PADB-logoLSSR - PepMap molecular information by study

Study ID 16446289
Species human
Disease healthy
Tissue / Source hair
Compartment shaft

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AAGAAPAGGPAPSTAAAPAEEKK 2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00219038AAIGALQEASEAYLVGLFEDTNLCAIHAKR 3 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752AAIVCTFQEYAGRC 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719AAQGFVGCALSSTIQRF 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719AAQGFVGCALSSTIQRF 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541AAVAEAEQQGEAALSDARC 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655AAVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795AAVAQSEQQGEAALSDARC 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AAVLEYLTAEILELAGNAARD 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AAVLEYLTAEILELAGNAARD 3 
A493AH2AFX, H2AXHistone H2A.xIPI00219037AAVLEYLTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037AAVLEYLTAEILELAGNAARD 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AAVLEYLTAEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AAVLEYLTAEILELAGNAARD 3 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AAVLEYLTAEILELAGNAARDNKK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AAVLEYLTAEILELAGNAARDNKK 2 
A9948IL1F10, FIL1T, IL1HY2Interleukin 1 family member 10IPI00103482AAWPGWFLCGPAEPQQPVQLTKE 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorIPI00010796;IPI00414286ADAPEEEDHVLVLRK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053ADLETNAEALVQEIDFLKS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053AEAEQQGEAALNDAKC 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541AEAEQQGEAALSDARC 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037AEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AEILELAGNAARD 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691AFLDSYFSEKA 1 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925;IPI00477309AFNMKSAVEDEGLKG 2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527AGAAPAGGPAPSTAAAPAEEKK 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865AGLNVLRIINEPTAAAIAYGLDKKV 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006AHTPGVAADLSHIETKA 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006AHTPGVAADLSHIETKA 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053AIAEAEQQGEAALNDAKC 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079AIDAEGASAPLMELLHSRN 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752AIVCTFQEYAGRC 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890ALNFSVFHYEIANSPEEAISLAKT 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079ANHAPLQEAAVIPRL 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269APDEHPILLTEAPLNPKI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006APEEHPTLLTEAPLNPKA 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440APEEHPVLLTEAPLNPKA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079APLQEAAVIPRL 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649APPVDLNRV 1 
A3807RPLP060S acidic ribosomal protein P0IPI00008530APVAAATTAAPAAAAAPAKV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655AQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795AQSEQQGEAALSDARC 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596AREQEIRMGQM*AMGGAMGINNRG 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541ASELNHVQEVLEGYKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ASELNHVQEVLEGYKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ASELNHVQEVLEGYKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541ASELNHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ASELNHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ASELNHVQEVLEGYKKK 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845ASFFSSSCLPVSCRP 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465ASGPPVSELITKA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540ASHSQVLTMTPDYQSHFRT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540ASHSQVLTMTPDYQSHFRT 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691ASIEENSDANTLVVKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053ASRCGGTLPGFGYRL 2 
A0454DSPDesmoplakinIPI00013933ASYTSGLETLLNIPIKRT 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ATAENEFVALKKD 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ATAENEFVALKKD 2 
A0454DSPDesmoplakinIPI00013933ATGFIVDPVSNLRL 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540ATSSEQLQNYQSDIIDLRR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541AVAEAEQQGEAALSDARC 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AVANDEELNQLLKG 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655AVAQSEQQGEAALSDARC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655AVAQSEQQGEAALSDARC 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795AVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795AVAQSEQQGEAALSDARC 3 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AVLEYLTAEILELAGNAARD 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AVLEYLTAEILELAGNAARD 3 
A493AH2AFX, H2AXHistone H2A.xIPI00219037AVLEYLTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037AVLEYLTAEILELAGNAARD 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AVLEYLTAEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AVLEYLTAEILELAGNAARD 3 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274AVLEYLTAEILELAGNAARDNKK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096AVLEYLTAEILELAGNAARDNKK 2 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165AVLEYLTAKILELAGNAARD 2 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165AVLEYLTAKILELAGNAARD 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274AVRINGDGQEVLYLAEGDNVRL 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274AVRINGDGQEVLYLAEGDNVRL 3 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529AVSAAPGSAAPAAGSAPAAAEEKK 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528AYYIQHTCFQDESAKQ 2 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323CAAPSCQSSLCVPVSCRP 2 
A4895KRTAP10-6, KRTAP18.6, KAP10.6Keratin-associated protein 10-6IPI00394670CAPAPCLSLVCTPVSRV 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CAPAPCLSLVCTPVSRV 2 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673CAPAPCLTLVCTPVSRV 2 
A4898KRTAP18.9s, KRTAP18.9, KRTAP10-9Keratin-associated protein 10-9IPI00429312CAPAPCLTLVCTPVSRV 2 
A4895KRTAP10-6, KRTAP18.6, KAP10.6Keratin-associated protein 10-6IPI00394670CCAPAPCLSLVCTPVSRV 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CCAPAPCLSLVCTPVSRV 2 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673CCAPAPCLTLVCTPVSRV 2 
A4898KRTAP18.9s, KRTAP18.9, KRTAP10-9Keratin-associated protein 10-9IPI00429312CCAPAPCLTLVCTPVSRV 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711CCEPTACQPTCYRR 2 
A4899KRTAP10-10, KAP10.10, KAP18-10Keratin associated protein KAP10-10IPI00375325CCRPSSSVSLLCHPVCKS 3 
A4892KRTAP10-3, KAP10.3, KAP18-3Keratin-associated protein 10-3IPI00394678CCRPSSSVSLLCRP 2 
A4893KRTAP10-4, KAP10.4, KAP18-4 IPI00394669;IPI00477713;IPI00477291CCRPSSSVSLLCRP 2 
A4894KRTAP10-5, KAP10.5, KAP18-5Keratin-associated protein 10-5IPI00394675CCRPSSSVSLLCRP 2 
A4896KRTAP10-7, KAP10.7, KAP18-7Keratin-associated protein 10-7IPI00394671CCRPSSSVSLLCRP 2 
A4898KRTAP18.9s, KRTAP18.9, KRTAP10-9Keratin-associated protein 10-9IPI00429312CCRPSSSVSLLCRP 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CCRPSSSVSLLCRP 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795CECCQSNLEPLFAGYIETLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795CECCQSNLEPLFAGYIETLRR 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655CGDLCASTTAPVVSTRV 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845CGEPTSCQPVHCETGNLETSCGSSTAYYVPRP 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CGVSM*PVLSTGVLRS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CGVSMPVLSTGVLRS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CITPVTINESLLVPLALEIDPTVQRV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CITPVTINESLLVPLALEIDPTVQRV 3 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719CIYRNTGTEAPDYLATVDVDPKS 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719CIYRNTGTEAPDYLATVDVDPKS 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CKLAGLEEALQKA 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845CLAYRPQSLHVVSSSLRP 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CLGSRSLCNVGFGRP 2 
A4893KRTAP10-4, KAP10.4, KAP18-4 IPI00394669;IPI00477713;IPI00477291CLSLVCTPVSRV 2 
A4895KRTAP10-6, KRTAP18.6, KAP10.6Keratin-associated protein 10-6IPI00394670CLSLVCTPVSRV 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CLSLVCTPVSRV 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CLSLVCTPVSRVSSPCCRV 2 
A4896KRTAP10-7, KAP10.7, KAP18-7Keratin-associated protein 10-7IPI00394671CLSLVCTPVSYVSSPCCRV 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625CLSVELDTAPTLDLNRV 2 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673CLTLVCTPVSRV 2 
A4898KRTAP18.9s, KRTAP18.9, KRTAP10-9Keratin-associated protein 10-9IPI00429312CLTLVCTPVSRV 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649CM*ITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540CM*ITNVEAQLAEIRA 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649CMITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540CMITNVEAQLAEIRA 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674CPASCVSLLCRP 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674CPASCVSLLCRPASSRLACYSLCSGKK 3 
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitorIPI00465081CRDLCGIVASKASLRELALGSNKL 2 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673CRPSSSVSLLCRP 2 
A4891KRTAP18.2s, KRTAP10-2, KAP10.2Keratin associated protein 10-2IPI00397659CRPSSSVSLLCRP 2 
A4892KRTAP10-3, KAP10.3, KAP18-3Keratin-associated protein 10-3IPI00394678CRPSSSVSLLCRP 2 
A4896KRTAP10-7, KAP10.7, KAP18-7Keratin-associated protein 10-7IPI00394671CRPSSSVSLLCRP 2 
A4897KRTAP10-8, KAP10.8, KAP18-8Keratin-associated protein 10-8IPI00394677CRPSSSVSLLCRP 2 
A4898KRTAP18.9s, KRTAP18.9, KRTAP10-9Keratin-associated protein 10-9IPI00429312CRPSSSVSLLCRP 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683CRPSSSVSLLCRP 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CSLQAALEGYKK 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CSLQAALEGYKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053CSLQAALEGYKKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540CSTPSCTTCVPSPCVTRT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540CSTPSCTTCVPSPCVTRTVCVPRT 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274CTAAAACEAGPSPVYVKV 2 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681CTRIVCVAPSCQPSVCVPVSCRP 2 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673CTSSPCQQACCVPVRC 2 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681CVAPSCQPSVCVPVSCRP 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691CVVDEPPGIADM*WDVRS 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691CVVDEPPGIADMWDVRS 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649DALESTLAETEARY 2 
A3804EEF2, EF2Elongation factor 2IPI00186290DGLAEDIDKGEVSARQ 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274DGQEVLYLAEGDNVRL 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984DGQVNYEEFVRV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655DLCASTTAPVVSTRV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655DLEANVEALIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795DLEANVEALIQEIDFLRR 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053DLETNAEALVQEIDFLKS 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541DLNMDCIIAEIKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655DLNMDCIIAEIKA 2 
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseIPI00011200DPAMLPTMIGLLAEAGVRL 2 
A0089CTNNA1Alpha-1 cateninIPI00215948DPAQPM*DENEFIDASRL 2 
A0089CTNNA1Alpha-1 cateninIPI00215948DPAQPMDENEFIDASRL 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229DPDAQPGGELMLGGTDSKY 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928DPDEPVHGAPFYFSLPNTSPEISRL 3 
A1941PLEC1, PLECPlectinIPI00186711DPEDVDVPQPDEKS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274DPEDYGPNGLDIEWM*QVNSDPAHHRE 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274DPEDYGPNGLDIEWMQVNSDPAHHRE 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383DPELWGSVLLESNPYRR 2 
A0454DSPDesmoplakinIPI00013933DPETGNIISLFQAM*NKE 2 
A0454DSPDesmoplakinIPI00013933DPETGNIISLFQAMNKE 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031DPIKDTSSGLVGPLLVCKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541DPNAQCVKQEEKEQIKS 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541DPNAQCVKQEEKEQIKS 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655DPNAQCVKQEEKEQIKS 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655DPNAQCVKQEEKEQIKS 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795DPNAQCVKQEEKEQIKS 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795DPNAQCVKQEEKEQIKS 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476DPNIVGSEHYDVARG 2 
A0454DSPDesmoplakinIPI00013933DPNTEENLTYLQLKE 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031DPPCLTYLYFSAVDPIKDTSSGLVGPLLVCKK 3 
A3807RPLP060S acidic ribosomal protein P0IPI00008530DPSAFVAAAPVAAATTAAPAAAAAPAKV 2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512DPTQVSSSLSPEGTLTVEAPM*PKL 2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512DPTQVSSSLSPEGTLTVEAPMPKL 2 
A0454DSPDesmoplakinIPI00013933DPVNSVFLPKD 2 
A3816RPS340S ribosomal protein S3IPI00011253DPVNYYVDTAVRH 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759DSLENTLTESEARY 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632DSLENTLTESEARY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540DSLENTLTESEARY 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715DTAPTVDLNQVLNETRS 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301DVAPNFEANTTVGRI 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655EALIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795EALIQEIDFLRR 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649EAQVESLKEELLCLKK 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330EAQVQSLKEELLCLKN 2 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165EAVLEYLTAKILELAGNAARD 2 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165EAVLEYLTAKILELAGNAARD 3 
A7154NEU2Sialidase 2IPI00022482EEIVFLMFTLKQ 1 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840EGELPESGGPAAPPDAELSPRW 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541ELNHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ELNHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ELNHVQEVLEGYKKK 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052ENEFVALKKD 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655ENEFVALKKD 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ENEFVALKKD 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053ENEFVALKKD 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053EPIFEGYISALRR 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655EPLFEGYIETLRR 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541EPLFSGYIETLRR 1 
A0280YWHAE14-3-3 protein epsilonIPI00000816ERYDEMVESMKK 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715ESEAHYSSQLSQVQSLITNVESQLAEIRC 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053ESELCSLQAALEGYKKK 2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00165579;IPI00386314;IPI00177728ESGSEGLDELIFARK 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715ESQVESLREELICLKK 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715ESQVESLREELICLKKN 2 
A0454DSPDesmoplakinIPI00013933ESSPIAAIFDTENLEKI 2 
A4445CLIC3Chloride intracellular channel protein 3IPI00000692ETLGPPDFPSLAPRY 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476FAHLDATTVLSRA 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorIPI00440493;IPI00471928FAQFGSDLDAATQQLLSRG 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890FDEAMADLHTLSEDSYKD 2 
A370CRTN3, ASYIP, NSPL2Reticulon protein 3IPI00028946;IPI00412154;IPI00398795FGAEPSAPGGGGSPGACPALGTKS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274FHSSINQGLNNGDLVLKD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890FHYEIANSPEEAISLAKT 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890FHYEIANSPEEAISLAKT 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475FIGNSTAIQELFKR 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871FISPGAFNGLTELRE 2 
A1308BLMHBleomycin hydrolaseIPI00219575FLLM*NPANDGGQWDM*LVNIVEKY 2 
A1308BLMHBleomycin hydrolaseIPI00219575FLLM*NPANDGGQWDMLVNIVEKY 2 
A7478PREP, PEPProlyl endopeptidaseIPI00008164;IPI00246525FLSPGIIYHCDLTKE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053FLYEPCGVSMPVLSTGVLRS 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752FMSVLDTNKDCEVDFVEYVRS 3 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585FPDQFIHLGGDEVEFKC 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524FPLIQAMHPTLAGKI 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524FSAFGNILSCKV 1 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524FSAFGNILSCKV 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031FSAVDPIKDTSSGLVGPLLVCKK 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719FSNWLHGDLRQ 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845FSTCRPSCSGL 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890FSVFHYEIANSPEEAISLAKT 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890FSVFHYEIANSPEEAISLAKT 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691FTFCVVDEPPGIADMWDVRS 2 
A5436PMEL, D12S53E, PMEL17Melanocyte protein Pmel 17 precursorIPI00031630FTITDQVPFSVSVSQLRA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079FYAITTLHNLLLYQEGAKM 2 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527GAAPAGGPAPSTAAAPAEEKK 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475GAELVDSVLDVVRK 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752GAELVDSVLDVVRK 2 
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein UIPI00025054;IPI00479217;IPI00386491GAGDENGHGEQQPQPPATQQQQPQQQRG 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053GAIAEAEQQGEAALNDAKC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655GDLCASTTAPVVSTRV 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GGISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRT 3 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GGISTVCQPVGGVSTVCQPACGVSRT 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00478002GGTGIVSAPVPKK 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GGVSTVCQPACGVSRT 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037GGVTIAQGGVLPNIQAVLLPKK 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655GGVVCGDLCASTTAPVVSTRV 2 
A495AH2AFZ, H2AZHistone H2A.zIPI00249267GHLQLAIRG 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274GHMTYGNDVVLKC 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRT 3 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GISTVCQPVGGVSTVCQPACGVSRT 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845GNLETSCGSSTAYYVPRP 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692GSEKETMQFLNDRL 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759GSEKETMQFLNDRL 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423GSEKETMQFLNDRL 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715GSEKETMQFLNDRL 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541GSVNVCVSSSRG 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655GSVNVCVSSSRG 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711GVSTVCQPACGVSRT 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037GVTIAQGGVLPNIQAVLLPKK 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037GVTIAQGGVLPNIQAVLLPKK 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655GVVCGDLCASTTAPVVSTRV 2 
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAIPI00398958HAIVAIENPADVSVISSRN 2 
A3826KRT25C, KRT27Keratin, type I cytoskeletal 27IPI00328103HALEEANADLEQKI 2 
A3827KRT25, KRT25AKeratin, type I cytoskeletal 25IPI00375911HALEEANADLEQKI 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00478908HIHFPLATYAPVISAEKA 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00478908HIHFPLATYAPVISAEKA 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541HISDTSVIVKM 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079HLINYQDDAELATRA 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00478908HLISQIVSSITASLRF 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HLLGYPTQNVSRSLRR 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928HPSTGVITTVSHYLDRE 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HRENVFLSYQDKR 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HRENVFLSYQDKRI 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HSELSYQESFHSSINQGLNNGDLVLKD 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HSELSYQESFHSSINQGLNNGDLVLKD 3 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675HSFGGGTGSGFTSLLMERL 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144HSFGGGTGSGFTSLLMERL 2 
A370CRTN3, ASYIP, NSPL2Reticulon protein 3IPI00028946;IPI00412154;IPI00398795HSISSSSFGAEPSAPGGGGSPGACPALGTKS 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540HSLRDSLENTLTESEARY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540HSLRDSLENTLTESEARY 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540HSQVLTMTPDYQSHFRT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540HSQVLTMTPDYQSHFRT 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274HSSINQGLNNGDLVLKD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890HTLSEDSYKDSTLIMQLLRD 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871HTNALQDLDGNVFRM 2 
A4929KRTAP4-9, KAP4.9, KRTAP4.9Keratin associated protein 4-9IPI00105153HTTCYRPTCVISSCPRP 2 
A4925KRTAP4-5, KAP4.5, KRTAP4.5Keratin-associated protein 4-5IPI00307621HTTCYRPTCVISTCPRP 2 
A4926KRTAP4-6, KAP4.15, KRTAP4-15Keratin-associated protein 4-6IPI00001077HTTCYRPTCVISTCPRP 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625HVESLKEDLLCLKK 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890HYEIANSPEEAISLAKT 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715HYSSQLSQVQSLITNVESQLAEIRC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053IAEAEQQGEAALNDAKC 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234IAGEASRLAHYNKR 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785IAGEASRLAHYNKR 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398IATPSDIDNDFVNDIIARA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053IFEGYISALRR 2 
A0454DSPDesmoplakinIPI00013933IHSQTSQQYPLYDLDLGKF 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274ILELAGNAARDNKK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096ILELAGNAARDNKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795ILQSHISDTSVVVKL 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234IM*NSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785IM*NSFVNDIFERI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234IMNSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785IMNSFVNDIFERI 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053INESLLVPLALEIDPTVQRV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053INESLLVPLALEIDPTVQRVKR 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912IPNRPPDAVLTDTTSLNQAALYRL 2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525ISALEYGVPVTLIGEAVFARC 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691ISGVGIDRPPYGVFTINPRT 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711ISTVCQPVGGVSTVCQPACGVSRT 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711ISTVCQPVGGVSTVCQPACGVSRT 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018ISWYDNEFGYSNRV 2 
A0454DSPDesmoplakinIPI00013933ITVKINELKSVQNDSQAIAEVLNQLKD 3 
A0089CTNNA1Alpha-1 cateninIPI00215948KAAAGEFADDPCSSVKR 2 
A329DMST133, EFHD1, PP1187Swiprosin 2IPI00031091KAAAGELQEDSGLM*ALAKL 2 
A329DMST133, EFHD1, PP1187Swiprosin 2IPI00031091KAAAGELQEDSGLMALAKL 2 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KAAAPGPCPPPPPPP 2 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KAAAPGPCPPPPPPPR 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAAFDDAIAELDTLSEESYKD 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAAFDDAIAELDTLSEESYKD 3 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAAFDDAIAELDTLSEESYKDSTLIM*QLLRD 3 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAAFDDAIAELDTLSEESYKDSTLIMQLLRD 3 
