])3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK4 (delta mass [ppm])3 
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3IPI00010402ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA2.6 (delta mass [ppm])3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887ATPQHTVSFTCESHGFSPR1.1 (delta mass [ppm])3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887ATPQHTVSFTCESHGFSPR0.4 (delta mass [ppm])3 
A0519SIRPA, BIT, MFRProtein-tyrosine phosphatase non-receptor type substrate 1 precursorIPI00332887ATPQHTVSFTCESHGFSPR1 (delta mass [ppm])3 
A1743PLA2G15, LYPLA3, UNQ341/PRO540Group XV phospholipase A2IPI00301459ATQFPDGVDVR4.9 (delta mass [ppm])2 
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseIPI00060200ATQIPSYK0.5 (delta mass [ppm])2 
A7472ACPPProstatic acid phosphatase precursorIPI00396434ATQIPSYK0.2 (delta mass [ppm])1 
A7472ACPPProstatic acid phosphatase precursorIPI00396434ATQIPSYK1.4 (delta mass [ppm])2 
A7472ACPPProstatic acid phosphatase precursorIPI00396434ATQIPSYK3.1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426ATQIPSYK1 (delta mass [ppm])2 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426ATQIPSYKK1.2 (delta mass [ppm])2 
A506DGPC1Glypican-1IPI00015688ATRAFVAARSFVQGLGVASDVVR3.8 (delta mass [ppm])3 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215ATSIVAWLAK1.2 (delta mass [ppm])2 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215ATSIVAWLAK0.1 (delta mass [ppm])2 
A320ACRTC1, MECT1, TORC1CREB-regulated transcription coactivator 1IPI00303383ATSNNPR3.2 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751ATSVALTWSR1.7 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751ATSVALTWSR0.9 (delta mass [ppm])2 
A8482ra-a47, SERPINH1, CBP1Collagen-binding protein 2 precursorIPI00019880ATTASQAK3.8 (delta mass [ppm])2 
A1468PLGPlasminogen precursorIPI00019580ATTVTGTPCQDWAAQEPHR0.8 (delta mass [ppm])3 
A1468PLGPlasminogen precursorIPI00019580ATTVTGTPCQDWAAQEPHR0.5 (delta mass [ppm])3 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATVFLEQR0.6 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATVFLEQR1.1 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATVFLEQR4.1 (delta mass [ppm])2 
A191DUNQ904/PRO1925, SARG904, UNQ904UPF0764 protein C16orf89IPI00166766ATVFLEQR0.1 (delta mass [ppm])2 
A5100PROM1, PROML1, MSTP061Prominin 1 precursorIPI00012540ATVFLLPALIFAVK0.5 (delta mass [ppm])2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003ATVLNYLPK0.6 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR0.2 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR0.2 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR1.3 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR2.8 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR3.2 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR1.5 (delta mass [ppm])2 
A8706CD14Monocyte differentiation antigen CD14 precursorIPI00029260ATVNPSAPR1.6 (delta mass [ppm])2 
A506BLRRN6A, LINGO1, LERN1Leucine-rich repeat and immunoglobulin-like domain containing NOGO receptor-interacting protein 1IPI00465325ATVPFPFDIK0.2 (delta mass [ppm])2 
A0441FABP5Fatty acid binding protein 5 (psoriasis-associated)IPI00007797ATVQQLEGR0.2 (delta mass [ppm])2 
A0441FABP5Fatty acid binding protein 5 (psoriasis-associated)IPI00007797ATVQQLEGR0.5 (delta mass [ppm])2 
A0441FABP5Fatty acid binding protein 5 (psoriasis-associated)IPI00007797ATVQQLEGR0.1 (delta mass [ppm])2 
A0441FABP5Fatty acid binding protein 5 (psoriasis-associated)IPI00007797ATVQQLEGR1.2 (delta mass [ppm])2 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATVVYQGER1.7 (delta mass [ppm])2 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATVVYQGER0.3 (delta mass [ppm])2 
A8663APOH, B2G1Beta-2-glycoprotein 1 precursorIPI00298828ATVVYQGER1.9 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR2.1 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR2 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR1.8 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR0.5 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR0.1 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR3 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR3.5 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR1.6 (delta mass [ppm])2 