A9579RPLP1, RRP160S acidic ribosomal protein P1IPI00008527KAAGVNVEPFWPGLFAKA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KAAM*IVNQLSKK 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KAAMIVNQLSKK 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAASDIAM*TELPPTHPIRL 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAASDIAMTELPPTHPIRL 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KAASDIAMTELPPTHPIRL 3 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918KAAYLQETGKPLDETLKK 2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918KAAYLQETGKPLDETLKKA 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KACANPAAGSVILLENLRF 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KACLENLGLKH 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KADIDVSGPSVDTDAPDLDIEGPEGKL 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KADKVYSILPHGVIYDKA 2 
A3839KRT38, HHA8, HKA8Keratin, type I cuticular HA8IPI00297641KADLEAQQESLKEEQLSLKS 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKE 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKE 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELM*CLKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELM*CLKK 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELM*CLKKN 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELM*CLKKN 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELM*CLKKN 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELM*CLKKN 3 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELMC 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELMC 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELMCLKK 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELMCLKK 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELMCLKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELMCLKK 3 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KADLEAQVESLKEELMCLKKN 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KADLEAQVESLKEELMCLKKN 3 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KADLEAQVQSLKE 1 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KADLEAQVQSLKE 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KADLEAQVQSLKEELL 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KADLEAQVQSLKEELLCLKN 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KADLEAQVQSLKEELLCLKN 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KADLETNAEALVQE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KADLETNAEALVQEIDFLKS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KADLETNAEALVQEIDFLKS 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775KADLINNLGTIAKS 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14IPI00026271KADRDESSPYAAMLAAQDVAQRC 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAEAEAWYQCRY 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAEAEAWYQCRY 2 
A7976ACAA1, ACAA, PTHIO3-ketoacyl-CoA thiolase, peroxisomal precursorIPI00012828KAEELGLPILGVLRS 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KAEGPEVDVNLPKA 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00383932KAEGPEVDVNLPKA 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KAEVQNLGGELVVSGVDSAM*SLIQAAKN 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530KAFLADPSAFVAAAPVAAATTAAPAAAAAPAKV 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KAFLHWYTGEGM*DEF 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KAFLHWYTGEGM*DEM 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KAFLHWYTGEGM*DEM*EFT 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KAFLHWYTGEGM*DEM*EFT 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KAFLHWYTGEGMDEM*EFT 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KAFLHWYTGEGMDEM*EFT 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KAFM*TADLPNELIELLEKI 2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536KAFSAVDTDGNGTINAQELGAALKA 2 
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorIPI00014230KAFVDFLSDEIKEERK 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KAGAGSATLSM*AYAGARF 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KAGAGSATLSMAYAGARF 2 
A1941PLEC1, PLECPlectinIPI00186711KAGVVGPELHEQLLSAEKA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KAHGGYSVFAGVGERT 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KAIGAVPLIQGEYM*IPCEKV 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KAIGAVPLIQGEYMIPCEKV 2 
A0098VCLVinculinIPI00291175KAIPDLTAPVAAVQAAVSNLVRV 2 
A0454DSPDesmoplakinIPI00013933KAITGFDDPFSGKT 1 
A0454DSPDesmoplakinIPI00013933KAITGFDDPFSGKT 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KAKQDM*ACLLKE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAKQDM*ACLLKE 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KAKQDMACLIRE 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KAKQDMACLIRE 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KAKQDMACLLKE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAKQDMACLLKE 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KALAAAGYDVEKN 1 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KALAAAGYDVEKN 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KALAAAGYDVEKNN 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KALAAAGYDVEKNNS 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KALAAAGYDVEKNNSRI 2 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468KALAAGGYDVEKN 2 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468KALAAGGYDVEKNNSRI 2 
A5799METAP2, MNPEP, P67EIF2Methionine aminopeptidase 2IPI00033036;IPI00300763KALDQASEEIWNDFRE 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KALESPERPFLAILGGAKV 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875KALIAAQYSGAQVRV 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KALKPEVDKLNIM*AAKR 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KALKPEVDKLNIMAAKR 2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243;IPI00478097KALLNVVDNARS 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KALPGQLKPFETLLSQNQGGKT 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KALPGQLKPFETLLSQNQGGKT 3 
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1IPI00305978KALQAAYGASAPSVTSAALRW 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KALYDTFSAFGNILSCKV 2 
A9948IL1F10, FIL1T, IL1HY2Interleukin 1 family member 10IPI00103482KALYTRDGQLLVGDPVADNCCAEKI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KAM*GIM*NSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KAM*GIM*NSFVNDIFERI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KAM*GIMNSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KAM*GIMNSFVNDIFERI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KAMGIM*NSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KAMGIM*NSFVNDIFERI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KAMGIMNSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KAMGIMNSFVNDIFERI 2 
A0454DSPDesmoplakinIPI00013933KANSSATETINKL 2 
A0326VIL2, EZREzrinIPI00419707;IPI00479359KAPDFVFYAPRL 2 
A3808RPL4, RPL160S ribosomal protein L4IPI00003918;IPI00471915KAPIRPDIVNFVHTNLRK 3 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorIPI00024993KAQFAQPEILIGTIPGAGGTQRL 2 
A0454DSPDesmoplakinIPI00013933KAQQIHSQTSQQYPLYDLDLGKF 2 
A0454DSPDesmoplakinIPI00013933KAQQIHSQTSQQYPLYDLDLGKF 3 
A0454DSPDesmoplakinIPI00013933KAQQIHSQTSQQYPLYDLDLGKFGEKV 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAQRCKLEGAIAEAEQQGEAALNDAKC 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAQYDDIASRS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAQYDDIASRSKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KAQYDDIASRSKAEAEAWYQCRY 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KAQYDDIVTRS 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KAQYDDIVTRS 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KARLEGEIATYRH 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KARLEGEINTYWG 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KARPFPDGLAEDIDKGEVSARQ 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KARPFPDGLAEDIDKGEVSARQ 3 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KASCLYGQLPKF 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KASDAAPNLDGFVKPGAHV 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KASGPPVSELITKA 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KASNTAEVFFDGVRVPSENVLGEVGSGFKV 3 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461KASPYPVILSLENHCTLEQQRV 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486KATAFFPDLVNM*LVLGKH 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486KATAFFPDLVNMLVLGKH 2 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269KATAGDTHLGGEDFDNRL 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KATGLFMSTNGNLEDLKL 2 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468KATGPPVSELITKA 2 
A495AH2AFZ, H2AZHistone H2A.zIPI00249267KATIAGGGVIPHIHKS 2 
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseIPI00010415;IPI00395748;IPI00219452KATLWYVPLSLKN 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KATQALVLAPTRE 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialIPI00305383KAVAFQNPQTHVIENLHAAAYRN 3 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KAVANYDSVEEGEKV 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KAVANYDSVEEGEKVVKT 2 
A4891KRTAP18.2s, KRTAP10-2, KAP10.2Keratin associated protein 10-2IPI00397659KAVCCVPTCSESSSSC 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KAVDVFFPPEAQNDFPVAM*QISEKH 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KAVEEKIEWLESHQDADIEDFKA 3 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KAVQYLSSQDEKY 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KAVQYLSSQDEKYQAIGAYY 2 
A0907YWHAQ14-3-3 protein tauIPI00018146KAVTEQGAELSNEERN 2 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221KAVVGDAQYHHFRH 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KAYAYADEDEGRPAND 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KAYAYADEDEGRPANDC 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KAYLPVNESFGFTADLRS 2 
A1941PLEC1, PLECPlectinIPI00186711KAYSDPSTGEPATYGELQQRC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KCLNNRFASFINKV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KCQNSKLEAAVAQSEQQGEAALSDARC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KCQNSKLEAAVAQSEQQGEAALSDARC 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KCQNSKLEAAVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KCQNSKLEAAVAQSEQQGEAALSDARC 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274KCYASGGSQPLSYKW 2 
A0430LMNB1, LMN2, LMNBLamin B1IPI00217975KDAALATALGDKKS 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KDAGTIAGLNVLRI 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KDAGTIAGLNVM*RI 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KDAGTIAGLNVMRI 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KDAGTITGLNVLRI 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KDATLEACAGALQNLTASKG 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00013769KDATNVGDEGGFAPNILENKE 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KDATNVGDEGGFAPNILENKE 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KDCEVDFVEYVRS 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KDELNADHPFIYIIRH 2 
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorIPI00419262KDFMIQGGDFTRG 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KDGLIPLEIRF 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KDGNASGTTLLEALDCILPPTRPTDKP 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984KDGNGFVSAAELRH 2 
A371ETAGLN2, CDABP0035Transgelin 2IPI00024057KDGTVLCELINALYPEGQAPVKK 2 
A3812RPL860S ribosomal protein L8IPI00012772KDIIHDPGRGAPLAKV 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KDIISDTSGDFRKL 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301KDINAYNCEEPTEKL 2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918KDITSDTSGDFRN 2 
A6804PPA1, IOPPP, PPInorganic pyrophosphataseIPI00015018KDKDFAIDIIKS 2 
A0370LDHA, PIG19L-lactate dehydrogenase A chainIPI00217966KDLADELALVDVIEDKL 2 
A0370LDHA, PIG19L-lactate dehydrogenase A chainIPI00217966KDLADELALVDVIEDKLKG 2 
A8502SERPINB5, PI5Maspin precursorIPI00418219KDLTDGHFENILADNSVNDQTKI 2 
A8502SERPINB5, PI5Maspin precursorIPI00418219KDLTDGHFENILADNSVNDQTKI 3 
A8502SERPINB5, PI5Maspin precursorIPI00472082KDLTDGHFENILADNSVNDQTKI 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KDLTDGHFENILADNSVNDQTKI 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KDLYANTVLSGGTTM*YPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KDLYANTVLSGGTTMYPGIADRM 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KDNHLLGTFDLTGIPPAPRG 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875KDPFAHLPKS 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KDQIYDIFQKL 1 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KDQQEAALVDM*VNDGVEDLRC 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KDQQEAALVDMVNDGVEDLRC 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KDQVANSAFVERL 2 
A0846NME1, NDPKA, NM23Nucleoside diphosphate kinase AIPI00012048;IPI00375531KDRPFFAGLVKY 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KDSATM*SLDPEEEAEHPIKI 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KDSATMSLDPEEEAEHPIKI 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KDSATMSLDPEEEAEHPIKI 3 
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1IPI00009342KDSLHEKFPDAGEDELLKI 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KDSTLIM*QLLRD 2 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KDSTLIM*QLLRD 2 
A0362YWHAG14-3-3 protein gammaIPI00220642KDSTLIM*QLLRD 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KDSTLIM*QLLRD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KDSTLIM*QLLRD 2 
A0907YWHAQ14-3-3 protein tauIPI00018146KDSTLIM*QLLRD 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KDSTLIMQLLRD 1 
A0280YWHAE14-3-3 protein epsilonIPI00000816KDSTLIMQLLRD 2 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KDSTLIMQLLRD 1 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KDSTLIMQLLRD 2 
A0362YWHAG14-3-3 protein gammaIPI00220642KDSTLIMQLLRD 1 
A0362YWHAG14-3-3 protein gammaIPI00220642KDSTLIMQLLRD 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KDSTLIMQLLRD 1 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KDSTLIMQLLRD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KDSTLIMQLLRD 1 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KDSTLIMQLLRD 2 
A0907YWHAQ14-3-3 protein tauIPI00018146KDSTLIMQLLRD 1 
A0907YWHAQ14-3-3 protein tauIPI00018146KDSTLIMQLLRD 2 
A9638RPS2040S ribosomal protein S20IPI00012493KDTGKTPVEPEVAIHRI 3 
A7976ACAA1, ACAA, PTHIO3-ketoacyl-CoA thiolase, peroxisomal precursorIPI00012828KDTTPDELLSAVMTAVLKD 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KDTYSGLM*GPLITCRK 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KDTYSGLMGPLITCRK 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KDVDAAYANKVELQAKV 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KDVDCAYLRK 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KDVDCAYLRK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KDVDCAYLRK 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KDVDCAYLRK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KDVDCAYLRK 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KDVDCAYLRK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KDVDTAFLM*KA 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KDVDTAFLM*KA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KDVDTAFLM*KADLETNAEALVQEIDFLKS 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KDVDTAFLMKA 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KDVDTAFLMKA 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KDVEDESTGLEKI 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KDVEDESTGLEKIEKQ 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750KDVNAAIAAIKT 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675KDVNAAIATIKT 2 
A8502SERPINB5, PI5Maspin precursorIPI00418219KDVPFGFQTVTSDVNKL 2 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KDVYVVTDQIPVFVTM 2 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KDVYVVTDQIPVFVTM*FQKN 2 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KDVYVVTDQIPVFVTM*FQKN 3 
A474BGPNMB, HGFIN, NMBTransmembrane glycoprotein NMB precursorIPI00001592;IPI00470529KDVYVVTDQIPVFVTMFQKN 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KEAADAIDAEGASAPLMELLHSRN 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KEAADAIDAEGASAPLMELLHSRN 3 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292KEAAEAIEAEGATAPLTELLHSRN 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KEAAENSLVAYKA 2 
A0280YWHAE14-3-3 protein epsilonIPI00086909KEAAKNSIVAYKA 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984KEAFSLFDKDGDGCITTRE 2 
A0008CALM1, CALM2, CALM3CalmodulinIPI00075248;IPI00478156;IPI00411575KEAFSLFDKDGDGTITTKE 2 
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7IPI00030179KEANNFLWPFKL 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772KEAVLDVIPTDIHQRA 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KEELIADALPVLADRV 2 
A315CRAB1B, rab1bRas-related protein Rab-1BIPI00008964KEFADSLGIPFLETSAKN 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KEFSPFGTITSAKV 2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350;IPI00375400KEGGLGPLNIPLLADVTRR 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KEGIPALDNFLDKL 2 
A0454DSPDesmoplakinIPI00013933KEHLM*LEEELRN 2 
A0454DSPDesmoplakinIPI00013933KEHLMLEEELRN 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KEHLSQATGILTERI 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KEIAEAYLGGKV 1 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675KEIIDLVLDRI 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144KEIIDLVLDRI 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269KEIITLAPSTM*KI 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269KEIITLAPSTMKI 1 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformIPI00007682KEILQEEEDLAEIVQLVGKA 2 
A5073PPLPeriplakinIPI00298057KEIQALKDTKPQVQTKE 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KEISEVFPDQFIHLGGDEVEFKC 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KEITALAPSTM*KI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KEITALAPSTM*KI 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KEITALAPSTMKI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KEITALAPSTMKI 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KEKEDDVPQFTSAGENFDKL 2 
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein UIPI00025054;IPI00479217;IPI00386491KEKPYFPIPEEYTFIQNVPLEDRV 3 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KELATWTPTEFR 1 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KELATWTPTEFRE 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KELATWTPTEFREC 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KELATWTPTEFRECDYNKF 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KELEEIVQPIISKL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514KELEEIVQPIISKL 2 
A8502SERPINB5, PI5Maspin precursorIPI00418219KELETVDFKDKLEET 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KELETVDFKDKLEET 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KELGAFGLQVPSELGGVGLCNTQYARL 2 
A3939STX12Syntaxin 12IPI00329332KELGSLPLPLSTSEQRQ 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KELPVLCPDYLSYYTTIEELQQKI 2 
A5073PPLPeriplakinIPI00298057KELSELIEQLQKN 2 
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitorIPI00465081KELSLAGNELGDEGARL 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871KELSLGIFGPM*PNLRE 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871KELSLGIFGPMPNLRE 2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicIPI00291005KELTEEKESAFEFLSSA 2 
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitorIPI00465081KELTVSNNDINEAGVRV 2 
A0454DSPDesmoplakinIPI00013933KENAAYFQFFEEAQSTEAYLKG 2 
A6588GGCT, CRF21Gamma-glutamylcyclotransferaseIPI00031564KENGLPLEYQEKL 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KEPLGPALAHELRY 1 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KEPLGPALAHELRY 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KEQLYFFGKN 1 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468KERNGLSLAALKK 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KESESCDCLQGFQLTHSLGGGTGSGM*GTLLISKI 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKI 3 
A0454DSPDesmoplakinIPI00013933KESHRLPVDIAYKR 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KESQFLKEELVAAVEDVRKQ 3 
A1256UBBPolyubiquitin-BIPI00387164KESTLHLVLRL 2 
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorIPI00397808KESTLHLVLRL 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KEVDEQM*LNVQNKN 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KEVDEQM*LNVQNKN 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorIPI00031522KEVEAVIPDHCIFASNTSALPISEIAAVSKR 3 
A972BFABP4Fatty acid-binding protein 4, adipocyteIPI00215746KEVGVGFATRK 2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997KEVQEFYKDTYNKL 2 
A9834CHAC1, BOTCHCation transport regulator-like protein 1IPI00012214KEVTFYPQDAPDQPLKA 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KEYQEVMNSKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KEYQEVMNSKL 2 
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAIPI00398958KFAAATGATPIAGRF 2 
A9542RPL15, EC4560S ribosomal protein L15IPI00375511;IPI00479757KFARSLQSVAEERA 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KFASFIDKVRF 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KFASFIDKVRF 2 
A3584FASN, FASFatty acid synthaseIPI00418433KFCFTPHTEEGCLSERA 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KFDGILGM*AYPRI 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KFDGILGMAYPRI 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KFDLTGIPPAPRG 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KFEELNMDLFRS 2 
A7241OTUB1, OTB1, OTU1Ubiquitin thiolesterase protein OTUB1IPI00409750;IPI00000581KFFEHFIEGGRT 2 
A9542RPL15, EC4560S ribosomal protein L15IPI00375511;IPI00479757KFFEVILIDPFHKA 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KFFVGGNWKM 1 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KFGANAILGVSLAVCKA 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KFGLMQLDKQ 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186KFGVEQDVDM*VFASFIRK 2 
A6384DUSP14, MKP6Dual specificity protein phosphatase 14IPI00013031KFHNVCLLEAYNWVKA 2 
A7478PREP, PEPProlyl endopeptidaseIPI00008164;IPI00246525KFIATLQYIVGRS 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KFM*SVLDTNKDCEVDF 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KFM*SVLDTNKDCEVDFVEYVRS 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KFM*SVLDTNKDCEVDFVEYVRS 3 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KFMSVLDTNKDCEVDFVEYVRS 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752KFMSVLDTNKDCEVDFVEYVRS 3 
A0152RAN, ARA24, TC4GTP-binding nuclear protein RANIPI00012507KFNVWDTAGQEKF 2 
A834BARF6ADP-ribosylation factor 6IPI00215920KFNVWDVGGQDKI 1 
A834BARF6ADP-ribosylation factor 6IPI00215920KFNVWDVGGQDKI 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KFPTWSVAQHLKG 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KFQAGNGSWGYPIYNGTLKR 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KFQDGDLTLYQSNTILRH 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KFQELQLAAGRH 2 
A5073PPLPeriplakinIPI00298057KFSIEEALQSGRL 2 
A564DISOC1, CGI-111Isochorismatase domain-containing protein 1IPI00304082;IPI00477486KFSM*VLPEVEAALAEIPGVRS 2 
A564DISOC1, CGI-111Isochorismatase domain-containing protein 1IPI00304082;IPI00477486KFSMVLPEVEAALAEIPGVRS 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KFSPAGPILSIRV 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KFSSQELILRR 2 
A3816RPS340S ribosomal protein S3IPI00011253KFVDGLMIHSGDPVNYYVDTAVRH 3 
A801DPITHD1, AD039, HT014UPF0424 protein C1ORF128IPI00015351KFVESDADEELLFNIPFTGNVKL 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096KFVIHCNSPVWGADKCEELLEKT 3 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461KFVSISDLLVPKD 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KFWEVISDEHGIDP 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KFWEVISDEHGIDP 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KFWEVISDEHGIDPTGSYHGDSDLQLERI 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KFWEVISDEHGIDPTGTYHGDSDLQLERI 3 
A0326VIL2, EZREzrinIPI00419707;IPI00479359KFYPEDVAEELIQDITQKL 2 
A0326VIL2, EZREzrinIPI00419707;IPI00479359KFYPEDVAEELIQDITQKL 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KGAFLYEPCGVS 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KGAFLYEPCGVSM*PVLSTGVLRS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KGAFLYEPCGVSMPVLSTGVLRS 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KGAVEKGEELSCEERN 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KGCDVVVIPAGVPRK 2 
A3816RPS340S ribosomal protein S3IPI00011253KGCEVVVSGKL 2 
A9544RPL1860S ribosomal protein L18IPI00215719KGCGTVLLSGPRK 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KGDLENAFLNLVQCIQNKPLYFADRL 3 
A8502SERPINB5, PI5Maspin precursorIPI00418219KGDTANEIGQVLHFENVKD 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KGDTANEIGQVLHFENVKD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KGDYYRYLAEVATGDDKK 2 
A1308BLMHBleomycin hydrolaseIPI00219575KGEISATQDVMMEEIFRV 2 
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1IPI00001159;IPI00478513;IPI00027040KGEPGAAPLSAPAFSLVFPFLKM 2 
A0454DSPDesmoplakinIPI00013933KGFFDPNTEENLTYLQLKE 2 
A1941PLEC1, PLECPlectinIPI00186711KGFFDPNTEENLTYLQLM*ERC 2 
A1941PLEC1, PLECPlectinIPI00186711KGFFDPNTEENLTYLQLMERC 2 
A1941PLEC1, PLECPlectinIPI00186711KGFFDPNTHENLTYRQ 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KGFGFVCFSSPEEATKA 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KGFGFVSFERH 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KGFYTSFEDWGGKN 1 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KGFYTSFEDWGGKN 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGGFVLLDGETFEVKG 2 
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2IPI00017726KGGIVGM*TLPIARD 2 
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2IPI00017726KGGIVGMTLPIARD 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGGPVQVLEDEELKS 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGGPVQVLEDEELKSQPEPLVVKG 3 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KGGTQYDQNHIILNTVSKE 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KGHYTEGAELVDSVLDVVRK 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KGHYTEGAELVDSVLDVVRK 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KGHYTEGAELVDSVLDVVRK 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KGHYTEGAELVDSVLDVVRK 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KGHYTEGAELVDSVLDVVRKE 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KGHYTEGAELVDSVLDVVRKE 3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439KGILAADESTGSIAKR 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KGITFDSGGISIKA 1 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KGITFDSGGISIKA 2 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KGIVDQSQQAYQEAFEISKK 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KGIVNEQFLLQRL 2 
A5082PKP3Plakophilin 3IPI00026952KGLEWLWSPQIVGLYNRL 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KGLGTDEDSLIEIICSRT 2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918KGLGTDEDTLIEILASRT 2 
A0454DSPDesmoplakinIPI00013933KGLIDYETFKE 1 
A0454DSPDesmoplakinIPI00013933KGLIDYETFKE 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KGLM*SSGM*SQLIGLKE 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KGLM*SSGMSQLIGLKE 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KGLMSSGM*SQLIGLKE 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KGLMSSGMSQLIGLKE 2 
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2IPI00017726KGLVAVITGGASGLGLATAERL 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446KGNDISSGTVLSDYVGSGPPKG 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KGQLTTDQVFPYPSVLNEEQTQFLKE 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KGSDEPPVFLEIHYKG 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00396485KGSFRYAWVLDKL 1 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00396485KGSFRYAWVLDKL 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186KGSGTAEVELKKG 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KGSGWLYHSDAIRT 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KGSIVWQEVFDDKA 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KGSLAADKVVEEIRR 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KGSPNANEPPLVFVGKG 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KGSYSLSHVYTPNDVRM 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KGSYSLSHVYTPNDVRM 3 
A9931GSDMA, GSDM, GSDM1GasderminIPI00166200KGTAGLSQNSTLEVQTLSVAPKA 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGTWERPGGAAPLGYDFW 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGTWERPGGAAPLGYDFWY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGTWERPGGAAPLGYDFWYQPRH 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KGTWERPGGAAPLGYDFWYQPRH 3 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KGVDEVTIVNILTNRS 2 
A468AH1F0, H1FVHistone H1.0IPI00294304KGVGASGSFRL 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KGVLFASGQNLARQ 2 
A207DCRIP2, CRP2Cysteine-rich protein 2IPI00006034KGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARA 3 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186KGVNLPGAAVDLPAVSEKD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096KGVTIASGGVLPNIHPELLAKK 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230KGVVDSDDLPLNVSRE 2 
A0428ALDOC, ALDCFructose-bisphosphate aldolase CIPI00418262KGVVPLAGTDGETTTQGLDGLSERC 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439KGVVPLAGTNGETTTQGLDGLSERC 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KGYDVIAQAQSGTGKT 2 
A2341ACTN1Alpha-actinin 1IPI00013508KGYEEWLLNEIRR 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KGYGFVHFETQEAAERA 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KGYLGPEQLPDCLKG 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorIPI00440493;IPI00471928KHALIIYDDLSKQ 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KHAVSEGTKA 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KHAVSEGTKA 2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292KHAVVNLINYQDDAELATRA 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KHDVVFLITKY 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KHELIEFRR 2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000KHELLQPFNVLYEKE 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KHFSVEGQLEFRA 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775KHFSVEGQLEFRA 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KHIFSEDTSDFSGMSETKG 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KHIYYITGETKD 1 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775KHLEINPDHPIVETLRQ 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775KHLEINPDHPIVETLRQ 3 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KHLEINPDHSIIETLRQ 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KHLEINPDHSIIETLRQ 3 
A8502SERPINB5, PI5Maspin precursorIPI00472082KHLSM*FILLPKD 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00419585KHTGPGILSMANAGPNTNGSQFFICTAKT 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00419585KHTGPGILSMANAGPNTNGSQFFICTAKT 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00472718KHTGPGILSMANAGPNTNGSQFFICTAKT 2 
A0454DSPDesmoplakinIPI00013933KHVTSECLGWM*RQ 2 
A0454DSPDesmoplakinIPI00013933KHVTSECLGWMRQ 2 
A832BARF4, ARF2ADP-ribosylation factor 4IPI00215918KHYFQNTQGLI 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KIAEQVASFQEEKS 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorIPI00024993KICPVETLVEEAIQCAEKI 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KICSEDIECSGLTIPKA 2 
A469CSEC23BProtein transport protein Sec23BIPI00017376KIDMNLTDLLGELQRDPWPVTQGKR 3 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KIDVTAPDVSIEEPEGKL 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KIEAELQDICNDVLELLDKY 2 
A0454DSPDesmoplakinIPI00013933KIEVLEEELRL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KIEWLESHQDADIEDFKA 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KIEWLESHQDADIEDFKAKK 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KIFGVTTLDIVRA 1 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KIFGVTTLDIVRA 2 
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D0IPI00028888KIFVGGLSPDTPEEKI 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439KIGEHTPSALAIMENANVLARY 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439KIGEHTPSALAIMENANVLARY 3 
A0326VIL2, EZREzrinIPI00419707;IPI00479359KIGFPWSEIRN 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KIGGIGTVPVGRV 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KIGLFGGAGVGKT 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQA 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQAAT 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQAATGF 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQAATGFI 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQAATGFIVDP 2 
A0454DSPDesmoplakinIPI00013933KIGLVRPGTALELLEAQAATGFIVDPVSNLRL 3 
A1308BLMHBleomycin hydrolaseIPI00219575KIGPITPLEFYRE 1 
A1308BLMHBleomycin hydrolaseIPI00219575KIGPITPLEFYRE 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14IPI00026271KIGRIEDVTPIPSDSTRRK 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729KIGSGSFGDIYLGANIASGEEVAIKL 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KIIELPFQNKH 2 
A1941PLEC1, PLECPlectinIPI00186711KIIKIIITVVEEQEQ 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530KIIQLLDDYPKC 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KIISNASCTTNCLAPLAKV 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896KIIVDELKQEVISTSSKA 2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525KIKDAFDRNPELQNLLLDDFFKS 3 
A8499HUR 7, SERPINB13, PI13HurpinIPI00006560;IPI00220494KIKDLFPDGSISSSTKL 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1IPI00018755;IPI00419258KIKGEHPGLSIGDVAKK 2 
A7989TKT, TKT1TransketolaseIPI00021716KILATPPQEDAPSVDIANIRM 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KILDSVGIEADDDRLNKV 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461KILFCDVLRA 2 
A7968TGM1, KTGProtein-glutamine gamma-glutamyltransferase KIPI00305622KILNVGDIGGNETVTLRQ 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KILTERGYSFTTTAERE 2 
A9544RPL1860S ribosomal protein L18IPI00215719KILTFDQLALDSPKG 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KILVNQLSVDDVNVLT 2 
A8502SERPINB5, PI5Maspin precursorIPI00418219KILVVNAAYFVGKW 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KILVVNAAYFVGKW 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KILWDYAPQGYNKF 2 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812KIPIFSAAGLPHNEIAAQICRQ 3 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931KIPVDTYNNILTVLKL 2 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175KIPVTDEEQTNVPYIYAIGDILEDKV 2 
A639ALGALS3, MAC2, GALIGGalectin-3IPI00465431KIQVLVEPDHFKV 1 
A639ALGALS3, MAC2, GALIGGalectin-3IPI00465431KIQVLVEPDHFKV 2 
A0454DSPDesmoplakinIPI00013933KISITEGIERG 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102KISSIQSIVPALEIANAHRK 3 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KISSVQPICLDSFTGPRR 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928KISTDKETNEGVLSVVKPLNYEENRQ 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928KISTDKETNEGVLSVVKPLNYEENRQ 3 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KISYAQYEKY 2 
A0454DSPDesmoplakinIPI00013933KISYKDAINRS 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KITGM*LLEIDNSELLHM*LESPESLRS 3 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KITGM*LLEIDNSELLHMLESPESLRS 3 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KITGMLLEIDNSELLHMLESPESLRS 3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KITLPVDFVTADKFDENAKT 2 
A0454DSPDesmoplakinIPI00013933KITNLTQQLEQASIVKK 2 
A0454DSPDesmoplakinIPI00013933KITNLTQQLEQASIVKKR 2 
A0369LDHBL-lactate dehydrogenase B chainIPI00219217KIVADKDYSVTANSKI 2 
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5IPI00024664KIVILPDYLEIARDGLGGLPDIVRD 3 
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 3IPI00297982KIVLTNPVCTEVGEKI 2 
A0439PHB2, BAP, REAProhibitin 2IPI00027252KIVQAEGEAEAAKM 2 
A4043PPP1CB, PPCS1DSerine/threonine protein phosphatase PP1-beta catalytic subunitIPI00218236;IPI00479703KIVQM*TEAEVRG 2 
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 3IPI00297982KIVSLFAEHNDLQYAAPGGLIGVGTKI 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KIVSQEPSGAPM*FILNRY 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KIVSQEPSGAPMFILNRY 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KIWCFGPDGTGPNILTDITKG 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KIWHHTFYNELRV 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KIWHHTFYNELRV 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269KIWYHTFYNELRV 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461KIYKVPSTEAEALASSLM*GLFEKR 3 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465KKALAAAGYDVEKNNSRI 2 
A1308BLMHBleomycin hydrolaseIPI00219575KKCFPESYTTEATRR 2 
A7154NEU2Sialidase 2IPI00022482KKDEHAELIVLRR 2 
A7154NEU2Sialidase 2IPI00022482KKDEHAELIVLRR 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KKDVDCAYLRK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKDVDCAYLRK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KKDVDCAYLRK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKDVDTAFLM*KA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKDVDTAFLMKA 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKDVDTAFLMKA 2 
A4646CD9, BTCC-1, MIC3CD9 antigenIPI00215997KKDVLETFTVKS 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KKEELTLEGIRQ 1 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KKEELTLEGIRQ 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461KKFDLGQDVIDFTGHA 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186KKGVNLPGAAVDLPAVSEKD 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KKIELNAETVNLRS 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KKIGYNPDTVAFVPISGWNG 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KKIGYNPDTVAFVPISGWNGDNM 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KKILDSVGIEADDDRLNKV 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KKILDSVGIEADDDRLNKV 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00472718KKITIADCGQLE 1 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00472718KKITIADCGQLE 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KKKELEEIVQPIISKL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514KKKELEEIVQPIISKL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKKYEEEVSLRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKKYEEEVSLRATAENEFVALKKD 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKKYEEEVSLRATAENEFVALKKD 3 
A0454DSPDesmoplakinIPI00013933KKLEEELEGMRR 1 
A0454DSPDesmoplakinIPI00013933KKLEEELEGMRR 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KKLESFYIQKV 2 
A452BFAM26D, UNQ6481/PRO21277, UNQ6481Family with sequence similarity 26, member DIPI00065530KKLFGFIPGSEDVKH 2 
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2IPI00017726KKLGNNCVFAPADVTSEKDVQTALALAKG 3 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008;IPI00289800KKPGM*FFNPEESELDLTYGNRY 2 
A3816RPS340S ribosomal protein S3IPI00011253KKPLPDHVSIVEPKD 2 
A3816RPS340S ribosomal protein S3IPI00011253KKPLPDHVSIVEPKD 3 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KKSDIDEIVLVGGSTRI 2 
A0454DSPDesmoplakinIPI00013933KKSVEEVASEIQPFLRG 2 
A0452CANXCalnexin precursorIPI00020984KKTDAPQPDVKEEEEEKE 3 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812KKTSCEFTGDILRT 2 
A5073PPLPeriplakinIPI00298057KKVPDPVLEESFQQLQRT 3 
A314CRAB1A, RAB1Ras-related protein Rab-1AIPI00005719KKVVDYTTAKEFADSLGIPFLETSAKN 3 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175KKVVYENAYGQFIGPHRI 2 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175KKVVYENAYGQFIGPHRI 3 
A589AEIF5AEukaryotic translation initiation factor 5AIPI00376005;IPI00411704KKYEDICPSTHNM*DVPNIKR 2 
A589AEIF5AEukaryotic translation initiation factor 5AIPI00376005;IPI00411704KKYEDICPSTHNMDVPNIKR 2 
A589AEIF5AEukaryotic translation initiation factor 5AIPI00376005;IPI00411704KKYEDICPSTHNMDVPNIKR 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCVENE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCVENEFVALKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCVENEFVALKK 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCVENEFVALKKD 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KKYEEELSLRPCVENEFVALKKD 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KKYEEEVALRA 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KKYEEEVALRA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KKYEEEVALRA 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KKYEEEVALRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKYEEEVSLRA 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKYEEEVSLRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKYEEEVSLRATAENEFVALKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KKYEEEVSLRATAENEFVALKKD 2 
A0387ATP5H, My032ATP synthase D chain, mitochondrialIPI00220487KKYPYWPHQPIENL 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KLAADDFRA 2 
A3839KRT38, HHA8, HKA8Keratin, type I cuticular HA8IPI00297641KLAADDFRI 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692KLAADDFRT 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KLAADDFRT 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423KLAADDFRT 2 
A0493GJA1, GJALGap junction alpha-1 proteinIPI00218487KLAAGHELQPLAIVDQRPSSRA 3 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571KLAAVDATVNQVLASRY 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KLADLECALQQAKQ 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLAELEGALQKA 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLAELEGALQKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLAELEGALQKA 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLAELEGALQKA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLAELEGALQKA 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLAELEGALQKA 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KLAEQAERYDEMVESM*KKV 3 
A0280YWHAE14-3-3 protein epsilonIPI00000816KLAEQAERYDEMVESMKK 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KLAEQAERYDEMVESMKKV 3 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KLAEQAERYEDM*AAFMKG 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KLAEQAERYEDMAAFMKG 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KLAEQAERYEDMAAFMKG 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLAGLEEALQKA 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLAGLEEALQKA 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KLAMQEFM*ILPVGAANFRE 2 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585KLAPGTIVEVWKD 2 
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1IPI00328257;IPI00413947;IPI00384489KLAPPLVTLLSAEPELQYVALRN 2 
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1IPI00328257;IPI00413947;IPI00384489KLAPPLVTLLSAEPELQYVALRN 3 
A0089CTNNA1Alpha-1 cateninIPI00215948KLAQENMDLFKEQWEKQ 2 
A3862KRT80, KB20Keratin B20IPI00431749KLAQLEAALQQAKQ 2 
A2341ACTN1Alpha-actinin 1IPI00013508KLASDLLEWIRR 2 
A0454DSPDesmoplakinIPI00013933KLASLEELKRQ 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKK 2 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512KLATQSNEITIPVTFESRA 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLAVNM*VPFPRL 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KLAVNM*VPFPRL 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLAVNMVPFPRL 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KLAVNMVPFPRL 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KLCATDADEENHLNSKI 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00383932KLDADMPEVAVEGPNGKW 2 
A3808RPL4, RPL160S ribosomal protein L4IPI00003918;IPI00471915KLDELYGTWRK 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KLDKSQIHDIVLVGGSTRI 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLDNSRDLNMDCIIAEIKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLDNSRDLNMDCIIAEIKA 3 
A9654RPS940S ribosomal protein S9IPI00221088KLDYILGLKI 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLEAAVAEAEQQGEAALSDARC 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLEAAVAEAEQQGEAALSDARC 3 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KLEAAVAEAEQQGEATLSDAKC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLEAAVAQSEQQGEAAL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLEAAVAQSEQQGEAAL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLEAAVAQSEQQGEAALSDARC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLEAAVAQSEQQGEAALSDARC 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLEAAVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLEAAVAQSEQQGEAALSDARC 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLEGAIAEAEQQGEAAL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLEGAIAEAEQQGEAALNDAKC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLEGAIAEAEQQGEAALNDAKC 3 
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1IPI00009342KLEGVLAEVAQHYQDTLIRA 2 
A0454DSPDesmoplakinIPI00013933KLENINGVTDGYLNSLCTVRA 2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931KLFDIFSQQVATVIQSRQ 2 
A452BFAM26D, UNQ6481/PRO21277, UNQ6481Family with sequence similarity 26, member DIPI00065530KLFGFIPGSEDVKH 1 
A452BFAM26D, UNQ6481/PRO21277, UNQ6481Family with sequence similarity 26, member DIPI00065530KLFGFIPGSEDVKH 2 
A5082PKP3Plakophilin 3IPI00026952KLFNHANQEVQRH 2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243;IPI00478097KLFVVPADEAQARI 2 
A329DMST133, EFHD1, PP1187Swiprosin 2IPI00031091KLGAPQTHLGLKS 2 
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitorIPI00465081KLGDVGMAELCPGLLHPSSRL 3 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KLGDVYVNDAFGTAHRA 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KLGDVYVNDAFGTAHRA 3 
A832BARF4, ARF2ADP-ribosylation factor 4IPI00215918KLGEIVTTIPTIGFNVETVEYKN 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1IPI00018755;IPI00419258KLGEM*WNNTAADDKQPYEKK 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1IPI00018755;IPI00419258KLGEMWNNTAADDKQPYEKK 2 
A1095HMGB1, HMG1, FM1High mobility group protein B1IPI00018755;IPI00419258KLGEMWNNTAADDKQPYEKK 3 
A0454DSPDesmoplakinIPI00013933KLGIYEAMKI 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KLGLALDQNADSQFWSLKS 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KLGLDIEIATYR 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLGLDIEIATYR 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLGLDIEIATYR 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLGLDIEIATYR 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLGLDIEIATYR 1 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KLGLDIEIATYRR 1 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KLGLDIEIATYRR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLGLDIEIATYRR 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KLGLDIEIATYRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLGLDIEIATYRR 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLGLDIEIATYRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLGLDIEIATYRR 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLGLDIEIATYRR 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLGLDIEIATYRR 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLGLDIEIATYRR 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KLGLLGLANSLAIEGRK 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663KLGPALATGNVVVM*KV 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663KLGPALATGNVVVMKV 2 
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1IPI00328257;IPI00413947;IPI00384489KLHDINAQLVEDQGFLDTLKD 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KLHIIEVGTPPTGNQPFPKK 2 
A0369LDHBL-lactate dehydrogenase B chainIPI00219217KLIAPVAEEEATVPNNKI 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KLIILANGGPQALVQIM*RN 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KLIILANGGPQALVQIMRN 2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292KLIILASGGPQALVNIMRT 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KLIQERSQQQEPLLCPSYQSYFKT 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KLIQRLQQETENVKA 2 
A0454DSPDesmoplakinIPI00013933KLISPESTVM*LLEAQAATGGIIDPH 2 
A0454DSPDesmoplakinIPI00013933KLISPESTVM*LLEAQAATGGIIDPHRN 2 
A0454DSPDesmoplakinIPI00013933KLISPESTVM*LLEAQAATGGIIDPHRN 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KLISWYDNEFGYSNRV 2 
A9642RPS2540S ribosomal protein S25IPI00401105KLITPAVVSERL 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorIPI00440493;IPI00471928KLKEIVTNFLAGFEA 2 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008;IPI00289800KLKLEDFFARNSYVAGQYDDAASYQRL 3 
A0454DSPDesmoplakinIPI00013933KLKNTKIEVLEEELRL 2 
A0454DSPDesmoplakinIPI00013933KLKVQEQELTRL 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037KLLGGVTIAQGGVLPNIQAVLLPKK 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037KLLGGVTIAQGGVLPNIQAVLLPKK 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KLLLPWLEARI 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KLLNDEDPVVVTKA 1 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KLLNDEDPVVVTKA 2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292KLLNDEDQVVVNKA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KLLNQPNQWPLVKA 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KLLQDFFNGKE 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KLLQDFFNGKE 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KLLQDFFNGKELNKS 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KLLQDFFNGKELNKS 2 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269KLLQDFFNGKELNKS 2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925;IPI00477309KLLQDFFNGRD 2 