A735CA1BGAlpha-1B-glycoprotein precursorIPI00022895ATWSGAVLAGR1 (delta mass [ppm])2 
A6739holEDNA polymerase III subunit thetaGI:123456ATYATSDFTLLELNNAANPAFNLFWAGWDR0.1 (delta mass [ppm])3 
A6739holEDNA polymerase III subunit thetaGI:123456ATYATSDFTLLELNNAANPAFNLFWAGWDRR0.1 (delta mass [ppm])3 
A1423COL6A3Collagen alpha 3(VI) chain precursorIPI00220701ATYHGSFSTK1.5 (delta mass [ppm])2 
A1423COL6A3Collagen alpha 3(VI) chain precursorIPI00220701ATYHGSFSTK0.5 (delta mass [ppm])2 
A706CVTA1, HSPC228, My012Vacuolar protein sorting-associaterd protein VTA1 homologIPI00017160ATYIHNCLK1.1 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ATYIQNYR1.2 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ATYIQNYR0.7 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ATYIQNYR3.1 (delta mass [ppm])2 
A6335CTBS, CTBDi-N-acetylchitobiase precursorIPI00007778ATYIQNYR2.3 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ATYTISITHPK1.5 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ATYTISITHPK1.4 (delta mass [ppm])2 
A5796ENPEPGlutamyl aminopeptidaseIPI00014375ATYTISITHPK2.7 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AVADLALIPDVDIDSDGVFK2.3 (delta mass [ppm])2 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AVADLALIPDVDIDSDGVFK3.7 (delta mass [ppm])3 
A7389PHPT1, PHP14, CGI-202Phosphohistidine phosphatase 1IPI00299977AVADLALIPDVDIDSDGVFK1.8 (delta mass [ppm])2 
A9469ROBO4, UNQ421/PRO3674, UNQ421Roundabout homolog 4 precursorIPI00103871AVADTRDQADGSR1.1 (delta mass [ppm])2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136AVAFQDCPVDLFFVLDTSESVALR2.4 (delta mass [ppm])3 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136AVAFQDCPVDLFFVLDTSESVALR3 (delta mass [ppm])3 
A5647ABHD14B, CIBAlpha/beta hydrolase domain-containing protein 14BIPI00063827AVAIDLPGLGHSK1.1 (delta mass [ppm])2 
A5647ABHD14B, CIBAlpha/beta hydrolase domain-containing protein 14BIPI00063827AVAIDLPGLGHSK2.8 (delta mass [ppm])2 
A628BTMEM183ATransmembrane protein 183AIPI00293381AVANAVQQEVK0.8 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFK1.1 (delta mass [ppm])4 
A233AATOH8, ATH6, BHLHA21Atonal homolog 8IPI00045865AVATNGLR1.7 (delta mass [ppm])2 
A760BYIPF3, KLIP1Protein YIPF3IPI00329688AVAVTLQSH0.6 (delta mass [ppm])2 
A760BYIPF3, KLIP1Protein YIPF3IPI00329688AVAVTLQSH1.4 (delta mass [ppm])2 
A8930MZB1, PACAP, HSPC190Plasma cell-induced resident endoplasmic reticulum proteinIPI00102821AVAYQMWQNLAK0.5 (delta mass [ppm])2 
A8181VAT1, 694:2Synaptic vesicle membrane protein VAT-1 homologIPI00156689AVCGFHLGYLDGEVELVSGVVAR0.6 (delta mass [ppm])3 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR0.8 (delta mass [ppm])3 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR1 (delta mass [ppm])4 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR1 (delta mass [ppm])3 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR1 (delta mass [ppm])3 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR1.7 (delta mass [ppm])3 
A6859KLK3, APSProstate specific antigen precursorIPI00010858AVCGGVLVHPQWVLTAAHCIR0.6 (delta mass [ppm])3 
A7842SOD1Superoxide dismutase [Cu-Zn]IPI00218733AVCVLKGDGPVQGIINFEQK0.2 (delta mass [ppm])3 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK0.7 (delta mass [ppm])1 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK0.5 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK0.3 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK0 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK0.1 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALK4.9 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439AVDAALK1.5 (delta mass [ppm])2 
A298ESEMG1, SEMGSemenogelin-1IPI00414684AVDAALK0.8 (delta mass [ppm])2 
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1IPI00022204AVDAALK2.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK0.1 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK1.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK0.4 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK1.6 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK0.9 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK1.6 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK0.2 (delta mass [ppm])2 