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseIPI00010415;IPI00395748;IPI00219452KLM*DEVAGIVAARH 2 
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseIPI00010415;IPI00395748;IPI00219452KLMDEVAGIVAARH 2 
A3909VPS35, MEM3Vacuolar protein sorting-associated protein 35IPI00018931KLNLEHIATSSAVSKE 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871KLNLGKNSLTHISPRV 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KLNLPINIIGLAPLCE 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KLNLPINIIGLAPLCENM*PSGKA 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KLNLPINIIGLAPLCENMPSGKA 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KLNLPINIIGLAPLCENMPSGKA 3 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKE 1 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKE 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKEPLGP 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKEPLGPALAHELRY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKEPLGPALAHELRY 3 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLNPNFLVDFGKEPLGPALAHELRYPGGDC 3 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KLNSNTQVVLLSATM*PSDVLEVTKK 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KLNSNTQVVLLSATMPSDVLEVTKK 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KLNSNTQVVLLSATMPSDVLEVTKKF 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KLPCNPCSTPSCTTCVPSPCVTRT 2 
A3584FASN, FASFatty acid synthaseIPI00418433KLPEDPLLSGLLDSPALKA 2 
A7919GARSGlycyl-tRNA synthetaseIPI00465260KLPFAAAQIGNSFRN 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301KLPFPIIDDRN 1 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301KLPFPIIDDRN 2 
A8871LAMTOR1, PDRO, PP7157RHOA activator C11ORF59IPI00016670KLPPLPSLTSQPHQVLASEPIPFSDLQQVSRI 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KLPSLSPVARS 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KLPSLSPVARSFSACS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423KLPSNPCATTNACEKPIGSCVTNPCGPRS 3 
A3939STX12Syntaxin 12IPI00329332KLQENLQQLQHSTNQLAKE 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KLQFYQNCECCQSNLEPLFAGYIETLRRE 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLQFYQNRE 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KLQFYQNRECCQSNLEPLFEGYIETLRR 3 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KLQM*EAPHIIVGTPGRV 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KLQMEAPHIIVGTPGRV 2 
A1941PLEC1, PLECPlectinIPI00186711KLQNVQIALDYLRH 2 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952KLRDLEDSLARE 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KLRNAGNEQDLGIQYKA 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984KLSDEEVDEM*IRA 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984KLSDEEVDEMIRA 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301KLSILYPATTGRN 1 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301KLSILYPATTGRN 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00013485;IPI00479366;IPI00455532;IPI00165486KLSIVPVRRG 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KLSLEGDHSTPPSAYGSVKA 2 
A9931GSDMA, GSDM, GSDM1GasderminIPI00166200KLSRVGQSSLLSSLSKL 2 
A0426VDAC2Voltage-dependent anion-selective channel protein 2IPI00024145;IPI00455531;IPI00411815;IPI00216027;IPI00216026;IPI00216024KLTFDTTFSPNTGKK 2 
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat1IPI00328343;IPI00465348KLTLHGLQQYYVKL 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896KLTRDETNYGIPQRA 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATM 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KLTTPTYGDLNHLVSATM 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATM*SGVTTC 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATM*SGVTTCLRF 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATM*SGVTTCLRF 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KLTTPTYGDLNHLVSATM*SGVTTCLRF 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATMSGVTTCL 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATMSGVTTCLRF 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KLTTPTYGDLNHLVSATMSGVTTCLRF 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KLTTPTYGDLNHLVSATMSGVTTCLRF 3 
A0454DSPDesmoplakinIPI00013933KLTVDSAIARD 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KLVDQNIFSFYLSRD 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KLVDQNIFSFYLSRDPDAQPGGELM*LGGTDSKY 3 
A5984CTSD, CPSDCathepsin D precursorIPI00011229KLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKY 3 
A6787ILVBL, AHAS, OR10B1PAcetolactate synthase-like proteinIPI00386719KLVEGLQGQTWAPDWVEELRE 2 
A7154NEU2Sialidase 2IPI00022482KLVEPPPQGCQGSVISFPSPRS 2 
A8499HUR 7, SERPINB13, PI13HurpinIPI00006560;IPI00220494KLVEWTSPGHMEERK 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KLVINGNPITIFQERD 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KLVINGNPITIFQERDP 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KLVINGNPITIFQERDPSKI 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00247601KLVINGNPITIFQERDPSKI 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLVLPSLISSRI 1 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KLVLPSLISSRI 2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525KLVPLLDTGDIIIDGGNSEYRD 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102KLVQDVANNTNEEAGDGTTTATVLARS 2 
A972BFABP4Fatty acid-binding protein 4, adipocyteIPI00215746KLVSSENFDDYM*KE 2 
A972BFABP4Fatty acid-binding protein 4, adipocyteIPI00215746KLVSSENFDDYMKE 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KLWISNGGLADIFTVFAKT 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896KLWNTLGVCKY 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KLYQGGPGGGSGGGGSGASGGPTIEEV 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KLYQGGPGGGSGGGGSGASGGPTIEEVD 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446KLYTLVLTDPDAPSRK 2 
A1308BLMHBleomycin hydrolaseIPI00219575KLYTVEYLSNM*VGGRK 2 
A1308BLMHBleomycin hydrolaseIPI00219575KLYTVEYLSNMVGGRK 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorIPI00025252KM*DATANDVPSPYEVRG 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540KM*DELQLFRG 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KM*DNSRELDVDGIIAEIKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KM*DNSRELDVDGIIAEIKA 3 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KM*FVLDEADEMLSRG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KM*KEIAEAYLGKT 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KM*M*NNNYDCPLPEEETNPKG 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KM*VPLLNKNNPKF 2 
A0369LDHBL-lactate dehydrogenase B chainIPI00219217KM*VVESAYEVIKL 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorIPI00025252KMDATANDVPSPYEVRG 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KMDNSRELDVDGIIAEIKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KMDNSRELDVDGIIAEIKA 3 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491KMFVLDEADEMLSRG 2 
A9842CTNNBIP1, ICATBeta-catenin-interacting protein 1IPI00025001KMGSNLTASEEEFLRT 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KMISDAIPELKA 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KMKEIAEAYLGGKV 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KMLDYEQAPNIQLSIGVKN 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KMMNNNYDCPLPEEETNPKG 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928KNAGFQEYTIPITVKD 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KNALESYTYNIKQ 1 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KNALESYTYNIKQ 2 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KNALNIGM*VEEVLQSSDETKS 2 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KNALNIGMVEEVLQSSDETKS 2 
A6787ILVBL, AHAS, OR10B1PAcetolactate synthase-like proteinIPI00386719KNAQM*AQSPILLLGGAASTLLQNRG 2 
A6787ILVBL, AHAS, OR10B1PAcetolactate synthase-like proteinIPI00386719KNAQMAQSPILLLGGAASTLLQNRG 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KNEILEMNKLIQRL 2 
A1733P4HB, ERBA2L, PDIProtein disulfide isomerase precursorIPI00010796;IPI00414286KNFEDVAFDEKKN 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461KNGDQHPSATLFVKI 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096KNGPLEVAGAAVSAGHGLPAKF 2 
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein UIPI00025054;IPI00479217;IPI00386491KNGQDLGVAFKI 1 
A1134HNRNPU, HNRPU, SAFAHeterogenous nuclear ribonucleoprotein UIPI00025054;IPI00479217;IPI00386491KNGQDLGVAFKI 2 
A0454DSPDesmoplakinIPI00013933KNGVGTSSSM*GSGVSDDVFSSSRH 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KNHEEEVNLLRE 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KNIEDVIAQGIGKL 1 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KNIEDVIAQGIGKL 2 
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitIPI00023748KNILFVITKPDVYKS 2 
A7478PREP, PEPProlyl endopeptidaseIPI00008164;IPI00246525KNILQLHDLTTGALLKT 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476KNLKPIKPM*QFLGDEETVRK 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476KNLKPIKPMQFLGDEETVRK 2 
A5073PPLPeriplakinIPI00298057KNLLDEIASRE 2 
A0454DSPDesmoplakinIPI00013933KNLPLADQGSSHHITVKI 2 
A0152RAN, ARA24, TC4GTP-binding nuclear protein RANIPI00012507KNLQYYDISAKS 1 
A0454DSPDesmoplakinIPI00013933KNM*PLQHLLEQIKE 2 
A0454DSPDesmoplakinIPI00013933KNMPLQHLLEQIKE 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KNNHKEEINSLQCQLGERL 2 
A7919GARSGlycyl-tRNA synthetaseIPI00465260KNNIIQTWRQ 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KNNLEPILEGYISNLRK 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KNNLEPILEGYISNLRKQ 2 
A1135PTBP1, PTBPolypyrimidine tract-binding protein 1IPI00179964;IPI00334175;IPI00183626KNNQFQALLQYADPVSAQHAKL 2 
A1135PTBP1, PTBPolypyrimidine tract-binding protein 1IPI00179964;IPI00334175;IPI00183626KNNQFQALLQYADPVSAQHAKL 3 
A7968TGM1, KTGProtein-glutamine gamma-glutamyltransferase KIPI00305622KNPLPVTLTNVVFRL 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KNQADFHYSVASQFQMHPTPVRI 3 
A0454DSPDesmoplakinIPI00013933KNQFETEINITKT 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514KNQLTSNPKNTVFDAKR 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KNQVAM*NPTNTIFDAKR 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KNQVAM*NPTNTVFDAKR 2 
A1100SNRPD1Small nuclear ribonucleoprotein Sm D1IPI00302850KNREPVQLETLSIRG 2 
A1100SNRPD1Small nuclear ribonucleoprotein Sm D1IPI00302850KNREPVQLETLSIRG 3 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446KNRPTSISWDGLDSGKL 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KNSLESYAFNM*KA 1 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KNSLESYAFNM*KA 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KNSLESYAFNMKA 1 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KNSSYFVEWIPNNVKT 2 
A0454DSPDesmoplakinIPI00013933KNTKIEVLEEELRL 2 
A0454DSPDesmoplakinIPI00013933KNTLTQTTENLRR 2 
A0089CTNNA1Alpha-1 cateninIPI00215948KNVPILYTASQACLQHPDVAAYKA 2 
A0362YWHAG14-3-3 protein gammaIPI00220642KNVTELNEPLSNEERN 2 
A5082PKP3Plakophilin 3IPI00026952KNVTGILWNLSSSDHLKD 2 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KPAVCLPVSCQ 1 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KPAVCLPVSCQSSVCVPM*SFKS 2 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KPAVCLPVSCQSSVCVPMSFKS 2 
A4903KRTAP12-1, KAP12.1, KRTAP12.1Keratin associated protein KAP12-1IPI00375324KPAVCVPVRCQSSVCVPVSCRP 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486KPFGPIINGCCCLEEKV 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KPGFTGHQYLLEEGEYRD 3 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673KPICCVPVCSGASTSC 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674KPVCCVPVCCGAASSCCRQ 2 
A790BDBIAcyl-CoA-binding proteinIPI00010182;IPI00218836KQATVGDINTERPGM*LDFTGKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KQDMACLIRE 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KQDMACLIRE 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KQDMACLLKE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KQDMACLLKE 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KQILNVLTLGKA 2 
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6IPI00329389;IPI00373918KQLASGLLLVTGPLVLNRV 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KQLTGLLWNLSSTDELKEELIADALPVLADRV 3 
A0454DSPDesmoplakinIPI00013933KQQIQNDLNQWKT 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KQQVYQLGGICKL 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KQSLGELIGTLNAAKV 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KQTQTFTTYSDNQPGVLIQVYEGERA 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KQTTVSNSQQAYQEAFEISKK 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KQVLSPGFYEIPILVKD 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KQVVSSSEQLQSCQ 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KQVVSSSEQLQSCQAEIIELRR 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759KQVVSSSEQLQSYQ 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632KQVVSSSEQLQSYQ 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423KQVVSSSEQLQSYQ 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759KQVVSSSEQLQSYQAEIIELRR 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423KQVVSSSEQLQSYQAEIIELRR 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KQYFSSSMLNNIINLCRS 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486KRAQVFHICGPEDVCEAYRH 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274KRINHGSLPHLQQRV 3 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812KRIPQSTLSEFYPRD 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289KRIPQSTLSEFYPRD 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KRISGLIYEETRG 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KRLSAEEAHLGILGPVIKA 3 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234KRSTITSREIQTAVRL 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785KRSTITSREIQTAVRL 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KSAIVHLINYQDDAELATRA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KSAIVHLINYQDDAELATRA 3 
A0454DSPDesmoplakinIPI00013933KSAIYQLEEEYENLLKA 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KSALFSSLLSSLPQDKI 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSALSGHLETVILGLLKT 2 
A3826KRT25C, KRT27Keratin, type I cytoskeletal 27IPI00328103KSASLQQQISEDVGATTSARN 2 
A3827KRT25, KRT25AKeratin, type I cytoskeletal 25IPI00375911KSASLQQQISEDVGATTSARN 2 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KSAVCVPVSC 1 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KSAVCVPVSCQ 1 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KSAVCVPVSCQS 1 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KSAVCVPVSCQSSVCVPVSCRP 2 
A4904KRTAP12-2, KAP12.2, KRTAP12.2Keratin associated protein KAP12-2IPI00375323KSAVCVPVSCQSSVCVPVSCRPIVCA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KSCPRPASVCSSGVNC 2 
A0426VDAC2Voltage-dependent anion-selective channel protein 2IPI00024145;IPI00455531;IPI00411815;IPI00216027;IPI00216026;IPI00216024KSCSGVEFSTSGSSNTDTGKV 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KSDLEAHVESLKE 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KSDLEAHVESLKEDLLCLKK 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KSDLEAHVESLKEDLLCLKK 3 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052KSDLEANVDTLTQEIDFLKT 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KSDLEANVEALIQEIDFLRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KSDLEANVEALIQEIDFLRR 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KSDLEANVEALIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KSDLEANVEALIQEIDFLRR 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KSDLEANVEALVEESSFLRR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KSDLEANVEALVEESSFLRR 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KSDLEAQVESLKE 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KSDLEAQVESLKE 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KSDLEAQVESLKEELLCLKK 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KSDLEAQVESLKEELLCLKK 3 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759KSDLEAQVESLKEELLCLKS 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759KSDLEAQVESLKEELLCLKS 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLRE 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLREELI 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLREELICLKK 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLREELICLKK 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLREELICLKKN 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KSDLESQVESLREELICLKKN 3 
A0493GJA1, GJALGap junction alpha-1 proteinIPI00218487KSDPYHATSGALSPAKD 2 
A0493GJA1, GJALGap junction alpha-1 proteinIPI00218487KSDPYHATSGALSPAKDC 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KSFIKDYPVVSIEDPFDQDDWGAWQKF 3 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525KSFLEDIRKA 2 
A4909KRTAP24-1, KAP24.1Keratin-associated protein 24-1IPI00414750KSFQTLNHCRLSTLGYKS 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KSFTEDKLATLFLERG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KSFYPEEVSSM*VLTKM 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KSFYPEEVSSMVLTKM 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KSGAIESTAPACTSSSPCSLKE 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KSGGIPALVRM 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KSGIEAIATPSDIDNDFVNDIIARA 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KSGIEAIATPSDIDNDFVNDIIARA 3 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524KSGVGNIFIKN 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096KSIAFPSIGSGRNGFPKQ 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230KSILFVPTSAPRG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KSINPDEAVAYGAAVQAAILSGDKS 2 
A231CNPC1Niemann-Pick C1 protein precursorIPI00005107KSISQYLHAGPPVYFVLEEGHDYTSSKG 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00472718KSIYGEKFEDENFILKHpy 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200KSKAEAEALYQTKF 2 
A7241OTUB1, OTB1, OTU1Ubiquitin thiolesterase protein OTUB1IPI00409750;IPI00000581KSKEDLVSQGFTE 1 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KSKYESELSLRQ 1 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KSKYESELSLRQ 2 
A0369LDHBL-lactate dehydrogenase B chainIPI00219217KSLADELALVDVLEDKL 2 
A3803EEF1D, EF1DElongation factor 1-deltaIPI00023048;IPI00305969KSLAGSSGPGASSGTSGDHGELVVRI 2 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KSLEEAQEWLKQ 1 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KSLEEAQEWLKQ 2 
A0430LMNB1, LMN2, LMNBLamin B1IPI00217975KSLEGDLEDLKDQIAQLEASLAAAKK 3 
A1941PLEC1, PLECPlectinIPI00186711KSLLAWQSLRR 2 
A5073PPLPeriplakinIPI00298057KSLLGEVEQNLQAAKQ 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KSLNSRFAAFIDKV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KSLNSRFAAFIDKV 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KSLNSRFAAFIDKV 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470KSLTNDWEDHLAVKH 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775KSLTNDWEDHLAVKH 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KSLYEEEICLLQS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KSLYEEEICLLQSQISETS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KSLYEEEICLLQSQISETSVIVKM 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KSLYEEEICLLQSQISETSVIVKM 3 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSLYYYIQQDTKG 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSLYYYIQQDTKGDYQKA 2 
A6588GGCT, CRF21Gamma-glutamylcyclotransferaseIPI00031564KSNLNSLDEQEGVKS 2 
A0152RAN, ARA24, TC4GTP-binding nuclear protein RANIPI00012507KSNYNFEKPFLWL 2 
A2463NACA, HSD48, ALPHA NACNascent polypeptide associated complex alpha subunitIPI00023748KSPASDTYIVFGEAKI 2 
A7919GARSGlycyl-tRNA synthetaseIPI00465260KSPITGNDLSPPVSFNLMFKT 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719KSPQYCQVIHRL 2 
A472CSEC24CProtein transport protein Sec24CIPI00024661KSPVESTTEPPAVRA 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461KSPYLYPLYGLGELPQGFARL 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KSQETECTYFSTPLLLGKK 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KSQIFSTASDNQPTVTIKV 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KSQIHDIVLVGGSTRI 2 
A8400CSTB, CST6, STFBCystatin BIPI00021828KSQVVAGTNYFIKV 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KSRLECEITTYR 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KSRLECEITTYRS 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KSTAGDTHLGGEDFDNRM 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KSTAGDTHLGGEDFDNRM 2 
A4895KRTAP10-6, KRTAP18.6, KAP10.6Keratin-associated protein 10-6IPI00394670KSTCCVPVPSCGASASSCQPSCCRT 2 
A4899KRTAP10-10, KAP10.10, KAP18-10Keratin associated protein KAP10-10IPI00375325KSTCCVPVPSCGASASSCQPSCCRT 2 
A4899KRTAP10-10, KAP10.10, KAP18-10Keratin associated protein KAP10-10IPI00375325KSTCCVPVPSCGASASSCQPSCCRT 3 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00219038KSTELLIRK 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875KSTFVLDEFKR 1 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875KSTFVLDEFKRK 2 
A0524PFN1Profilin IIPI00216691KSTGGAPTFNVTVTKT 2 
A972BFABP4Fatty acid-binding protein 4, adipocyteIPI00215746KSTITLDGGVLVHVQKW 2 
A4899KRTAP10-10, KAP10.10, KAP18-10Keratin associated protein KAP10-10IPI00375325KSVCYVPVCSGASTSC 2 
A0454DSPDesmoplakinIPI00013933KSVEDRFDQQKNDYDQLQKA 2 
A0454DSPDesmoplakinIPI00013933KSVEDRFDQQKNDYDQLQKA 3 
A0454DSPDesmoplakinIPI00013933KSVEEVASEIQPFLRG 2 
A0454DSPDesmoplakinIPI00013933KSVEEVASEIQPFLRG 3 
A5082PKP3Plakophilin 3IPI00026952KSVENAVCVLRN 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KSVENCMCVLHNLSYRL 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461KSVHFGGFSSPGTPGQAFYEMAS 2 
A0454DSPDesmoplakinIPI00013933KSVQNDSQAIAEVLNQLKD 2 
A0454DSPDesmoplakinIPI00013933KSVQNDSQAIAEVLNQLKD 3 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KSVTEQGAELSNEERN 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KSYELPDGQVITIGNERF 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KSYELPDGQVITIGNERF 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSYSPYDM*LESIRK 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSYSPYDM*LESIRKE 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSYSPYDMLESIRK 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KSYSPYDMLESIRKE 2 
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3XIPI00215637KTAAFLLPILSQIYSDGPGEALRA 2 
A3862KRT80, KB20Keratin B20IPI00431749KTAEEQGELAFQDAKT 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00419585KTAENFRALSTGEKG 2 
A0362YWHAG14-3-3 protein gammaIPI00220642KTAFDDAIAELDTLNEDSYKD 2 
A0907YWHAQ14-3-3 protein tauIPI00018146KTAFDEAIAELDTLNEDSYKD 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KTAFDEAIAELDTLNEESYKD 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KTAFDEAIAELDTLNEESYKDSTLIM*QLLRD 3 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KTAFDEAIAELDTLSEESYKD 2 
A0361YWHAZ14-3-3 protein zeta/deltaIPI00021263;IPI00180776KTAFDEAIAELDTLSEESYKD 3 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KTALDAFGRI 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KTAVCDIPPRG 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KTAVCDIPPRG 2 
A9544RPL1860S ribosomal protein L18IPI00215719KTAVVVGTITDDVRV 2 
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aIPI00299573;IPI00479315KTCTTVAFTQVNSEDKGALAKL 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KTDLEKDIISDTSGDFRK 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KTDLEKDIISDTSGDFRK 3 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KTDLEKDIISDTSGDFRKL 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KTDLEKDIISDTSGDFRKL 3 
A5453S100A11, MLN70, S100CCalgizzarinIPI00013895KTEFLSFMNTELAAFTKN 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KTEGAQVDEPVVITPRA 2 
A5957CRAT, CAT1Carnitine O-acetyltransferaseIPI00016457;IPI00292244;IPI00029140KTENWLSEWWLKT 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514KTFAPKEISAMVLTKM 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KTFFPEEISSM*VLTKM 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KTFFPEEISSMVLTKM 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorIPI00025252KTFSHELSDFGLESTAGEIPVVAIRT 2 
A0524PFN1Profilin IIPI00216691KTFVNITPAEVGVLVGKD 2 
A9556L27a, RPL27A, L27A60S ribosomal protein L27aIPI00398135KTGAAPIIDVVRS 2 
A9556L27a, RPL27A, L27A60S ribosomal protein L27aIPI00398135KTGAAPIIDVVRSGYYKV 2 
A0454DSPDesmoplakinIPI00013933KTGSQYDIQDAIDKG 2 
A0454DSPDesmoplakinIPI00013933KTGSQYDIQDAIDKGLVDRK 2 
A0454DSPDesmoplakinIPI00013933KTGSQYDIQDAIDKGLVDRK 3 
A0454DSPDesmoplakinIPI00013933KTGSQYDIQDAIDKGLVDRKF 2 
A0454DSPDesmoplakinIPI00013933KTGSQYDIQDAIDKGLVDRKF 3 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KTHINIVVIGHVDSGKS 3 
A0454DSPDesmoplakinIPI00013933KTIADLELHYQEFIRN 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialIPI00305383KTIAQGNLSNTDVQAAKN 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KTIIPLISQCTPKV 2 
A3515SEPT2, DIFF6, NEDD5Septin-2IPI00014177KTIISYIDEQFERY 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237KTIQVDNTDAEGRL 2 
A6551GPIGlucose-6-phosphate isomeraseIPI00027497KTITDVINIGIGGSDLGPLM*VT 2 
A9646RPS27A, UBA80, UBCEP1Ubiquitin and ribosomal protein S27A precursorIPI00397808KTITLEVELSDTIDNVKApq 2 
A1256UBBPolyubiquitin-BIPI00387164KTITLEVEPSDTIENVKA 2 
A1256UBBPolyubiquitin-BIPI00387164KTITLEVEPSDTIENVKAKI 2 
A6551GPIGlucose-6-phosphate isomeraseIPI00027497KTLAQLNPESSLFIIASKT 2 
A0370LDHA, PIG19L-lactate dehydrogenase A chainIPI00217966KTLHPDLGTDKDKEQWKE 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorIPI00031522KTLQEVTQLSQEAQRI 2 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KTLQQFPGGSIDLQKEDNGIGILTLNNPSRM 3 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KTLVTQNSGVEALIHA 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KTLVTQNSGVEALIHAILRA 2 
A1308BLMHBleomycin hydrolaseIPI00219575KTLYNNQPIDFLKKM 2 
A7919GARSGlycyl-tRNA synthetaseIPI00465260KTLYVEEVVPNVIEPSFGLGRI 2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918KTPAQFDADELRA 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KTPAQYDASELKA 2 
A9638RPS2040S ribosomal protein S20IPI00012493KTPVEPEVAIHRI 3 
A9638RPS2040S ribosomal protein S20IPI00012493KTPVEPEVAIHRIRI 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KTPVTDPATGAVKE 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744KTPVTDPATGAVKEKI 3 
A370CRTN3, ASYIP, NSPL2Reticulon protein 3IPI00028946;IPI00412154;IPI00398795KTQIDHYVGIARD 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530KTSFFQALGITTKI 1 
A3807RPLP060S acidic ribosomal protein P0IPI00008530KTSFFQALGITTKI 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KTSGATCDANSVM*NCGIRG 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398KTSGATCDANSVMNCGIRG 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KTSYSASIEENCLSSELIRL 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAM*ADLHTLSEDSYKD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAM*ADLHTLSEDSYKDSTLIM*QLLRD 3 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAMADLHT 1 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAMADLHT 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAMADLHTLS 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAMADLHTLSEDSYKD 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KTTFDEAMADLHTLSEDSYKD 3 
A0454DSPDesmoplakinIPI00013933KTTIHQLTM*QKEEDTSGYRA 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674KTVCCKPVCCVPVCCGAASSCCRQ 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674KTVCCKPVCCVPVCCGAASSCCRQ 3 
A4896KRTAP10-7, KAP10.7, KAP18-7Keratin-associated protein 10-7IPI00394671KTVCCKPVYCVPVCSGDSSC 2 
A4896KRTAP10-7, KAP10.7, KAP18-7Keratin-associated protein 10-7IPI00394671KTVCCKPVYCVPVCSGDSSCC 2 
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorIPI00419262KTVDNFVALATGEKG 2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503KTVESITDIRA 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorIPI00031522KTVLGTPEVLLGALPGAGGTQRL 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KTVLIM*ELINNVAKA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KTVLIMELINNVAKA 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729KTVLLLADQMISRI 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KTVTAM*DVVYALKR 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KTVTAM*DVVYALKRQ 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KTVTAMDVVYALKR 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KTVTAMDVVYALKRQ 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KTVTNAVVTVPAYFNDSQRQ 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674KTVYCKPICCVPVCSRA 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00013485;IPI00479366;IPI00455532;IPI00165486KTYSYLTPDLWKE 1 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00013485;IPI00479366;IPI00455532;IPI00165486KTYSYLTPDLWKE 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00478002KTYSYLTPNLWKE 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663KVAEQTPLTALYVANLIKE 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663KVAFTGSTEIGRV 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KVAGM*DVELTVEERN 2 
A0280YWHAE14-3-3 protein epsilonIPI00000816KVAGMDVELTVEERN 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVAHALAEGLGVIACIGEKL 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KVALVYGQM*NEPPGARA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KVALVYGQMNEPPGARA 2 
A0493GJA1, GJALGap junction alpha-1 proteinIPI00218487KVAQTDGVNVDMHLKQ 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KVAVAIPNRPPDAVLTDTTSLNQAALYRL 3 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KVAVLGASGGIGQPLSLLLKN 2 
A639ALGALS3, MAC2, GALIGGalectin-3IPI00465431KVAVNDAHLLQYNHRV 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082KVCLEITEDGGDSIEVPGARI 2 
A2466ENDOU, P11Placental protein 11 precursorIPI00006995KVCQLSLGGYPLAVRT 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006KVDFPQDQLTALTGRI 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KVDIDAPDVDVHGPDWHL 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00418700KVDIDVPDVNIEGPDAKL 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00383932KVDIEGPDVNIEGPEGKL 2 
A0428ALDOC, ALDCFructose-bisphosphate aldolase CIPI00418262KVDKGVVPLAGTDGETTTQGLDGLSERC 3 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KVDVDVPDVNIEGPDAKL 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00418700KVDVDVPDVNIEGPDAKL 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812KVDVEVPDVSLEGPEGKL 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00383932KVDVEVPDVSLEGPEGKL 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890KVETELQGVCDTVLGLLDSHLIKE 3 
A6551GPIGlucose-6-phosphate isomeraseIPI00027497KVFEGNRPTNSIVFTKL 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRD 1 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRD 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRDA 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRDAVTYT 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRDAVTYTEHP 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473KVFLENVIRDAVTYTEHP 3 
A7242OTUB2, OTB2, OTU2Ubiquitin thioesterase OTUB2IPI00302895KVFNDQSASDHIVQFLRL 2 
A1598C3, CPAMD1Complement C3 precursorIPI00164623KVFSLAVNLIAIDSQVLCGAVKW 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102KVGGTSDVEVNEKK 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00418700KVGIDTPDIDIHGPEGKL 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675KVGINYQPPTVVPGGDLAKV 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144KVGINYQPPTVVPGGDLAKV 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750KVGINYQPPTVVPGGDLAKV 2 
A5622PGD, PGDH6-phosphogluconate dehydrogenase, decarboxylatingIPI00219525KVGTGEPCCDWVGDEGAGHFVKM 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KVGYTPDWIFLLRN 2 
A589AEIF5AEukaryotic translation initiation factor 5AIPI00376005;IPI00411704KVHLVGIDIFTGKK 1 
A589AEIF5AEukaryotic translation initiation factor 5AIPI00376005;IPI00411704KVHLVGIDIFTGKK 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KVHSAVITVPAYFNDSQRQ 2 
A8400CSTB, CST6, STFBCystatin BIPI00021828KVHVGDEDFVHLRV 2 
A8400CSTB, CST6, STFBCystatin BIPI00021828KVHVGDEDFVHLRV 3 
A6804PPA1, IOPPP, PPInorganic pyrophosphataseIPI00015018KVIAINVDDPDAANYNDINDVKR 2 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537KVIELENWTEGKG 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KVIHDNFGIVEGLM*TTVHAITATQKT 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KVIHDNFGIVEGLM*TTVHAITATQKT 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KVIHDNFGIVEGLMTTVHAITATQKT 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KVIQCFAETGQVQKI 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KVISELNGKNIEDVIAQGIGKL 2 
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2IPI00008529KVISELNGKNIEDVIAQGIGKL 3 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KVISSYEHVQPCFIIRPAKV 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274KVIVTVQARP 2 
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicIPI00291005KVIVVGNPANTNCLTASKS 2 
A9931GSDMA, GSDM, GSDM1GasderminIPI00166200KVKGTAGLSQNSTLEVQTLSVAPKA 3 
A1941PLEC1, PLECPlectinIPI00186711KVLALPEPSPAAPTLRS 2 
A5073PPLPeriplakinIPI00298057KVLDKYEDVVQGLQKR 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KVLDSGAPIKIPVGPETLGRI 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KVLDSGAPIKIPVGPETLGRI 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KVLDVNDNFPTLEKT 2 
A5541CRYAB, CRYA2Alpha crystallin B chainIPI00021369KVLGDVIEVHGKH 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00247601KVLHDNFGIVKGLM*TTVHAITATQKT 3 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912KVLHGEQYLELYKPLPRA 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KVLNNM*EIGTSLFDEEGAKI 2 
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1IPI00169383KVLNNMEIGTSLFDEEGAKI 2 
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialIPI00220362KVLQATVVAVGSGSKG 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KVLSVCPSNKPAIVEAGGM*QALGKH 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KVLSVCPSNKPAIVEAGGM*QALGKH 3 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KVLSVCPSNKPAIVEAGGMQALGKH 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079KVLSVCPSNKPAIVEAGGMQALGKH 3 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175KVM*VLVFVTPTPLGTRW 2 
A0426VDAC2Voltage-dependent anion-selective channel protein 2IPI00024145;IPI00455531;IPI00411815;IPI00216027;IPI00216026;IPI00216024KVNNSSLIGVGYTQTLRPGVKL 2 
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 1IPI00140420KVNVTVDYIRPASPATETVPAFSERT 3 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVPADTEVVCAPPTAYIDFARQ 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVPADTEVVCAPPTAYIDFARQ 3 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376KVPDESEVVVERD 2 
A6384DUSP14, MKP6Dual specificity protein phosphatase 14IPI00013031KVPLADM*PHAPIGLYFDTVADKI 3 
A6384DUSP14, MKP6Dual specificity protein phosphatase 14IPI00013031KVPLADMPHAPIGLYFDTVADKI 3 
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aIPI00299573;IPI00479315KVPPAINQFTQALDRQ 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461KVPSTEAEALASSLMGLFEKR 2 
A3211CKAP4, P63P63 proteinIPI00141318KVQEQVHTLLSQDQAQAARL 2 
A5799METAP2, MNPEP, P67EIF2Methionine aminopeptidase 2IPI00033036;IPI00300763KVQTDPPSVPICDLYPNGVFPKG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865KVQVEYKGETKS 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702KVQVEYKGETKT 2 
A0454DSPDesmoplakinIPI00013933KVRNNYDEEIISLKN 2 
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformIPI00217030KVRTDITYPAGFM*DVISIDKT 2 
A3818RPS4X, CCG2, RPS440S ribosomal protein S4, X isoformIPI00217030KVRTDITYPAGFMDVISIDKT 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475KVSDTVVEPYNATLSVHQ 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752KVSDTVVEPYNATLSVHQ 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KVSQPIEGHAASFAQFKM 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362KVTHAVVTVPAYFNDAQRQ 2 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165KVTIAQGGVLPNI 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274KVTIAQGGVLPNI 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274KVTIAQGGVLPNIQAVLLPKK 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274KVTIAQGGVLPNIQAVLLPKK 3 
A0370LDHA, PIG19L-lactate dehydrogenase A chainIPI00217966KVTLTSEEEARL 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVTNGAFTGEISPGM*IKD 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVTNGAFTGEISPGMIKD 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461KVTVEIHGVSRD 2 
A3862KRT80, KB20Keratin B20IPI00431749KVTVNPGLLVPLDVKL 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476KVVDLLAPYAKG 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KVVIGMDVAASEFFRS 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KVVIYSEPDVSEKC 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028KVVLAYEPVWAIGTGKT 2 
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialIPI00220362KVVLDDKDYFLFRD 2 
A5082PKP3Plakophilin 3IPI00026952KVVSHLIEKLPGSVGEKS 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840KVVVYEKPFFEGKC 2 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175KVVYENAYGQFIGPHRI 2 
A6977LPCAT3, MBOAT5, OACT5Lysophospholipid acyltransferase 5IPI00306419KVWLFETNPRF 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896KVWNLANCKL 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031KVYSILPHGVIYDKA 2 
A790BDBIAcyl-CoA-binding proteinIPI00010182;IPI00218836KWDAWNELKG 1 
A790BDBIAcyl-CoA-binding proteinIPI00010182;IPI00218836KWDAWNELKG 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KWGDAGAEYVVESTGVFTTM*EKA 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018KWGDAGAEYVVESTGVFTTMEKA 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315KWISIMTERS 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383KWLLLTGISAQQNRV 2 
A7478PREP, PEPProlyl endopeptidaseIPI00008164;IPI00246525KWM*GGAELSDDGRY 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KWNFM*QQQRC 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KWNFM*QQQRC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KWNFMQQQRC 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KWNFMQQQRC 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KWQFYQNQRC 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KWQFYQNQRC 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446KWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKV 3 
A5453S100A11, MLN70, S100CCalgizzarinIPI00013895KYAGKDGYNYTLSKT 2 
A0454DSPDesmoplakinIPI00013933KYCYLQNEVFGLFQKL 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KYEAELAM*RQ 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KYEAELAMRQ 1 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540KYEAELAMRQ 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KYEAEVSLRQ 1 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330KYEAEVSLRQ 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KYEEELSLRPCVENEFVALKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KYEEELSLRPCVENEFVALKK 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053KYEEELSLRPCVENEFVALKKD 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KYEEEVALRA 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541KYEEEVALRA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KYEEEVALRA 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795KYEEEVALRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KYEEEVSLRA 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655KYEEEVSLRA 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625KYESELSLRQ 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649KYETEVSLRQ 2 
A3804EEF2, EF2Elongation factor 2IPI00186290KYEWDVAEARK 1 
A3804EEF2, EF2Elongation factor 2IPI00186290KYEWDVAEARK 2 
A0454DSPDesmoplakinIPI00013933KYGDGIQLTRS 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00013769KYGKDATNVGDEGGFAPNILENKE 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KYGKDATNVGDEGGFAPNILENKE 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248KYGKDATNVGDEGGFAPNILENKE 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691KYIINGIYTAEILAIDDGSGKT 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757KYISLIYTNYEAGKDDYVKA 2 
A0467YWHAB14-3-3 protein beta/alphaIPI00216318KYLIPNATQPESKV 2 
A0514DNCL1, DYNLL1, DLC1Dynein light chain 1, cytoplasmicIPI00019329KYNPTWHCIVGRN 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KYPIEHGIITNWDDM*EKI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006KYPIEHGIITNWDDM*EKI 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KYPIEHGIVTNWDDM*EKI 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440KYPIEHGIVTNWDDMEKI 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528KYQAIGAYYIQHTCFQDESAKQ 2 
A0426VDAC2Voltage-dependent anion-selective channel protein 2IPI00024145;IPI00455531;IPI00411815;IPI00216027;IPI00216026;IPI00216024KYQLDPTASISAKV 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715KYQTEQSLRL 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423KYQTEQSLRQ 2 
A468AH1F0, H1FVHistone H1.0IPI00294304KYSDMIVAAIQAEKN 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289KYSNSALGHVNCTIKE 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896KYTVQDESHSEWVSCVRF 2 
A8499HUR 7, SERPINB13, PI13HurpinIPI00006560;IPI00220494KYYHASLEPVDFVNAADESRK 2 
A8499HUR 7, SERPINB13, PI13HurpinIPI00006560;IPI00220494KYYHASLEPVDFVNAADESRK 3 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KYYVTIIDAPGHRD 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724KYYVTIIDAPGHRDFIKN 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465LAAAGYDVEKNNSRI 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037LAAVLEYLTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037LAAVLEYLTAEILELAGNAARD 3 
A0901SFN, HME114-3-3 protein sigmaIPI00013890LAEVATGDDKKRI 2 
A0428ALDOC, ALDCFructose-bisphosphate aldolase CIPI00418262LAGTDGETTTQGLDGLSERC 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439LAGTNGETTTQGLDGLSERC 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079LALCPANHAPLQEAAVIPRL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LALEIDPTVQRV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LALEIDPTVQRVKR 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890LALNFSVFHYEIANSPEEAISLAKT 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LASELNHVQEVLEGYKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LASELNHVQEVLEGYKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LASELNHVQEVLEGYKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LASELNHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LASELNHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LASELNHVQEVLEGYKKK 2 
A0454DSPDesmoplakinIPI00013933LASYTSGLETLLNIPIKRT 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LCSLQAALEGYKKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540LDDLTLCKA 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649LDDLTLCKS 1 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752LDTNKDCEVDFVEYVRS 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752LDTNKDCEVDFVEYVRS 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LDVDGIIAEIKA 1 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692LEAQVESLKEELMCLKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540LEAQVESLKEELMCLKK 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759LEIELQAQHNLRD 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632LEIELQAQHNLRD 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LEIELQAQHNLRD 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423LEIELQAQHNLRY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540LEIELQAQHSLRD 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540LEIELQAQHSLRDSLENTLTESEARY 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LESELCSLQAALEGYKKK 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LESQVESLREELICLKK 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274LEYLTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037LEYLTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037LEYLTAEILELAGNAARD 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096LEYLTAEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096LEYLTAEILELAGNAARD 3 
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1IPI00014165LEYLTAKILELAGNAARD 2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00219038LFEDTNLCAIHAKR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LFEGYIETLRR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LFSGYIETLRR 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625LIDNLENQLAEIRC 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691LILSGNDGNWFDIQTDPQTNEGILKV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LIQEIDFLRR 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LITNVESQLAEIRC 1 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LITNVESQLAEIRC 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759LITNVESQLAEIRS 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632LITNVESQLAEIRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423LITNVESQLAEIRS 1 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423LITNVESQLAEIRS 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330LLTQIQSLIDNLEAQLAEIRC 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330LLTQIQSLIDNLEAQLAEIRC 3 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079LNDEDPVVVTKA 1 
A0901SFN, HME114-3-3 protein sigmaIPI00013890LNFSVFHYEIANSPEEAISLAKT 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890LNFSVFHYEIANSPEEAISLAKT 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LNHVQEVLEGYKK 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LNHVQEVLEGYKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LNHVQEVLEGYKK 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LNHVQEVLEGYKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LNHVQEVLEGYKK 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LNHVQEVLEGYKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LNHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LNHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LNHVQEVLEGYKKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LNLEIDPNAQCVKQ 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LNLEIDPNAQCVKQ 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LNLEIDPNAQCVKQ 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541LNLEIDPNAQCVKQEEKE 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LNLEIDPNAQCVKQEEKE 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LNLEIDPNAQCVKQEEKE 2 
A4918KRTAP3-1, KAP3.1, KRTAP3.1Keratin associated protein 3-1IPI00011212LNNCHPTPGLSGINLTTYVQPGCESPCEPRC 3 
A0454DSPDesmoplakinIPI00013933LPLADQGSSHHITVKI 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330LPVLCPDYLSYYTTIEELQQKI 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LQSHISDTSVVVKL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LQSHISDTSVVVKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LQSQISETSVIVKM 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LREELICLKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LRKSDLEANVEALIQEIDFLRR 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LRKSDLEANVEALIQEIDFLRR 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LRLLVESDINSIRR 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LRLLVESDINSIRR 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440LRVAPEEHPVLLTEAPLNPKA 3 
A4890KRTAP10-1, KAP10.1, KAP18-1Keratin-associated protein 10-1IPI00394673LSCCAPAPCLTLVCTPVSRV 2 
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1IPI00328257;IPI00413947;IPI00384489LSEIAESHPSSNLLDLNPQSINKL 2 