A1539KNG1, BDK, KNGKininogen-1IPI00215894AVDAALKK0.3 (delta mass [ppm])2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439AVDAALKK0.4 (delta mass [ppm])2 
A8500SCCA1, SERPINB3, SCCASquamous cell carcinoma antigen 1IPI00022204AVDAALKK1.6 (delta mass [ppm])2 
A0757CNTN1Contactin-1 precursorIPI00029751AVDLIPWMEYEFR1.3 (delta mass [ppm])2 
A7159NIT2, CUA002Omega-amidase NIT2IPI00549467AVDNQVYVATASPAR0.7 (delta mass [ppm])2 
A4802FAT4, CDHF14, FATJProtocadherin Fat 4IPI00234091AVDPDEGVNGMVLYSLK0.9 (delta mass [ppm])2 
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorIPI00478003AVDQSVLLMKPDAELSASSVYNLLPEK0 (delta mass [ppm])3 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER1.1 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER1.8 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER0.6 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER0.1 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER0.8 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER2.2 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER3.4 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER0.3 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER1.5 (delta mass [ppm])2 
A4941LGALS3BP, M2BPGalectin-3-binding protein precursorIPI00023673AVDTWSWGER1 (delta mass [ppm])2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AVEHINK1.3 (delta mass [ppm])2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AVEHINK0.4 (delta mass [ppm])2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248AVEHINK1.5 (delta mass [ppm])2 
A4450CNGB1, CNCG2, CNCG3LCyclic-nucleotide-gated cation channel 4IPI00297656AVEKMPR3.8 (delta mass [ppm])2 
A7989TKT, TKT1TransketolaseIPI00021716AVELAANTK0.5 (delta mass [ppm])2 
A113CMITD1MIT domain-containing protein 1IPI00103065AVELDSESR0.1 (delta mass [ppm])2 
A6946MAN1A1Mannosyl-oligosaccharide 1,2-alpha-mannosidase IAIPI00291641AVELGVK1.1 (delta mass [ppm])1 
A6946MAN1A1Mannosyl-oligosaccharide 1,2-alpha-mannosidase IAIPI00291641AVELGVK1.9 (delta mass [ppm])2 
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3IPI00171199AVENSSTAIGIR0.7 (delta mass [ppm])2 
A7520PSMA3, HC8, PSC8Proteasome subunit alpha type 3IPI00171199AVENSSTAIGIR1.1 (delta mass [ppm])2 
A4619CDH19, CDH7L2, UNQ478/PRO941Cadherin-19 precursorIPI00028135AVEPESEFVIK0.8 (delta mass [ppm])2 
A8024TRHDE, UNQ2507/PRO5995, UNQ2507Thyrotropin-releasing hormone degrading ectoenzymeIPI00007798AVETVEANVR0.3 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AVEVLPK0.7 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AVEVLPK0.8 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AVEVLPK0.6 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AVEVLPK0.9 (delta mass [ppm])2 
A0419GSNGelsolin precursor, plasmaIPI00026314AVEVLPK2.2 (delta mass [ppm])2 
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseIPI00060200AVFGELPSGGGTVEK0.6 (delta mass [ppm])2 
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseIPI00060200AVFGELPSGGGTVEK2.8 (delta mass [ppm])2 
A6559GALM, Ibd1, BLOCK25Aldose 1-epimeraseIPI00060200AVFGELPSGGGTVEK0.8 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR0.6 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR1.3 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR0.5 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR0.5 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR2 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGR0.1 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AVFPSIVGR0.7 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AVFPSIVGR0.9 (delta mass [ppm])2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439AVFPSIVGRPR1.6 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AVFPSIVGRPR2.6 (delta mass [ppm])2 