A4918KRTAP3-1, KAP3.1, KRTAP3.1Keratin associated protein 3-1IPI00011212LSGINLTTYVQPGCESPCEPRC 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702LSLGIETAGGVMTPLIKR 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719LSLKDGLIPLEIRF 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LSLRPCVENEFVALKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053LSLRPCVENEFVALKKD 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715LSQVQSLITNVESQLAEIRC 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759LSQVQSLITNVESQLAEIRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423LSQVQSLITNVESQLAEIRS 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530LSVETDYTFPLAEKV 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274LTAEILELAGNAARD 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037LTAEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096LTAEILELAGNAARD 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655LTGGFGSHSVCGGFRA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795LTGGFGSHSVCGGFRA 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845LTHVFSTCRPSCSGL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362LTLGIETVGGVMTKL 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514LTLGIETVGGVMTKL 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540LTMTPDYQSHFRT 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274MAAVLEYLTAEILELAGNAARD 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274MAAVLEYLTAEILELAGNAARD 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096MAAVLEYLTAEILELAGNAARD 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096MAAVLEYLTAEILELAGNAARD 3 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274MAAVLEYLTAEILELAGNAARDNKK 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096MAAVLEYLTAEILELAGNAARDNKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540MACLPSVCLPTTFRP 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540MACLPSVCLPTTFRPASCLSKT 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234MGIM*NSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785MGIM*NSFVNDIFERI 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234MGIMNSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785MGIMNSFVNDIFERI 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorIPI00291006MICVIANPVNSTIPITAEVFKK 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649MITNVEAQLAEIRA 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649MITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540MITNVEAQLAEIRA 1 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540MITNVEAQLAEIRA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053MKADLETNAEALVQEIDFLKS 2 
A0213IQGAP1Ras GTPase-activating-like protein IQGAP1IPI00009342MLVNLEEPLASTYQDILYQAKQ 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691MMSPDLPIGQTVGSTSPMTSRH 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274MNLQVSDTATYECRV 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234MNSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785MNSFVNDIFERI 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301MPGGLLLGDVAPNFEANTTVGRI 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301MPGGLLLGDVAPNFEANTTVGRI 3 
A7027MIF, GLIF, MMIFMacrophage migration inhibitory factorIPI00293276MPM*FIVNTNVPRA 2 
A7027MIF, GLIF, MMIFMacrophage migration inhibitory factorIPI00293276MPMFIVNTNVPRA 2 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757MPPYTVVYFPVRG 1 
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PIPI00219757MPPYTVVYFPVRG 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759MPYNFCLPSLSCRT 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423MPYNFCLPSLSCRT 2 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AIPI00465439MPYQYPALTPEQKK 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465MSETAPAAPAAAPPAEKA 2 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468MSETAPAETATPAPVEKS 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376MSLDPEEEAEHPIKI 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752MSVLDTNKDCEVDFVEYVRS 2 
A3633HSD17B12Hydroxysteroid (17-beta) dehydrogenase 12IPI00007676MSYEYPEYFLDVPDLDNVIKK 2 
A652CTXNL1, TRP32, TXLThioredoxin-like protein 1IPI00305692MVGVKPVGSDPDFQPELSGAGSRL 2 
A3804EEF2, EF2Elongation factor 2IPI00186290MVNFTVDQIRA 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729MYFNLGSLPWQGLKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NAEALVQEIDFLKS 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NAEALVQEIDFLKS 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052NAENEFVALKKD 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759NALEIELQAQHNLRD 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632NALEIELQAQHNLRD 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715NALEIELQAQHNLRD 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423NALEIELQAQHNLRY 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871NALQDLDGNVFRM 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541NESLLTPLNLEIDPNAQCVKQ 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NESLLTPLNLEIDPNAQCVKQ 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NESLLTPLNLEIDPNAQCVKQ 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NESLLVPLALEIDPTVQRV 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719NFLVDFGKEPLGPALAHELRY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719NFLVDFGKEPLGPALAHELRY 3 
A0901SFN, HME114-3-3 protein sigmaIPI00013890NFSVFHYEIANSPEEAISLAKT 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274NGDGQEVLYLAEGDNVRL 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984NGFVSAAELRH 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274NGGGVGGGACGDLASEIRE 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096NGPLEVAGAAVSAGHGLPAKF 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096NGPLEVAGAAVSAGHGLPAKF 3 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692NGSEKETMQFLNDRL 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759NGSEKETMQFLNDRL 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423NGSEKETMQFLNDRL 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715NGSEKETMQFLNDRL 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079NHAPLQEAAVIPRL 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871NHISSLPDNVFSNLRQ 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541NHVQEVLEGYKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NHVQEVLEGYKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NHVQEVLEGYKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541NHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NHVQEVLEGYKKK 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691NICVPAELADYNNVIYAERV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NIEPIFEGYISALRR 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NIEVDAAPPVDLTRV 2 
A207DCRIP2, CRP2Cysteine-rich protein 2IPI00006034NIGGAGSYIYEKPLAEGPQVTGPIEVPAARA 3 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274NIQAVLLPKK 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037NIQAVLLPKK 2 
A275ES100A3, S100ES100 calcium-binding protein A3IPI00016752NKDCEVDFVEYVRS 2 
A9642RPS2540S ribosomal protein S25IPI00401105NKDPVNKSGGKAKKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NLEPLFEGYIETLRR 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845NLETSCGSSTAYYVPRP 2 
A0008CALM1, CALM2, CALM3CalmodulinIPI00075248;IPI00478156;IPI00411575NLGEKLTDEEVDEMIRE 3 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292NLINYQDDAELATRA 2 
A4918KRTAP3-1, KAP3.1, KRTAP3.1Keratin associated protein 3-1IPI00011212NLTTYVQPGCESPCEPRC 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200NNLEPILEGYISNLRKQ 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NPCSTPSCTTCVPSPCVTRT 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719NPDAAQGFVGCALSSTIQRF 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719NPNFLVDFGKEPLGPALAHELRY 3 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524NPSAPSYPMASLYVGDLHPDVTEAMLYEKF 3 
A4445CLIC3Chloride intracellular channel protein 3IPI00000692NPVPAQDEALYQQLLRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NRECCQSNLEPLFEGYIETLRR 2 
A0454DSPDesmoplakinIPI00013933NRSMVEDITGLRL 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865NRTTPSYVAFTDTERL 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865NRTTPSYVAFTDTERL 3 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702NRTTPSYVAFTDTERL 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702NRTTPSYVAFTDTERL 3 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269NRTTPSYVAFTDTERL 2 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269NRTTPSYVAFTDTERL 3 
A8502SERPINB5, PI5Maspin precursorIPI00418219NSAFAVDLFKQ 1 
A8502SERPINB5, PI5Maspin precursorIPI00472082NSAFAVDLFKQ 1 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234NSFVNDIFERI 1 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234NSFVNDIFERI 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785NSFVNDIFERI 1 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785NSFVNDIFERI 2 
A0454DSPDesmoplakinIPI00013933NSIKDYELQLASYTSGLETLLNIPIKRT 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NSKLEAAVAQSEQQGEAALSDARC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NSKLEAAVAQSEQQGEAALSDARC 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NSKLEAAVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NSKLEAAVAQSEQQGEAALSDARC 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NSNVVVGTTNACAPSARV 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890NSPEEAISLAKT 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541NSRDLNMDCIIAEIKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NSRDLNMDCIIAEIKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NSRELDVDGIIAEIKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053NSRELDVDGIIAEIKA 3 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585NSTAGPSCTLLEEAFRR 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845NSYQPIGDCVPNAYRP 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719NTGTEAPDYLATVDVDPKS 2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292NTIPLFVQLLYSPIENIQRV 2 
A0454DSPDesmoplakinIPI00013933NTKIEVLEEELRL 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NTLEIELQAQHSLRD 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NTLEIELQAQHSLRDSLENTLTESEARY 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715NTLTESEAHYSSQLSQVQSLITNVESQLAEIRC 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440NTVLSGGTTM*YPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440NTVLSGGTTMYPGIADRM 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NVEALIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795NVEALIQEIDFLRR 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649NVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NVEAQLAEIRA 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715NVEVDTAPTVDLNQVLNETRS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274NVFLSYQDKRI 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655NVVVGTTNACAPSARV 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540NYQSDIIDLRR 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724PGMVVTFAPVNVTTEVKS 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655PSNSNVVVGTTNACAPSARV 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QAASGISGSM*GPGSWYSEGAFNGNEKE 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QAASGISGSMGPGSWYSEGAFNGNEKE 2 
A0454DSPDesmoplakinIPI00013933QAATGFIVDPVSNLRL 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289QAEPVWTPPAPAPAAPPSTPAAPKR 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QAQHSLRDSLENTLTESEARY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QAQHSLRDSLENTLTESEARY 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QCM*ITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QCM*ITNVEAQLAEIRA 2 
A0454DSPDesmoplakinIPI00013933QFFEEAQSTEAYLKG 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274QGGVLPNIQAVLLPKK 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037QGGVLPNIQAVLLPKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QHSLRDSLENTLTESEARY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QHSLRDSLENTLTESEARY 3 
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7IPI00030179QIALTDNALIARS 2 
A0454DSPDesmoplakinIPI00013933QIASGGVVDPVNSVFLPKD 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QLAQMQCMITNVEAQLAEIRA 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QLAQMQCMITNVEAQLAEIRA 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QLAQMQCMITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QLAQMQCMITNVEAQLAEIRA 3 
A0454DSPDesmoplakinIPI00013933QLEEEYENLLKA 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715QLSQVQSLITNVESQLAEIRC 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715QLSQVQSLITNVESQLAEIRC 3 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759QLSQVQSLITNVESQLAEIRS 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759QLSQVQSLITNVESQLAEIRS 3 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423QLSQVQSLITNVESQLAEIRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423QLSQVQSLITNVESQLAEIRS 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QM*QCMITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QM*QCMITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QMEELNQQVATSSEQLQNYQSDIIDLRR 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QMEELNQQVATSSEQLQNYQSDIIDLRRT 3 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423QMESLKEELLSLKQ 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QMQCM*ITNVEAQLAEIRA 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QMQCMITNVEAQLAEIRA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QMQCMITNVEAQLAEIRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655QNSKLEAAVAQSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795QNSKLEAAVAQSEQQGEAALSDARC 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QNYQSDIIDLRR 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711QPVGGISTVCQPVGGVSTVCQPACGVSRT 2 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711QPVGGISTVCQPVGGVSTVCQPACGVSRT 3 
A4902KRTAP11-1, KAP11.1, KRTAP11.1Keratin associated protein 11-1IPI00216711QPVGGVSTVCQPACGVSRT 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QQVVSSSEQLQSCQAEIIELRR 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053QRCCQTNIEPIFEGYISALRR 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655QSEQQGEAALSDARC 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795QSEQQGEAALSDARC 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330QSLIDNLEAQLAEIRC 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383QSLIELFESFKS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715QSLITNVESQLAEIRC 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715QSLITNVESQLAEIRC 3 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759QSLITNVESQLAEIRS 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759QSLITNVESQLAEIRS 3 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423QSLITNVESQLAEIRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423QSLITNVESQLAEIRS 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655QSNLEPLFEGYIETLRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655QSNLEPLFEGYIETLRRE 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053QSQISETSVIVKM 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691QSVYTASIEENSDANTLVVKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053QTNIEPIFEGYISALRR 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649QVESLKEELLCLKK 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632QVESLKEELLCLKQ 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759QVESLKEELLCLKS 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692QVESLKEELMCLKK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QVESLKEELMCLKK 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530QVFDNGSIYNPEVLDITEETLHSRF 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540QVLTMTPDYQSHFRT 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RAADTDGDGQVNYEEFVRV 2 
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase AIPI00215638RAAECNIVVTQPRR 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663RAAFQLGSPWRR 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840RAAGAPGASDADGLKPRN 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840RAALDGGVASAASPESKP 2 
A9642RPS2540S ribosomal protein S25IPI00401105RAALQELLSKG 2 
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseIPI00010415;IPI00395748;IPI00219452RAASAFFTYVSLSQEGRS 2 
A5082PKP3Plakophilin 3IPI00026952RAASSLLANLWQYNKL 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248RAAVPSGASTGIYEALELRD 2 
A0396SLC25A5, ANT2ADP/ATP translocase 2IPI00007188RAAYFGIYDTAKG 1 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RADDGLYQCTVANNVGYSVCVVEVKV 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RADLERQNQEYQVLLDVRA 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RADLERQNQEYQVLLDVRA 3 
A7154NEU2Sialidase 2IPI00022482RADLGAYLNPRPPAPEAWSEPVLLA 2 
A7154NEU2Sialidase 2IPI00022482RADLGAYLNPRPPAPEAWSEPVLLAKG 2 
A7154NEU2Sialidase 2IPI00022482RADLGAYLNPRPPAPEAWSEPVLLAKG 3 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237RADM*GGAATICSAIVSAAKL 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RAEAESWYRS 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RAEAESWYRS 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RAEAESWYRS 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RAEDGKTELSLM*RF 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315RAEDGSVIDYELIDQDARD 2 
A0454DSPDesmoplakinIPI00013933RAELIVQPELKY 2 
A7935TARSThreonyl-tRNA synthetase, cytoplasmicIPI00329633RAELNPWPEYIYTRL 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RAEVGDVIVIHLKN 2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536RAFDQDGDGHITVDELRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RAFSCISACGPRP 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RAFVHWYVGEGM*EEG 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RAFVHWYVGEGMEEG 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RAFVHWYVGEGMEEG 2 
A3807RPLP060S acidic ribosomal protein P0IPI00008530RAGAIAPCEVTVPAQNTGLGPEKT 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079RAGDKDDITEPAVCALRH 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079RAGDKDDITEPAVCALRH 3 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292RAGDREDITEPAICALRH 2 
A9636RPS18, D6S218E40S ribosomal protein S18IPI00013296RAGELTEDEVERV 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744RAGLGSGLSLSGLVHPELSRS 2 
A495AH2AFZ, H2AZHistone H2A.zIPI00249267RAGLQFPVGRI 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274RAGLQFPVGRV 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037RAGLQFPVGRV 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RAGSYTSQHSYHSELS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RAGSYTSQHSYHSELSYQ 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RAGSYTSQHSYHSELSYQE 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RAGSYTSQHSYHSELSYQESFH 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RAGSYTSQHSYHSELSYQESFHS 2 
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseIPI00011200RAGTGVDNVDLEAATRK 2 
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aIPI00299573;IPI00479315RAGVNTVTTLVENKK 2 
A4043PPP1CB, PPCS1DSerine/threonine protein phosphatase PP1-beta catalytic subunitIPI00218236;IPI00479703RAHQVVEDGYEFFAKR 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RAIAELGIYPAVDPLDSTSRI 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RAIKPYQTLIKE 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RAILVDLEPGTM*DSVRS 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RAILVDLEPGTMDSVRS 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362RAKFEELNM*DLFRS 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200RAKLDELEGALHQAKE 2 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200RAKLDELEGALHQAKE 3 
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71IPI00061200RAKLDELEGALHQAKEELARM 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RAKLEAAVAEAEQQGEAALS 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RAKLEAAVAEAEQQGEAALSDA 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RAKLEAAVAEAEQQGEAALSDARC 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RAKLEAAVAEAEQQGEAALSDARC 3 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052RAKLEAAVAEAEQQGEATLSDAKC 2 
A3855KRT84, KRTHB4, HB4Keratin, type II cuticular HB4IPI00300052RAKLEAAVAEAEQQGEATLSDAKCK 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RAKYEAELAM*RQ 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RAKYEAELAMRQ 1 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RAKYEAELAMRQ 2 
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richIPI00010740;IPI00216613RALAEIAKAELDDTPM*RG 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461RALAQGPWWARK 2 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571RALDLFSDNAPPPELLEIINEDIAKRT 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RALEHFTDLYDIKR 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744RALEQFATVVEAKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RALGCLGSRSLCNVGFGRP 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RALGCLGSRSLCNVGFGRPRV 2 
A3584FASN, FASFatty acid synthaseIPI00418433RALGLGVEQLPVVFEDVVLHQATILPKT 3 
A7242OTUB2, OTB2, OTU2Ubiquitin thioesterase OTUB2IPI00302895RALGYSYLESLLGKS 2 
A3804EEF2, EF2Elongation factor 2IPI00186290RALLELQLEPEELYQTFQRI 2 
A0454DSPDesmoplakinIPI00013933RALLQAILQTEDM*LKV 2 
A0454DSPDesmoplakinIPI00013933RALLQAILQTEDMLKV 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079RALM*GSPQLVAAVVRT 2 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorIPI00472102RALM*LQGVDLLADAVAVTM*GPKG 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079RALMGSPQLVAAVVRT 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RALNSRGEDLERPLELRV 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079RALPELTKLLNDEDPVVVTKA 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476RALPFWNEEIVPQIKE 2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503RALQATVGNSYKC 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RALTVPELTQQMFDAKN 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RALTVPELTQQMFDSKN 2 
A6203CPT1A, CPT1Carnitine O-palmitoyltransferase I, mitochondrial liver isoformIPI00032038;IPI00479108RAMVDPAQTVEQRL 2 
A4798FAM83H, PP2121Hypothetical proteinIPI00394829RAPAGDLLPSAFRV 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470RAPFDLFENRK 1 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470RAPFDLFENRK 2 
A4445CLIC3Chloride intracellular channel protein 3IPI00000692RAPLEHELAGEPQLRE 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RAPQLLLQTALAHM*HYLPEEPGPGGRD 3 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RAPQLLLQTALAHMHYLPEEPGPGGRD 3 
A5541CRYAB, CRYA2Alpha crystallin B chainIPI00021369RAPSWFDTGLSEM*RL 2 
A5541CRYAB, CRYA2Alpha crystallin B chainIPI00021369RAPSWFDTGLSEMRL 2 
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1IPI00219446RAPVAGTCYQAEWDDYVPKL 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772RAPVILGSPDDVLEFLKV 2 
A1941PLEC1, PLECPlectinIPI00186711RAPVPASELLASGVLSRA 2 
A1941PLEC1, PLECPlectinIPI00186711RAQAEAQQPTFDALRDELRG 2 
A1308BLMHBleomycin hydrolaseIPI00219575RAQHVFQHAVPQEGKPITNQKS 2 
A1308BLMHBleomycin hydrolaseIPI00219575RAQHVFQHAVPQEGKPITNQKS 3 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486RAQVFHICGPEDVCEAYRH 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486RAQVFHICGPEDVCEAYRH 3 
A3839KRT38, HHA8, HKA8Keratin, type I cuticular HA8IPI00297641RAQYEAM*LETNRQ 2 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269RARFEELCSDLFRS 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RARFEELNADLFRG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RARFEELNADLFRG 3 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RARFEELNADLFRG 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RARFEELNADLFRG 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RARLECEINTYRG 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RARLECEINTYRGLLESEDSK 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RARLECEINTYRS 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RARLECEINTYRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RARLECEINTYRS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RARLECEINTYRS 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RARLEGEINTYRS 2 
A207DCRIP2, CRP2Cysteine-rich protein 2IPI00006034RASSVTTFTGEPNTCPRC 2 
A2554RBM14, RBM14-RBM4, SIPRNA-binding protein 14IPI00013174RASYVAPLTAQPATYRA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RATAENEFVALKK 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RATAENEFVALKK 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RATAENEFVALKKD 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RATAENEFVALKKD 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RATAENEFVALKKDVDCAYLRK 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RATAENEFVALKKDVDCAYLRK 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RATAENEFVVLKK 2 
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HIPI00013881;IPI00479484;IPI00479191;IPI00478348;IPI00477925;IPI00477457RATENDIYNFFSPLNPVRV 2 
A2466ENDOU, P11Placental protein 11 precursorIPI00006995RATGHGEHFSAQELAEQDAFLRE 3 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RATSTATSGFAGAIGQKL 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RAVCM*LSNTTAIAEAWARL 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RAVCM*LSNTTAIAEAWARL 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RAVCMLSNTTAIAEAWARL 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RAVCMLSNTTAIAEAWARL 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RAVFPSIVGRPRH 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006RAVFPSIVGRPRH 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RAVFVDLEPTVIDEVRT 2 
A472CSEC24CProtein transport protein Sec24CIPI00024661RAVITSLLDQIPEM*FADTRE 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RAVLVDLEPGTMDSVRS 2 
A0454DSPDesmoplakinIPI00013933RAVTGYNDPETGNIISLFQAM*NKE 2 
A0454DSPDesmoplakinIPI00013933RAVTGYNDPETGNIISLFQAM*NKELIEKG 3 
A0454DSPDesmoplakinIPI00013933RAVTGYNDPETGNIISLFQAMNKE 2 
A0454DSPDesmoplakinIPI00013933RAVTGYNDPETGNIISLFQAMNKE 3 
A0454DSPDesmoplakinIPI00013933RAVTGYNDPETGNIISLFQAMNKELIEKG 3 
A3812RPL860S ribosomal protein L8IPI00012772RAVVGVVAGGGRI 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RAYALAFAERG 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289RAYLESEVAISEELVQKY 2 
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorIPI00298237RAYPDVAALSDGYWVVSNRV 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RAYRPAAAFLRT 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RCCESNLEPLFSGYIETLRR 2 
A4929KRTAP4-9, KAP4.9, KRTAP4.9Keratin associated protein 4-9IPI00105153RCCISSCCRPSCCVSSC 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RCCITAAPYRG 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RCCITAAPYRG 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCCQTNIEPIFEGYISALRR 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCCQTNIEPIFEGYISALRR 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCCQTNIEPIFEGYISALRRQ 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCCQTNIEPIFEGYISALRRQ 3 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RCDSDILPLRN 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCGGTLPGFGYRL 2 
A5453S100A11, MLN70, S100CCalgizzarinIPI00013895RCIESLIAVFQKY 2 
A0454DSPDesmoplakinIPI00013933RCIKDEETGLCLLPLKE 2 
A0454DSPDesmoplakinIPI00013933RCIKDEETGLCLLPLKEKK 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RCKLAELEGALQKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RCKLAELEGALQKA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RCKLAELEGALQKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCKLEGAIAEAEQQGEAALND 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCKLEGAIAEAEQQGEAALNDAKC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RCKLEGAIAEAEQQGEAALNDAKC 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RCPEALFQPSFLGMESCGIHETTFNSIMKC 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RCQLGDRLNIEVDAAPPVDLTRV 3 
A4903KRTAP12-1, KAP12.1, KRTAP12.1Keratin associated protein KAP12-1IPI00375324RCQSSVCVPVSCRP 2 
A4903KRTAP12-1, KAP12.1, KRTAP12.1Keratin associated protein KAP12-1IPI00375324RCQSSVCVPVSCRPVVYA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RCQYEAM*VEANRR 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RCQYEAM*VEANRRD 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RCQYEAMVEANRRD 2 
A3584FASN, FASFatty acid synthaseIPI00418433RCVLLSNLSSTSHVPEVDPGSAELQKV 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RDALESTLAETEARY 2 
A0537ANXA2, ANX2, ANX2L4Annexin A2IPI00455315RDALNIETAIKT 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896RDETNYGIPQRA 2 
A6477FBP1, FBPFructose-1,6-bisphosphatase 1IPI00073772RDFDPAVTEYIQRK 2 
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat1IPI00328343;IPI00465348RDFLLKPELLRA 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301RDFTPVCTTELGRA 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RDGFNPADVEAGLYG 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RDGFNPADVEAGLYGSHLY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RDGFNPADVEAGLYGSHLYV 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RDGFNPADVEAGLYGSHLYVWDWQRH 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RDGFNPADVEAGLYGSHLYVWDWQRH 3 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RDIILDNPTLTLEVLNEARV 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RDIILDNPTLTLEVLNEARV 3 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928RDLDEGPECTPAAQYVRI 2 
A0454DSPDesmoplakinIPI00013933RDLIDFDDRQQIYAAEKA 2 
A0454DSPDesmoplakinIPI00013933RDLKDEIVRL 2 
A0454DSPDesmoplakinIPI00013933RDLKDEIVRLNDSILQATEQRR 3 
A317DECHDC1Enoyl coenzyme A hydratase domain containing 1IPI00479537RDLLGTVWGGPANLEAIAKK 2 
A5082PKP3Plakophilin 3IPI00026952RDLLYFDGLRKL 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RDLNM*DCIIAEIKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RDLNM*DCIIAEIKA 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RDLNMDCIIAEIKA 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RDLNMDCIIAEIKA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RDLNMDCMVAEIKA 2 
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseIPI00011200RDLPLLLFRT 2 
A8404CST6Cystatin M precursorIPI00019954RDLSPDDPQVQKA 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RDLSPTAPCPAAATASLLASISRI 2 
A7154NEU2Sialidase 2IPI00022482RDLTDAAIGPAYRE 1 
A7154NEU2Sialidase 2IPI00022482RDLTDAAIGPAYRE 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RDLTDYLM*KI 1 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RDLTDYLM*KI 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269RDLTDYLM*KI 1 
A4549ACTBL2Beta-actin-like protein 2IPI00003269RDLTDYLM*KI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006RDLTDYLM*KI 1 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006RDLTDYLM*KI 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RDLTDYLMKI 1 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RDLTDYLMKI 2 
A4549ACTBL2Beta-actin-like protein 2IPI00003269RDLTDYLMKI 1 
A4549ACTBL2Beta-actin-like protein 2IPI00003269RDLTDYLMKI 2 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006RDLTDYLMKI 1 
A4555ACTA1, ACTAActin, alpha skeletal muscleIPI00021428;IPI00023006RDLTDYLMKI 2 
A279ES100A14, S100A15Protein S100-A14IPI00010214RDLVTQQLPHLMPSNCGLEEKI 3 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDM*M*SEIDRDGNGTVDFPEFLG 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDM*M*SEIDRDGNGTVDFPEFLGM*M 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDM*M*SEIDRDGNGTVDFPEFLGM*M*A 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDM*M*SEIDRDGNGTVDFPEFLGMM 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDM*M*SEIDRDGNGTVDFPEFLGMMARK 3 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RDMMSEIDRDGNGTVDFPEFLGMM 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RDNAELENLIRE 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RDNAELENLIRE 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RDNAELENLIRE 1 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RDNAELENLIRE 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RDNIQGITKPAI 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RDNIQGITKPAIRR 2 
A3584FASN, FASFatty acid synthaseIPI00418433RDNLEFFLAGIGRL 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890RDNLTLWTADNAGEEG 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229RDPDAQPGGELM*LGGTDSKY 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229RDPDAQPGGELMLGGTDSKY 2 
A0098VCLVinculinIPI00291175RDPSASPGDAGEQAIRQ 2 
A2479ARSFArylsulfatase F precursorIPI00479599RDPSESTPLTPATEPLHDFVIKK 2 
A2479ARSFArylsulfatase F precursorIPI00479599RDPSESTPLTPATEPLHDFVIKK 3 
A5971CAPN12Calpain 12IPI00418873RDPYFPAGPDALGYDQLGPDSEKA 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RDQEGQDVLLFIDNIFRF 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486RDRSVSGLDSFGNLEVSPPVVANGKE 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RDSLALFPHM*ATTAFM*QPDHAGIFRV 3 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RDSLALFPHMATTAFM*QPDHAGIFRV 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHY 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQ 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQL 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQLS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQLSQ 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQLSQVQS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RDSLENTLTESEAHYSSQLSQVQSLI 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RDSLENTLTESEARY 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RDSLENTLTESEARY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RDSLENTLTESEARY 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RDSQECILTETEARY 2 
A0454DSPDesmoplakinIPI00013933RDSQKNFVDPVTKK 2 
A0318CDH1, CDHE, UVOEpithelial-cadherin precursorIPI00000513RDTANWLEINPDTGAISTRA 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729RDVKPDNFLM*GLGK 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729RDVKPDNFLMGLGKK 2 
A2492LMNB2, LMN2Lamin B2IPI00009771RDVMQQQLAEYQELLDVKL 2 
A6332LKP, DHX9, DDX9ATP-dependent RNA helicase AIPI00215638RDVVQAYPEVRI 2 
A8804GDI2, RABGDIBRab GDP dissociation inhibitor betaIPI00031461RDWNVDLIPKF 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RDYADADINM*AFLDSYFSEKA 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RDYADADINM*AFLDSYFSEKA 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RDYADADINMAFLDSYFSEKA 2 
A1668RPS1040S ribosomal protein S10IPI00008438;IPI00478810;IPI00414852RDYLHLPPEIVPATLRR 2 
A3788SND1, TDRD11Staphylococcal nuclease domain containing protein 1IPI00140420READGSETPEPFAAEAKF 2 
A5282CALML5, CLSPCalmodulin-like protein 5IPI00021536READVDQDGRVNYEEFARM 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541REAECVEADSGRL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655REAECVEADSGRL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795REAECVEADSGRL 2 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079REAMCPGVSGEDSSLLLATQVEGQATNLQRL 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorIPI00440493;IPI00471928REAYPGDVFYLHSRL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RECCQSNLEPLFEGYIETLR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RECCQSNLEPLFEGYIETLRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RECCQSNLEPLFEGYIETLRR 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RECCQSNLEPLFEGYIETLRRE 3 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461REEAAGPALALSLIERY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719REEIVYLPCIYRN 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719REEIVYLPCIYRNTGTEAPDYLATVDVDPKS 3 
A9648RPS2840S ribosomal protein S28IPI00012751REGDVLTLLESERE 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376REGDVQLNFDM*PFIFAEVNADRI 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691REGIKGSSLLNYVLGTYTAIDLDTGNPATDVRY 3 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292REGLLAIFKS 1 
A0324JUP, CTNNG, DP3Junction plakoglobinIPI00420079REGLLAIFKS 1 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691REGPAFHPSTMAFS 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691REGPAFHPSTMAFSVRE 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719REGSVMLQVDVDTVKG 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724REHALLAYTLGVKQ 1 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724REHALLAYTLGVKQ 2 
A7968TGM1, KTGProtein-glutamine gamma-glutamyltransferase KIPI00305622REHHTDEYEYDELIVRR 3 
A1308BLMHBleomycin hydrolaseIPI00219575REHVKPLFNMEDKI 2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00219038REIAQDFKTDLRF 2 
A4043PPP1CB, PPCS1DSerine/threonine protein phosphatase PP1-beta catalytic subunitIPI00218236;IPI00479703REIFLSQPILLELEAPLKI 2 
A7933SARS, SERSSeryl-tRNA synthetase, cytoplasmicIPI00220637REIGNLLHPSVPISNDEDVDNKVERI 3 
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalIPI00477729;IPI00296907REIGTHKPLPGITVGDIGPKF 2 
A0454DSPDesmoplakinIPI00013933REIMWINDCEEEELLYDWSDKNTNIAQKQ 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691REITPLFLIYCRA 2 
A0901SFN, HME114-3-3 protein sigmaIPI00013890REKVETELQGVCDTVLGLLDSHLIKE 3 
A3816RPS340S ribosomal protein S3IPI00011253RELAEDGYSGVEVRV 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301RELAILLGM*LDPAEKDEKG 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301RELAILLGMLDPAEKDEKG 2 
A397EPrLZ, TPD52, PC-1Prostate and colon associated proteinIPI00218323RELAKVEEEIQTLSQVLAAKE 2 
A397EPrLZ, TPD52, PC-1Prostate and colon associated proteinIPI00218323RELAKVEEEIQTLSQVLAAKE 3 
A0454DSPDesmoplakinIPI00013933RELDECFAQANDQM*EILDSLIRE 2 
A0454DSPDesmoplakinIPI00013933RELDECFAQANDQMEILDSLIRE 2 
A8480RNH1, RNH, PRIPlacental ribonuclease inhibitorIPI00465081RELDLSNNCLGDAGILQLVESVRQ 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RELDVDGIIAEIKA 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RELDVDGIIAEIKA 2 
A452BFAM26D, UNQ6481/PRO21277, UNQ6481Family with sequence similarity 26, member DIPI00065530RELFEQAAEQHSRL 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486RELGLAECDIIDIPQLFKT 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RELISNASDALDKI 1 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RELISNASDALDKI 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230RELISNASDALDKI 1 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230RELISNASDALDKI 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230RELISNASDALDKIRL 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RELISNASDALDKIRY 2 
A1298PGLS6-phosphogluconolactonaseIPI00029997RELPAAVAPAGPASLARW 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RELQELVQYPVEHPDKF 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorIPI00025252RELSDFISYLQRE 2 
A3548P5, PDIA6, ERP5Protein disulfide isomerase A6 precursorIPI00299571RELSFGRGSTAPVGGGAFPTIVERE 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RELSLHTNALQDLDGNVFRM 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RELSLHTNALQDLDGNVFRM 3 
A7933SARS, SERSSeryl-tRNA synthetase, cytoplasmicIPI00220637RELVSCSNCTDYQARR 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RELWLYDNHISSLPDNVFSNLRQ 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RELWLYDNHISSLPDNVFSNLRQ 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RENVFLSYQDKR 1 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RENVFLSYQDKR 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RENVFLSYQDKRI 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691REQHSMYNLVVRG 2 
A4960MAP7, E-MAP-115, EMAP115EnsconsinIPI00020771;IPI00478245;IPI00022628RERENVLFLTSGTRR 2 
A1941PLEC1, PLECPlectinIPI00186711RESADPLGAWLQDARR 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RESHGGSVLQDGWDHRG 3 
A9531PCBP1Poly(rC)-binding protein 1IPI00016610RESTGAQVQVAGDM*LPNSTERA 2 
A9532PCBP2Poly(rC)-binding protein 2IPI00012066;IPI00470509;IPI00216689RESTGAQVQVAGDM*LPNSTERA 2 
A9531PCBP1Poly(rC)-binding protein 1IPI00016610RESTGAQVQVAGDMLPNSTERA 2 
A9532PCBP2Poly(rC)-binding protein 2IPI00012066;IPI00470509;IPI00216689RESTGAQVQVAGDMLPNSTERA 2 
A472CSEC24CProtein transport protein Sec24CIPI00024661RETETVFVPVIQAGMEALKA 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237RETLNISGPPLKA 1 
A5073PPLPeriplakinIPI00298057RETPLKPIPVEALCDFEGEQGLISRG 3 
A0454DSPDesmoplakinIPI00013933RETQTECEWTVDTSKL 2 
A3804EEF2, EF2Elongation factor 2IPI00186290RETVSEESNVLCLSKS 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RETVVEVPQVTWEDIGGLEDVKR 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RETVVEVPQVTWEDIGGLEDVKRE 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632REVEQWFATQT 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423REVEQWFATQT 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715REVEQWFATQT 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632REVEQWFATQTEELNKQ 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632REVEQWFATQTEELNKQ 3 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423REVEQWFATQTEELNKQ 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423REVEQWFATQTEELNKQ 3 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715REVEQWFATQTEELNKQ 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715REVEQWFATQTEELNKQ 3 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759REVEQWFTTQTEELNKQ 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528REVVDPEVFFNATGCLRK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655REYQEVMNSKL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795REYQEVMNSKL 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031REYTDGEFVEIKA 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RFAAFIDKV 1 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RFAAFIDKV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RFAAFIDKV 1 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RFAAFIDKV 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RFAAFIDKV 1 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RFAAFIDKV 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RFAAFIDKVRF 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RFAAFIDKVRF 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RFAAFIDKVRF 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RFAASDPSQYDASI 1 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RFAASDPSQYDASI 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RFAASDPSQYDASINL 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RFAASDPSQYDASINLM*NLQV 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RFAASDPSQYDASINLMNLQV 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596RFACHSASLTVRN 2 
A314CRAB1A, RAB1Ras-related protein Rab-1AIPI00005719RFADDTYTESYISTIGVDFKI 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RFAKPVYPGQTLQTEM*WKE 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RFAKPVYPGQTLQTEMWKE 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RFAKPVYPGQTLQTEMWKE 3 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RFAPVPEGGEGVM*QSWRI 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RFAPVPEGGEGVMQSWRI 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596RFAQPGSFEYEYAM*RW 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596RFAQPGSFEYEYAMRW 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RFASFINKV 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RFASFINKV 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RFASFINKVRF 2 
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richIPI00010740;IPI00216613RFATHAAALSVRN 2 
A4036CSNK1E, CK1ECasein kinase I, epsilon isoformIPI00027729RFDDKPDYSYLRQ 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RFDGALNVDLTEFQTNLVPYPRI 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144RFDGALNVDLTEFQTNLVPYPRI 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RFDGALNVDLTEFQTNLVPYPRI 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RFDILPSRS 2 
A0454DSPDesmoplakinIPI00013933RFDQQKNDYDQLQKA 2 
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1IPI00304925;IPI00477309RFEELCSDLFRS 1 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RFEELNADLFRG 1 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RFEELNADLFRG 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RFEELNADLFRG 1 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RFEELNADLFRG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RFEELNADLFRGTLDPVEKA 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744RFFEEVNDPAKNDALEM*VEETTWQGLKE 3 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorIPI00028031;IPI00178744RFFEEVNDPAKNDALEMVEETTWQGLKE 3 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503RFFLQGIQLNTILPDARD 2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503RFFLQGIQLNTILPDARDP 2 
A1327LAMP1Lysosome-associated membrane glycoprotein 1 precursorIPI00004503RFFLQGIQLNTILPDARDPAFKA 3 
A3816RPS340S ribosomal protein S3IPI00011253RFGFPEGSVELYAEKV 2 
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicIPI00456969;IPI00477531RFGNPLLVQDVESYDPVLNPVLNRE 2 
A3839KRT38, HHA8, HKA8Keratin, type I cuticular HA8IPI00297641RFGTELAQM*QSLISNVEEQLSEIRA 2 
A3839KRT38, HHA8, HKA8Keratin, type I cuticular HA8IPI00297641RFGTELAQMQSLISNVEEQLSEIRA 2 
A0432PRDX6, AOP2Peroxiredoxin 6IPI00220301RFHDFLGDSWGILFSHPRD 3 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RFHVNLLCGEEQG 2 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RFHVNLLCGEEQGSDAA 2 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RFHVNLLCGEEQGSDAALHFNPRL 2 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RFHVNLLCGEEQGSDAALHFNPRL 3 
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HIPI00013881;IPI00479484;IPI00479191;IPI00478348;IPI00477925;IPI00477457RFIYTREGRPSGEAFV 2 
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7IPI00030179RFKEANNFLWPFKL 2 
A0454DSPDesmoplakinIPI00013933RFLEFQYLTGGLVDP 2 
A0454DSPDesmoplakinIPI00013933RFLEFQYLTGGLVDPEVHGRI 2 
A0454DSPDesmoplakinIPI00013933RFLEFQYLTGGLVDPEVHGRI 3 
A1941PLEC1, PLECPlectinIPI00186711RFLEVQYLTGGLIEPDTPGRV 2 
A1941PLEC1, PLECPlectinIPI00186711RFLEVQYLTGGLIEPDTPGRVPLDEALQRG 3 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLHNPDAAQGFVGC 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLHNPDAAQGFVGCA 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLHNPDAAQGFVGCALS 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLHNPDAAQGFVGCALSSTIQRF 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLHNPDAAQGFVGCALSSTIQRF 3 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175RFLIATGERPRY 2 
A0454DSPDesmoplakinIPI00013933RFLNEQKNLHSEISGKR 2 
A7422PLCD11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1IPI00016461RFLVEDYDASSKNDFIGQSTIPLNSLKQ 3 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFLYFSNWLHGDLRQ 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RFPGQLNADLRK 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RFPGQLNADLRK 2 
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AIPI00219038RFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 3 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230RFQSSHHPTDITSLDQYVERM 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorIPI00027230RFQSSHHPTDITSLDQYVERM 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RFQSVPAQPGQTSPLLQYFGILLDQGQLNKY 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RFRCPEALFQPSFLGM*ESC 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RFRCPEALFQPSFLGMESC 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476RFSGWYDADLSPAGHEEAKR 2 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476RFSGWYDADLSPAGHEEAKR 3 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RFSLDDCSWYGEGINSNEKETM*QILNERL 3 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RFSLDDCSWYGEGINSNEKETMQILNERL 3 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorIPI00007611RFSPLTTNLINLLAENGRL 2 
A0124GNB2L1, HLC7, PIG21Guanine nucleotide-binding protein beta subunit-like protein 12.3IPI00013896RFSPNSSNPIIVSCGWDKL 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528RFSSYSQM*ENWSRH 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528RFSSYSQMENWSRH 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RFTDGTYSIEIPKPPWLGFLGPILRA 3 
A9948IL1F10, FIL1T, IL1HY2Interleukin 1 family member 10IPI00103482RFTFFQSSSGSAFRL 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RFTQAGSEVSALLGRI 2 
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicIPI00456969;IPI00477531RFTQDTQPHYIYSPRE 2 
A9834CHAC1, BOTCHCation transport regulator-like protein 1IPI00012214RFWQGDTFHRG 2 
A5824AKR7A2, AFAR, AFAR1Aflatoxin B1 aldehyde reductase 1IPI00305978RFYAYNPLAGGLLTGKY 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RFYKNEGGTWSVEKV 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGAFGYGNGGGVGGGAC 1 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGAFGYGNGGGVGGGAC 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGAFGYGNGGGVGGGACGDLASEIRE 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGAFGYGNGGGVGGGACGDLASEIREDAVAPGCKA 3 
A0454DSPDesmoplakinIPI00013933RGAGSIAGASASPKE 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018RGALQNIIPASTGAAK 1 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseIPI00219018RGALQNIIPASTGAAKA 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840RGAPGSPTQERPAGGLGEAPNGAPSVCAEEGSLGPRN 3 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186RGDLGIEIPAEKV 2 
A7241OTUB1, OTB1, OTU1Ubiquitin thiolesterase protein OTUB1IPI00409750;IPI00000581RGEGGTTNPHIFPEGSEPKV 2 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorIPI00007611RGEVPCTVTSASPLEEATLSELKT 2 
A1035HNRPA1, HNRNPA1Heterogeneous nuclear ribonucleoprotein A1IPI00176590;IPI00465365;IPI00411329;IPI00399203;IPI00215965;IPI00176692RGFAFVTFDDHDSVDKT 2 
A1137HNRNPD, AUF1, HNRPDHeterogeneous nuclear ribonucleoprotein D0IPI00028888RGFCFITFKEEEPVKKI 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RGFEVVYM*TEPIDEYCVQQLKE 2 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1IPI00396378;IPI00477522;IPI00414696RGFGFVTFDDHDPVDKI 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491RGFKDQIYDIFQKL 2 
A0367RPL13, BBC160S ribosomal protein L13IPI00465361RGFSLEELRV 2 
A1136HNRNPA2B1, HNRPA2B1Heterogeneous nuclear ribonucleoproteins A2/B1IPI00396378;IPI00477522;IPI00414696RGGGGNFGPGPGSNFRG 2 