A4552ACTG1, ACTGActin, cytoplasmic 2IPI00021440AVFPSIVGRPR0.6 (delta mass [ppm])2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00218343AVFVDLEPTVIDEVR0.4 (delta mass [ppm])2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00166768AVFVDLEPTVIDEVR1.8 (delta mass [ppm])2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00166768AVFVDLEPTVIDEVR2 (delta mass [ppm])2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00166768AVFVDLEPTVIDEVR1.1 (delta mass [ppm])2 
A8413GPC3, OCI5Glypican-3 precursorIPI00019907AVFVDLEPTVIDEVR2.8 (delta mass [ppm])2 
A6739holEDNA polymerase III subunit thetaGI:123456AVGAYSK2.5 (delta mass [ppm])1 
A6739holEDNA polymerase III subunit thetaGI:123456AVGAYSK1.1 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR1.7 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR1.5 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR1.4 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR0.5 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR2.8 (delta mass [ppm])2 
A6356DPEP1, MDP, RDPMicrosomal dipeptidase precursorIPI00059476AVGFGGDFDGVPR3.2 (delta mass [ppm])2 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215AVGFLEIGYQK0.9 (delta mass [ppm])2 
A8379A2ML1, CPAMD9Alpha-2-Macroglobulin-like protein 1IPI00419215AVGFLEIGYQK1.2 (delta mass [ppm])2 
A3887HNT, NTM, IGLON2Neurotrimin precursorIPI00442294AVGFVSEDEYLEIQGITR0.9 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0.8 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK1 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0.5 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK1.1 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0.6 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0.9 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK0.3 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK2.2 (delta mass [ppm])2 
A4194PSCA, UNQ206/PRO232, UNQ206Prostate stem cell antigen precursorIPI00013446AVGLLTVISK1.7 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AVGNLRK0.4 (delta mass [ppm])2 
A643CTF, PRO1400Serotransferrin precursorIPI00022463AVGNLRK0.6 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR0.9 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR1 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR0.1 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR3.6 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR2.9 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00300865AVGPSLDLLR1.3 (delta mass [ppm])2 
A431BFAM151A, UNQ3034/PRO9836, UNQ3034Protein FAM151AIPI00064917AVGPSLDLLR1.7 (delta mass [ppm])2 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AVGVPALGFSPMNR0 (delta mass [ppm])2 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AVGVPALGFSPMNR2.4 (delta mass [ppm])2 
A5703ACY1, ABHD14A-ACY1Aminoacylase-1IPI00009268AVGVPALGFSPMNR2.4 (delta mass [ppm])2 
A7390PCBD1, DCOH, PCBDPterin-4-alpha-carbinolamine dehydrataseIPI00218568AVGWNELEGR1.6 (delta mass [ppm])2 
A7390PCBD1, DCOH, PCBDPterin-4-alpha-carbinolamine dehydrataseIPI00218568AVGWNELEGR0.7 (delta mass [ppm])2 
A6004CPECarboxypeptidase E precursorIPI00031121AVIHWIMDIPFVLSANLHGGDLVANYPYDETR2.8 (delta mass [ppm])3 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AVIPGLR0.6 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095AVIQVSQIVAR1 (delta mass [ppm])2 
A6254DCXR, KIDCRL-xylulose reductaseIPI00448095AVIQVSQIVAR1.6 (delta mass [ppm])2 
A9899EPS8L1, PP10566, EPS8R1Epidermal growth factor receptor kinase substrate 8-like protein 1IPI00026345AVISTVER2.3 (delta mass [ppm])2 
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16IPI00062120AVIVLVENFYK0.7 (delta mass [ppm])2 
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16IPI00062120AVIVLVENFYK3 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AVLALLR0.2 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AVLALLR3.4 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AVLALLR1.4 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AVLALLR1.9 (delta mass [ppm])2 
A9269CLEC14A, EGFR5, UNQ236/PRO269C-type lectin domain family 14 member AIPI00240345AVLALLR0.7 (delta mass [ppm])2 
A019ANOV, CCN3, IGFBP9NOV protein homolog precursorIPI00011140AVLDGCSCCLVCAR0.8 (delta mass [ppm])2 
A019ANOV, CCN3, IGFBP9NOV protein homolog precursorIPI00011140AVLDGCSCCLVCAR0.2 (delta mass [ppm])2 
A019ANOV, CCN3, IGFBP9NOV protein homolog precursorIPI00011140AVLDGCSCCLVCAR0.8 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK1.4 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK1.3 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK2.8 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK3.2 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK2.4 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK1.1 (delta mass [ppm])2 
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorIPI00550991AVLDVFEEGTEASAATAVK0.6 (delta mass [ppm])2 
A6615SHMT1, SHMTSerine hydroxymethyltransferase 1, cytosolicIPI00002519AVLEALGSCLNNK0.3 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00012011AVLFCLSEDK4.5 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00012011AVLFCLSEDKK0.5 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00012011AVLFCLSEDKK2.1 (delta mass [ppm])2 
A0999CFL1, CFLCofilin, non-muscle isoformIPI00012011AVLFCLSEDKK3.9 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AVLGAVPR0.7 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AVLGAVPR0.7 (delta mass [ppm])2 
A5806NAGLU, UFHSD1, ufHSD2Alpha-N-acetylglucosaminidaseIPI00008787AVLGAVPR1.2 (delta mass [ppm])2 
A8515SERPINA7, TBGThyroxine-binding globulin precursorIPI00292946AVLHIGEK0.2 (delta mass [ppm])2 
A8515SERPINA7, TBGThyroxine-binding globulin precursorIPI00292946AVLHIGEK1.3 (delta mass [ppm])2 
A6551GPIGlucose-6-phosphate isomeraseIPI00027497AVLHVALR1.7 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVLHVHGGGGPR1.6 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVLHVHGGGGPR0.1 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVLHVHGGGGPR0.8 (delta mass [ppm])3 
A8383AMBP, ITIL, HCPAMBP protein precursorIPI00022426AVLPQEEEGSGGGQLVTEVTK1.8 (delta mass [ppm])2 
A8390SERPINA6, CBGCorticosteroid-binding globulin precursorIPI00027482AVLQLNEEGVDTAGSTGVTLNLTSKPIILR0.5 (delta mass [ppm])3 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK0.2 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK0 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK0.7 (delta mass [ppm])1 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK1.3 (delta mass [ppm])1 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK1.1 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK1.3 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK1.8 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK0.8 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK1.2 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK2.5 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEK2.2 (delta mass [ppm])2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorIPI00553177AVLTIDEKGTEAAGAMFLEAIPMSIPPEVK1.4 (delta mass [ppm])3 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1.7 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK2.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.3 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.9 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1.1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1.8 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.6 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1.5 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK1.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEK0.2 (delta mass [ppm])2 
A1581ALB, GIG20, GIG42Serum albumin precursorIPI00022434AVMDDFAAFVEKCCK1.8 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AVPTQCDVPPNSR2.4 (delta mass [ppm])2 
A6929GAALysosomal alpha-glucosidase precursorIPI00293088AVPTQCDVPPNSR1.9 (delta mass [ppm])2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AVPWVILSDGDGTVEK0.5 (delta mass [ppm])2 
A5976CANT1, SHAPY, ENTPD8Soluble calcium-activated nucleotidase 1IPI00103175AVPWVILSDGDGTVEK3.8 (delta mass [ppm])2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136AVQEAQR0 (delta mass [ppm])2 
A1410COL6A1Collagen alpha 1(VI) chain precursorIPI00291136AVQEAQR0.1 (delta mass [ppm])2 
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionIPI00382492AVQLLESGGGLVQPGGSLR2.1 (delta mass [ppm])2 
A5964CA2Carbonic anhydrase 2IPI00218414AVQQPDGLAVLGIFLK3.2 (delta mass [ppm])2 
A127DTTC40TPR repeat-containing protein C10ORF93IPI00456875AVRLGDPR3.4 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVRVPGHEDGVTISGLEPDHKYK2.7 (delta mass [ppm])4 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVRVPGHEEGVTISGLEPDHK1.3 (delta mass [ppm])3 
A5930BIRC6Baculoviral IAP repeat-containing protein 6IPI00299635AVSATPPR3.8 (delta mass [ppm])2 
A687BTMBIM1, RECS1, PP1201Transmembrane BAX inhibitor motif-containing protein 1IPI00290452AVSDSFGPGEWDDR1.8 (delta mass [ppm])2 
A644CMFI2, MAP97Melanotransferrin precursorIPI00029275AVSDYFGGSCVPGAGETSYSESLCR1 (delta mass [ppm])2 
A1775TIMP2Metalloproteinase inhibitor 2 precursorIPI00027166AVSEKEVDSGNDIYGNPIKR1.1 (delta mass [ppm])3 
A1775TIMP2Metalloproteinase inhibitor 2 precursorIPI00027166AVSEKEVDSGNDIYGNPIKR0.5 (delta mass [ppm])3 
A1775TIMP2Metalloproteinase inhibitor 2 precursorIPI00027166AVSEKEVDSGNDIYGNPIKR2.3 (delta mass [ppm])3 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AVSESQLK1 (delta mass [ppm])1 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AVSESQLK2.6 (delta mass [ppm])1 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AVSESQLKK1.4 (delta mass [ppm])2 
A645CTSG101Tumor susceptibility gene 101 proteinIPI00018434AVSESQLKK0.5 (delta mass [ppm])2 
A1094AGER, RAGEAdvanced glycosylation end product-specific receptor precursorIPI00431197AVSISIIEPGEEGPTAGEGFDK1.8 (delta mass [ppm])2 
A1094AGER, RAGEAdvanced glycosylation end product-specific receptor precursorIPI00431197AVSISIIEPGEEGPTAGEGFDK2.6 (delta mass [ppm])2 
A1094AGER, RAGEAdvanced glycosylation end product-specific receptor precursorIPI00431197AVSISIIEPGEEGPTAGEGFDKVR0.6 (delta mass [ppm])3 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AVSISPTNVILTWK1.1 (delta mass [ppm])2 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AVSISPTNVILTWK1.5 (delta mass [ppm])2 
A1110EPS8Epidermal growth factor receptor kinase substrate 8IPI00290337AVSLIDLESK1.4 (delta mass [ppm])2 
A7361MPOMyeloperoxidase precursorIPI00007244AVSNEIVR0.8 (delta mass [ppm])2 
A1250UBE2V2, MMS2, UEV2Enterocyte differentiation promoting factorIPI00019600AVSTGVK1.4 (delta mass [ppm])1 
A1497ATF, PLAUUrokinase-type plasminogen activator precursorIPI00296180AVSVPLTLAETVASLWPALQELAR1.2 (delta mass [ppm])3 
A1849TNXB, HXBL, TNXTenascin-XIPI00025276AVSYPASVR0.8 (delta mass [ppm])2 
A0907YWHAQ14-3-3 protein tauIPI00018146AVTEQGAELSNEER0 (delta mass [ppm])2 
A0907YWHAQ14-3-3 protein tauIPI00018146AVTEQGAELSNEER3.6 (delta mass [ppm])2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318AVTEQGHELSNEER0.5 (delta mass [ppm])2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318AVTEQGHELSNEER2.6 (delta mass [ppm])2 
A1931PVRL3, PRR3Poliovirus receptor-related protein 3 precursorIPI00022959AVTFPLGNAQSSTTVTVLVEPTVSLIK0.9 (delta mass [ppm])3 
A0454DSPDesmoplakinIPI00013933AVTGYNDPETGNIISLFQAMNK1.5 (delta mass [ppm])3 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVTLECVSAGEPR0.1 (delta mass [ppm])2 
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinIPI00024284AVTLECVSAGEPR3 (delta mass [ppm])2 
A5068PCDH9Protocadherin-9IPI00006967AVTLSILNDNDNFVLDPYSGVIK0.6 (delta mass [ppm])3 
A2615MUC5B, MUC5, MG1Mucin-5BIPI00012165AVTLSLDGGDTAIR2 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR1.6 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR0.2 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR0.4 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR0 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR2.9 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR1.1 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR2.5 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR3.6 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR1.9 (delta mass [ppm])2 
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPI00007221AVVEVDESGTR1.3 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR0.5 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR2.7 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR0.1 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR2.4 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR2 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR0.9 (delta mass [ppm])2 
A9298FCGR3A, CD16A, FCG3Low affinity immunoglobulin gamma Fc region receptor III-A precursorIPI00218834AVVFLEPQWYR1.7 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK0 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK0.9 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK1.8 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK0 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK0.4 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEK0.9 (delta mass [ppm])2 
A9299FCGR3B, CD16B, FCG3Low affinity immunoglobulin gamma Fc region receptor III-B precursorIPI00023858AVVFLEPQWYSVLEKDSVTLK0.1 (delta mass [ppm])3 
A5419NPC2, HE1Epididymal secretory protein E1 precursorIPI00301579AVVHGILMGVPVPFPIPEPDGCK4 (delta mass [ppm])3 
A5419NPC2, HE1Epididymal secretory protein E1 precursorIPI00301579AVVHGILMGVPVPFPIPEPDGCK4.2 (delta mass [ppm])3 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812AVVQVFEGTSGIDAK1.9 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR1.4 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR1.5 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR0.5 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR0.9 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR1.5 (delta mass [ppm])2 
A7843SOD3Extracellular superoxide dismutase [Cu-Zn] precursorIPI00027827AVVVHAGEDDLGR2.1 (delta mass [ppm])2 
A0055GNAI2, GNAI2BGuanine nucleotide-binding protein G(i), alpha-2 subunitIPI00465121AVVYSNTIQSIMAIVK2.5 (delta mass [ppm])2 
A7357PEPD, PRDXaa-Pro dipeptidaseIPI00257882AVYEAVLR0.4 (delta mass [ppm])2 
A8394CRISPLD1, CRISP10, LCRISP1Cysteine-rich secretory protein LCCL domain-containing 1 precursorIPI00027806AVYLVCNYSPK2.5 (delta mass [ppm])2 
A925BCUBN, IFCRCubilinIPI00160130AVYQVACGDELTGEGVIR1.1 (delta mass [ppm])2 
A925BCUBN, IFCRCubilinIPI00160130AVYQVACGDELTGEGVIR2.5 (delta mass [ppm])2 
A4817FLRT2, UNQ232/PRO265Leucine-rich repeat transmembrane protein FLRT2 precursorIPI00001633AWAGIDLK2.3 (delta mass [ppm])1 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008AWAGIDLK0.9 (delta mass [ppm])2 
A8509SPINT1, HAI1, UNQ223/PRO256Kunitz-type protease inhibitor 1 precursorIPI00376403AWAGIDLK2.6 (delta mass [ppm])1 
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorIPI00179330AWAGIDLK0.5 (delta mass [ppm])2 
A988BFOLR1, FOLR, hFRFolate receptor alpha precursorIPI00441498AWAGIDLK0.4 (delta mass [ppm])2 
A5770GPT, AAT1, GPT1Alanine aminotransferase 1IPI00217458AWALDVAELHR0.4 (delta mass [ppm])3 
A4649CDHR2, PCDH24, PCLKCProtocadherin-24IPI00307446AWDADQTEANNR0.7 (delta mass [ppm])2 
A6663GSSGlutathione synthetaseIPI00010706AWELYGSPNALVLLIAQEK1 (delta mass [ppm])2 
A5834SMPD1, ASMSphingomyelin phosphodiesterase 1 precursorIPI00296461AWEPWLPAEALR0.2 (delta mass [ppm])2 
A8867LTBP1Latent transforming growth factor beta binding protein 1 precursorIPI00220249AWGPHCEK0.1 (delta mass [ppm])2 
A8868LTBP2, LTBP-2, LTBP3Latent-transforming growth factor beta-binding protein 2IPI00292150AWGSECEK1.4 (delta mass [ppm])2 
A4756DSG2, CDHF5Desmoglein 2 precursorIPI00028931AWITAPVALR1.4 (delta mass [ppm])2 
A9846CRNN, DRC1, PDRC1CornulinIPI00297056AWLCPTQR0.2 (delta mass [ppm])2 
A6946MAN1A1Mannosyl-oligosaccharide 1,2-alpha-mannosidase IAIPI00291641AWLMSDK0.9 (delta mass [ppm])2 
A6946MAN1A1Mannosyl-oligosaccharide 1,2-alpha-mannosidase IAIPI00291641AWLMSDKTDLEAK0.7 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AWMAGTLQLGR0.3 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AWMAGTLQLGR3.4 (delta mass [ppm])2 
A6763HYAL1, LUCA1, LUCA1/HYAL1Hyaluronoglucosaminidase 1IPI00168847AWMAGTLQLGR4.8 (delta mass [ppm])2 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AWNTNLR0.4 (delta mass [ppm])2 
A363CRHCG, CDRC2, PDRC2Ammonium transporter RH type CIPI00008820AWNTNLR0.9 (delta mass [ppm])2 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]IPI00220271AWRDPDEPVLLEEPVVLALAEK1.4 (delta mass [ppm])3 
A5750AKR1A1, ALDR1, ALRAlcohol dehydrogenase [NADP+]IPI00220271AWRDPDEPVLLEEPVVLALAEK3.6 (delta mass [ppm])3 
A7653QSOX1, QSCN6, BPGF-1Sulfhydryl oxidase 1IPI00003590AWRPALYLAALDCAEETNSAVCR1 (delta mass [ppm])3 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488AYAANVYTSVVEELAR1.7 (delta mass [ppm])2 
A6953MAN2B2Epididymis-specific alpha-mannosidaseIPI00328488AYAANVYTSVVEELAR1.4 (delta mass [ppm])2 
A9695CILP2, CLIP-2Cartilage intermediate layer protein 2 precursorIPI00216780AYANDKFTPSEQVEGVVVTLVNLEPAPGFSANPR2.9 (delta mass [ppm])3 
A1195PTPRJ, DEP1Receptor-type tyrosine-protein phosphatase etaIPI00290328AYAVILTTGEAGHPSADVLK0 (delta mass [ppm])3 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK0.9 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK1.3 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK1.7 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK0.5 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK2.5 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK2.4 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK0.9 (delta mass [ppm])2 
A708BTMEM27, UNQ679/PRO1312, NX17Collectrin precursorIPI00010191AYAWDTNEEYLFK0.3 (delta mass [ppm])2 
A6464ESDS-formylglutathione hydrolaseIPI00411706AYDATHLVK0.7 (delta mass [ppm])3 
A5099PFN2Profilin-2IPI00107555AYELALYLR0.8 (delta mass [ppm])2 
A5099PFN2Profilin-2IPI00107555AYELALYLR3.2 (delta mass [ppm])2 
A5662ACE2, UNQ868/PRO1885, UNQ868Angiotensin-converting enzyme 2 precursorIPI00465187AYEWNDNEMYLFR2.8 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR0.8 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR0.9 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR0.6 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR1 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR2.3 (delta mass [ppm])2 
A4994MXRA8, UNQ662Matrix-remodeling-associated protein 8 precursorIPI00153049AYGPLFLR0.2 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563AYGTGFVGCLR0.2 (delta mass [ppm])2 
A3494AGRN, AGRINAgrinIPI00374563AYGTGFVGCLR2.5 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AYINKVEELK1.6 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AYINKVEELK1.7 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AYINKVEELK0.2 (delta mass [ppm])2 
A790BDBIAcyl-CoA-binding proteinIPI00010182AYINKVEELKK0.7 (delta mass [ppm])3 
A790BDBIAcyl-CoA-binding proteinIPI00010182AYINKVEELKK0.1 (delta mass [ppm])2 
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorIPI00024292AYIPNFESGR0.2 (delta mass [ppm])2 
A1176APOEApolipoprotein E precursorIPI00021842AYKSELEEQLTPVAEETR0.5 (delta mass [ppm])3 
A1176APOEApolipoprotein E precursorIPI00021842AYKSELEEQLTPVAEETR0.3 (delta mass [ppm])3 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR0.1 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR2.1 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR2.6 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR0.9 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR3.5 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLR0.3 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLRK1.5 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLRK0.1 (delta mass [ppm])3 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLRK1.1 (delta mass [ppm])2 
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorIPI00166729AYLEEECPATLRK0.5 (delta mass [ppm])3 
A3804EEF2, EF2Elongation factor 2IPI00186290AYLPVNESFGFTADLR0.3 (delta mass [ppm])2 
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitIPI00005162AYLQQLR0.2 (delta mass [ppm])2 
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunitIPI00005162AYLQQLR0.2 (delta mass [ppm])2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237AYPDVAALSDGYWVVSNR0.4 (delta mass [ppm])2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237AYPDVAALSDGYWVVSNR0.5 (delta mass [ppm])2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237AYPDVAALSDGYWVVSNR0.6 (delta mass [ppm])2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237AYPDVAALSDGYWVVSNR1.3 (delta mass [ppm])2 
A7149MME, EPNNeprilysinIPI00247063AYQNYIK0.9 (delta mass [ppm])</