A7793PGDH3, PHGDHD-3-phosphoglycerate dehydrogenaseIPI00011200RGGIVDEGALLRA 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812RGGVQVPAVDISSSLGGRP 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RGGVSCGGLSYSTTPGRQ 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RGGVVCGDLCASTTAPVVSTRV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RGGVVCGDLCASTTAPVVSTRV 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RGGVVCGDLCVSGSRP 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RGGWELPHAYKR 2 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008;IPI00289800RGGYFDEFGIIRG 2 
A7154NEU2Sialidase 2IPI00022482RGHFVAQDTLECQVAEVETGEQRV 2 
A3804EEF2, EF2Elongation factor 2IPI00186290RGHVFEESQVAGTPM*FVVKA 3 
A6721HEXB, HCC7Beta-hexosaminidase beta chain precursorIPI00012585RGIAAQPLYAGYCNHENM 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491RGIDVQQVSLVINYDLPTNRE 2 
A0454DSPDesmoplakinIPI00013933RGIHNSIGDYRW 2 
A0454DSPDesmoplakinIPI00013933RGIVDSITGQRL 2 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812RGIVNGAAPELPVPTGGPAVGARE 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840RGIWVAYEKPGFTGHQYLLEEGEYRD 3 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491RGIYAYGFEKPSAIQQRA 2 
A3816RPS340S ribosomal protein S3IPI00011253RGLCAIAQAESLRY 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RGLLESEDSKLPCNP 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RGLLESEDSKLPCNPCAPDYSPSKS 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RGLLESEDSKLPCNPCAPDYSPSKS 3 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292RGLNTIPLFVQLLYSPIENIQRV 2 
A551AHNRPH1, HNRNPH1, HNRPHHeterogeneous nuclear ribonucleoprotein HIPI00013881;IPI00479484;IPI00479191;IPI00478348;IPI00477925;IPI00477457RGLPWSCSADEVQRF 2 
A780BALD, ABCD1, ALDPAdrenoleukodystrophy proteinIPI00291373RGLQAPAGEPTQEASGVAAAKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RGLRALGCLGSRS 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RGLTGFGSRSLCNLGSCGPRI 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RGLTGGFGSHSVCGGFRA 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RGLTGGFGSHSVCGGFRA 2 
A0454DSPDesmoplakinIPI00013933RGLVGIEFKE 1 
A0454DSPDesmoplakinIPI00013933RGLVGIEFKE 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RGM*GQIYEVSSCDNRD 2 
A028CHEPHL1Hephaestin-like protein 1IPI00261031RGMGQIYEVSSCDNRDP 2 
A639ALGALS3, MAC2, GALIGGalectin-3IPI00465431RGNDVAFHFNPRF 2 
A6087CNDP2, CN2, CPGLCytosolic nonspecific dipeptidaseIPI00165579;IPI00386314;IPI00177728RGNILIPGINEAVAAVTEEEHK 2 
A166ATOLLIPToll-interacting proteinIPI00100154RGNKDAAINSLLQMGEEP 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248RGNPTVEVDLFTSKG 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289RGPLPAAPPVAPERQ 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RGPSTPGVLSNCTSPLPEAFLANLFVHPLLPPRD 3 
A166ATOLLIPToll-interacting proteinIPI00100154RGPVYIGELPQDFLRI 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875RGQELAFPLSPDWQVDYESYTWRK 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RGQFSTDELVAEVEKR 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RGQFSTDELVAEVEKRN 2 
A3862KRT80, KB20Keratin B20IPI00431749RGQLEANLLQVLEKV 2 
A3862KRT80, KB20Keratin B20IPI00431749RGQLEANLLQVLEKVEEFRI 2 
A3862KRT80, KB20Keratin B20IPI00431749RGQLEANLLQVLEKVEEFRI 3 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RGQPFEVLIIASDDGFKA 2 
A0454DSPDesmoplakinIPI00013933RGRSEADSDKNATILELRS 2 
A0454DSPDesmoplakinIPI00013933RGRSEADSDKNATILELRS 3 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RGSEM*FAEM*DLRA 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RGSEM*FAEMDLRA 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RGSEMFAEM*DLRA 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RGSEMFAEMDLRA 2 
A6962ME1NADP-dependent malic enzymeIPI00008215RGSEYDDFLDEFMEAVSSKY 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528RGSM*YDGLADNYNYGTTSRS 2 
A1012PKP1Plakophilin 1IPI00071509;IPI00218528RGSMYDGLADNYNYGTTSRS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGSRVTHLLGYPTQNVSRS 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RGSRVTHLLGYPTQNVSRSLRR 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00013485;IPI00479366;IPI00455532;IPI00165486RGTGIVSAPVPKK 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928RGVDKEPLNLFYIERD 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928RGVDKEPLNLFYIERD 3 
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorIPI00014230RGVDNTFADELVELSTALEHQ 2 
A801DPITHD1, AD039, HT014UPF0424 protein C1ORF128IPI00015351RGVFKPWEERT 2 
A5082PKP3Plakophilin 3IPI00026952RGVGGAVPGAVLEPVARA 2 
A6422ENGASECytosolic endo-beta-N-acetylglucosaminidaseIPI00168838RGVIPPEVGNVAVRL 2 
A0454DSPDesmoplakinIPI00013933RGVITDQNSDGYCQTGTM*SRH 2 
A0454DSPDesmoplakinIPI00013933RGVITDQNSDGYCQTGTMSRH 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RGVLKVFLENVIRD 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RGVSCYRGLTGFGSRS 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470RGVVDSEDLPLNISREM*LQQSKI 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RGVVDSEDLPLNISREM*LQQSKI 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470RGVVDSEDLPLNISREMLQQSKI 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaIPI00382470RGVVDSEDLPLNISREMLQQSKI 3 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RGVVDSEDLPLNISREMLQQSKI 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1IPI00414676;IPI00334775RGVVDSEDLPLNISREMLQQSKI 3 
A3803EEF1D, EF1DElongation factor 1-deltaIPI00023048;IPI00305969RGVVQELQQAISKL 1 
A3803EEF1D, EF1DElongation factor 1-deltaIPI00023048;IPI00305969RGVVQELQQAISKL 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663RGYFIQPTVFGDVQDGM*TIAKE 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663RGYFIQPTVFGDVQDGMTIAKE 2 
A0454DSPDesmoplakinIPI00013933RGYFNEELSEILSDPSDDTKG 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RGYSFTTTAERE 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RHCVDPAVIAAIISRE 2 
A6930LYG2, LYGHLysozyme G-like protein 2 precursorIPI00328398RHCVDPAVIAAIISRE 3 
A4043PPP1CB, PPCS1DSerine/threonine protein phosphatase PP1-beta catalytic subunitIPI00218236;IPI00479703RHDLDLICRA 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RHEIVQTLSLKD 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RHEIVQTLSLKDGLIPLEIRF 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RHEIVQTLSLKDGLIPLEIRF 3 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RHFNELPHELRA 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RHFNELPHELRA 3 
A7363PGAM1, PGAMAPhosphoglycerate mutase 1IPI00385244;IPI00453476RHGESAWNLENRF 2 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00465248RHIADLAGNSEVILPVPAFNVINGGSHAGNKL 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096RHILLAVANDEELNQLLKG 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845RHIPLTSIDLCPTS 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845RHIPLTSIDLCPTSVS 2 
A4910KRTAP26-1, KAP26.1Keratin-associated protein 26-1IPI00397845RHIPLTSIDLCPTSVSC 2 
A1941PLEC1, PLECPlectinIPI00186711RHISDLYEDLRD 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274RHLQLAIRN 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037RHLQLAIRN 2 
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oIPI00216457;IPI00339274RHLQLAIRNDEELNKL 2 
A493AH2AFX, H2AXHistone H2A.xIPI00219037RHLQLAIRNDEELNKL 2 
A8499HUR 7, SERPINB13, PI13HurpinIPI00006560;IPI00220494RHNESNSILFFGRF 2yy 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RHNVM*ISTEWAAPNVLRD 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RHNVMISTEWAAPNVLRD 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289RHQAQIDHYLGLANKN 2 
A0454DSPDesmoplakinIPI00013933RHQNQNTIQELLQNCSDCLM*RA 3 
A4798FAM83H, PP2121Hypothetical proteinIPI00394829RHSFATEGAGAVENFAAARQ 2 
A4798FAM83H, PP2121Hypothetical proteinIPI00394829RHSFATEGAGAVENFAAARQ 3 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RHSSLAGCQIINYRT 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028RHVFGESDELIGQKV 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorIPI00029133RHYLFDVQRN 2 
A8871LAMTOR1, PDRO, PP7157RHOA activator C11ORF59IPI00016670RIAAYAYSALSQIRV 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234RIAGEASRLAHYNKR 2 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785RIAGEASRLAHYNKR 2 
A1668RPS1040S ribosomal protein S10IPI00008438;IPI00478810;IPI00414852RIAIYELLFKE 2 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RIAQDPSSVSPGGTGGQKL 2 
A3803EEF1D, EF1DElongation factor 1-deltaIPI00023048;IPI00305969RIASLEVENQSLRG 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RIAVGGFRAGSCGRS 2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243;IPI00478097RIAVSKPSGPQPQADL 2 
A7428PLD3, HU-K4Phospholipase D3IPI00328243;IPI00478097RIAVSKPSGPQPQADLQALLQSGAQVRM 3 
A166ATOLLIPToll-interacting proteinIPI00100154RIAWTHITIPESLRQ 2 
A0454DSPDesmoplakinIPI00013933RIDKQIDFRL 2 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RIDSLSAQLSQLQKQ 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RIDVVVNNAGILRD 2 
A5817APRTAdenine phosphoribosyltransferaseIPI00218693RIDYIAGLDSRG 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14IPI00026271RIEDVTPIPSDSTRR 2 
A9631RPS14, PRO2640, EMTB40S ribosomal protein S14IPI00026271RIEDVTPIPSDSTRRK 2 
A3808RPL4, RPL160S ribosomal protein L4IPI00003918;IPI00471915RIEEVPELPLVVEDKV 2 
A1246UBE2L3, UBCE7, UBCH7Ubiquitin-conjugating enzyme E2 L3IPI00021347RIEINFPAEYPFKPPKI 2 
A1246UBE2L3, UBCE7, UBCH7Ubiquitin-conjugating enzyme E2 L3IPI00021347RIEINFPAEYPFKPPKI 3 
A0454DSPDesmoplakinIPI00013933RIEPHTGLLLLSVQKR 2 
A0454DSPDesmoplakinIPI00013933RIEPHTGLLLLSVQKRS 2 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008;IPI00289800RIFGPIWNRD 2 
A6548G6PDGlucose-6-phosphate 1-dehydrogenaseIPI00216008;IPI00289800RIFTPLLHQIELEKPKPIPYI 3 
A3615ENO1, ENO1L1, MBPB1Alpha enolaseIPI00013769RIGAEVYHNLKN 2 
A8128USP5, ISOTUbiquitin carboxyl-terminal hydrolase 5IPI00024664RIGEWELIQESGVPLKPLFGPGYTGIRN 3 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RIHFPLATYAPVISAEKA 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RIHFPLATYAPVISAEKA 3 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144RIHFPLATYAPVISAEKA 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RIHFPLATYAPVISAEKA 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RIINEPTAAAIAYGLDKK 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RIINEPTAAAIAYGLDKK 3 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RIINEPTAAAIAYGLDKK 2 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RIINEPTAAAIAYGLDKK 3 
A2006HSPA2Heat shock-related 70 kDa protein 2IPI00007702RIINEPTAAAIAYGLDKKG 2 
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinIPI00003865RIINEPTAAAIAYGLDKKV 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362RIINEPTAAAIAYGLDKR 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362RIINEPTAAAIAYGLDKR 3 
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6IPI00339269RIINEPTAAAIAYGLDRR 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514RIINKPTAAAIAYG 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00258514RIINKPTAAAIAYGLDKR 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AIPI00419585RIIPGFMCQGGDFTRH 2 
A9532PCBP2Poly(rC)-binding protein 2IPI00012066;IPI00470509;IPI00216689RIITLAGPTNAIFKA 2 
A9531PCBP1Poly(rC)-binding protein 1IPI00016610RIITLTGPTNAIFKA 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028RIIYGGSVTGATCKE 2 
A0454DSPDesmoplakinIPI00013933RIKDFLQGSSCIAGIYNETTKQ 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RIKVLDVNDNFPTLEKT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RILDDLTLCKA 1 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RILDDLTLCKA 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RILDDLTLCKADLEAQVESLKEELM*CLKK 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RILDDLTLCKS 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RILDDLTLCKS 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692RILDELTLCKA 1 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692RILDELTLCKA 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RILDELTLCKS 1 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RILDELTLCKS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RILDELTLCKS 1 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RILDELTLCKS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RILDELTLCKSDLESQVESLREELICLKK 3 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RILDELTLCRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RILDELTLCRS 1 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RILDELTLCRS 2 
A6203CPT1A, CPT1Carnitine O-palmitoyltransferase I, mitochondrial liver isoformIPI00032038;IPI00479108RILDNTSEPQPGEARL 2 
A1013DSC1, CDHF1Desmocollin 1A/1B precursorIPI00007425;IPI00386975;IPI00216099RILEDGSIYTTHDLILSSERK 2 
A1013DSC1, CDHF1Desmocollin 1A/1B precursorIPI00007425;IPI00386975;IPI00216099RILEDGSIYTTHDLILSSERK 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorIPI00440493;IPI00471928RILGADTSVDLEETGRV 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875RILGLLDAYLKT 2 
A7275PADI3, PDI3Protein-arginine deiminase type IIIIPI00008486RILIGGNLPGSSGRR 2 
A8502SERPINB5, PI5Maspin precursorIPI00472082RILQHKDELNADHPFIYIIRH 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RILQSHISDTSVVVKL 2 
A6398BAT1, DDX39B, UAP56Spliceosome RNA helicase Bat1IPI00328343;IPI00465348RILVATNLFGRG 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIM*DPNIVGSEHYDVARG 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RIM*NTFSVMPSPKV 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RIM*NTFSVVPSPKV 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIM*NVIGEPIDERG 2 
A5918ACOT7, BACHCytosolic acyl coenzyme A thioester hydrolaseIPI00010415;IPI00395748;IPI00219452RIM*RPDDANVAGNVHGGTILKM 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIMDPNIVGSEHYDVARG 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RIMNTFSVMPSPKV 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RIMNTFSVVPSPKV 2 
A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomalIPI00477729;IPI00296907RINEGIGQGDLSELPELHALTAGLKA 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RINGDGQEVLYLAEGDNVRL 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RINGDGQEVLYLAEGDNVRL 3 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RINHGSLPHLQQRV 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RINHGSLPHLQQRV 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RINVYYNEAAGNKY 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RINVYYNEAAGNKYVPRA 2 
A7154NEU2Sialidase 2IPI00022482RIPALLYLPGQQSLLAFAEQRA 2 
A7154NEU2Sialidase 2IPI00022482RIPALLYLPGQQSLLAFAEQRA 3 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928RIPIEDKDLINTANWRV 2 
A4752DSC3, CDHF3, DSC4Desmocollin 3 precursorIPI00031549;IPI00477338;IPI00218928RIPIEDKDLINTANWRV 3 
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoformIPI00007812RIPQSTLSEFYPRD 2 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289RIPQSTLSEFYPRD 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIPSAVGYQPTLATDM*GTM*QERI 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIPSAVGYQPTLATDMGTM*QERI 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorIPI00303476RIPSAVGYQPTLATDMGTMQERI 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RIPWDQGCQPTPRF 2 
A0439PHB2, BAP, REAProhibitin 2IPI00027252RIPWFQYPIIYDIRA 2 
A379AEIF3F, EIF3S5Eukaryotic translation initiation factor 3 subunit 5IPI00011257;IPI00240909RIQDALSTVLQYAEDVLSGKV 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTM*TPDY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTM*TPDYQSHF 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTM*TPDYQSHF 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTM*TPDYQSHFRT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTM*TPDYQSHFRT 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDY 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDYQS 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDYQSHF 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDYQSHF 3 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDYQSHFRT 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RIQEASHSQVLTMTPDYQSHFRT 3 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625RIQEQCEQDIPM*VCPDYQRY 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625RIQEQCEQDIPMVCPDYQRY 2 
A0454DSPDesmoplakinIPI00013933RIQESKNQCTQVVQERE 2 
A0454DSPDesmoplakinIPI00013933RIQESKNQCTQVVQERE 3 
A2492LMNB2, LMN2Lamin B2IPI00009771RIRELEEAMAGERD 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RIREWCEQQVPYM*CPDYQSYFRT 3 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RIREWCEQQVPYMCPDYQSYFRT 3 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RIRIDSLSAQLSQLQKQ 3 
A3862KRT80, KB20Keratin B20IPI00431749RIRYEDEISKRT 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00021812RISAPNVDFNLEGPKV 2 
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKIPI00418700RISAPNVDFNLEGPKV 2 
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2IPI00019912RISDEDWDIIHRV 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RISEQFTAM*FRR 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RISEQFTAM*FRR 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RISEQFTAMFRR 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RISEQFTAMFRR 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RISGLIYEETRG 1 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RISGLIYEETRG 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RISGLIYEETRGVL 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RISGVGIDRPPYGVFT 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RISGVGIDRPPYGVFTINP 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RISGVGIDRPPYGVFTINPRT 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RISGVGIDRPPYGVFTINPRT 3 
A841BATG9B, APG9L2, NOS3ASAutophagy-related protein 9bIPI00465328RISIFSLSPAPHTRS 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RISSGCGVTRNFSSCSAVAPKT 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229RISVNNVLPVFDNLM*QQKL 2 
A5984CTSD, CPSDCathepsin D precursorIPI00011229RISVNNVLPVFDNLMQQKL 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RITAVCKVPDESEVVVERD 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RITAVCKVPDESEVVVERD 3 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RITESEEVVSRE 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5IPI00003362RITPSYVAFTPEGERL 2 
A0607PA2G4, EBP1, P38-2G4Proliferation-associated protein 2G4IPI00299000RITSGPFEPDLYKS 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RITWLYDNTTGKQ 1 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524RIVATKPLYVALAQRK 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RIVAVPTPLPWN 1 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RIVAVPTPLPWNAMS 2 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681RIVCVAPSCQPSVCVPVSC 2 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681RIVCVAPSCQPSVCVPVSCRP 2 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681RIVCVAPSCQPSVCVPVSCRP 3 
A4905KRTAP12-3, KRTAP12.3, KAP12.3Keratin-associated protein 12-3IPI00394681RIVCVAPSCQPSVCVPVSCRPIIYV 2 
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7IPI00030179RIVEPYIAWGYPNLKS 2 
A7935TARSThreonyl-tRNA synthetase, cytoplasmicIPI00329633RIYGISFPDPKM 2 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RIYVVDVGSEPRA 1 
A463CSELENBP1, SBPSelenium-binding protein 1IPI00305719RIYVVDVGSEPRA 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465RKASGPPVSELITKA 2 
A470AHIST1H1C, H1F2Histone H1.2IPI00217465RKASGPPVSELITKA 3 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468RKATGPPVSELITKA 2 
A473AHIST1H1B, H1F5Histone H1.5IPI00217468RKATGPPVSELITKA 3 
A2341ACTN1Alpha-actinin 1IPI00013508RKDDPLTNLNTAFDVAEKY 2 
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1IPI00025447;IPI00472724RKDGNASGTTLLEALDCILPPTRPTDKPLRL 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RKDLYANTVLSGGTTM*YPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RKDLYANTVLSGGTTM*YPGIADRM 3 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RKDLYANTVLSGGTTMYPGIADRM 2 
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1IPI00021439;IPI00021440RKDLYANTVLSGGTTMYPGIADRM 3 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524RKEFSPFGTITSAKV 2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350;IPI00375400RKEGGLGPLNIPLLADVTRR 2 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2IPI00027350;IPI00375400RKEGGLGPLNIPLLADVTRRL 3 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785RKESYSIYVYKV 1 
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EIPI00003935;IPI00220403;IPI00152785RKESYSIYVYKV 2 
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kIPI00020101;IPI00455460;IPI00419833;IPI00377199;IPI00303133;IPI00152906;IPI00032234RKESYSVYVYKV 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RKGDIFLVRG 2 
A0647ANXA1, ANX1, LPC1Annexin A1IPI00218918RKGTDVNVFNTILTTRS 2 
A8047TXNRD1, TR, TR1Thioredoxin reductase 1IPI00472175RKIGLETVGVKI 2 
A0452CANXCalnexin precursorIPI00020984RKIPNPDFFEDLEPFRM 2 
A3804EEF2, EF2Elongation factor 2IPI00186290RKIWCFGPDGTGPNILTDITKG 2 
A3804EEF2, EF2Elongation factor 2IPI00186290RKIWCFGPDGTGPNILTDITKG 3 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096RKKNGPLEVAGAAVSAGHGLPAKF 2 
A494AH2AFY, MACROH2A1Core histone macro-H2A.1IPI00059366;IPI00304171;IPI00148096RKKNGPLEVAGAAVSAGHGLPAKF 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RKLAVNM*VPFPRL 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RKLAVNM*VPFPRL 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RKLAVNMVPFPRL 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RKLAVNMVPFPRL 2 
A3808RPL4, RPL160S ribosomal protein L4IPI00003918;IPI00471915RKLDELYGTWRK 1 
A3808RPL4, RPL160S ribosomal protein L4IPI00003918;IPI00471915RKLDELYGTWRK 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875RKLDPGSEETQTLVRE 2 
A1968EEF1G, EF1G, PRO1608Elongation factor 1-gammaIPI00000875RKLDPGSEETQTLVRE 3 
A1135PTBP1, PTBPolypyrimidine tract-binding protein 1IPI00179964;IPI00334175;IPI00183626RKLPIDVTEGEVISLGLPFGKV 2 
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1IPI00001159;IPI00478513;IPI00027040RKMAAQIIGNMYSLTDQKDLAPYLPS 2 
A9842CTNNBIP1, ICATBeta-catenin-interacting protein 1IPI00025001RKMGSNLTASEEEFLRT 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RKNEILEMNKL 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RKNEILEMNKL 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RKNEILEMNKLIQRL 3 
A9035RTN4, NOGOC, NOGOReticulon 4IPI00021766;IPI00478442;IPI00335276;IPI00298289RKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRG 3 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RKPIYLM*NNFNARF 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RKPIYLMNNFNARF 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RKPIYLMNNFNARF 3 
A6203CPT1A, CPT1Carnitine O-palmitoyltransferase I, mitochondrial liver isoformIPI00032038;IPI00479108RKPM*LYSFQTSLPRLPVP 2 
A3633HSD17B12Hydroxysteroid (17-beta) dehydrogenase 12IPI00007676RKPTLDKPSPETFVKS 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RKPVNVQM*LFSNPLDEPVRD 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RKPVNVQMLFSNPLDEPVRD 2 
A0433TPI1, TPI, TIMTriosephosphate isomerase 1IPI00465028RKQSLGELIGTLNAAKV 2 
A4758DSG4, CDHF13Desmoglein 4 preproprotein precursorIPI00428691RKRSSTMGTLRDYADADINM*AFLDSYFSEKA 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFLR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFLR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFLRR 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFLRR 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFLRR 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFLRR 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFLRRL 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RKSDLEANVEALIQEIDFLRRL 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFLRRL 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RKSDLEANVEALIQEIDFLRRL 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RKSDLEANVEALVEESSFLR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RKSDLEANVEALVEESSFLRR 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RKSDLEANVEALVEESSFLRR 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RKSDLEANVEALVEESSFLRRL 3 
A9655RPSA, LAMBR, LAMR140S ribosomal protein SAIPI00456823RKSNGIYIINLKR 2 
A0454DSPDesmoplakinIPI00013933RKSVEDRFDQQKNDYDQLQKA 3 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorIPI00006663RKTFPTVNPSTGEVICQVAEGDKEDVDKA 3 
A0454DSPDesmoplakinIPI00013933RKTGSQYDIQDAIDKG 2 
A1308BLMHBleomycin hydrolaseIPI00219575RKTLYNNQPIDFLKK 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RKTVTAM*DVVYA 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RKTVTAM*DVVYALKR 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4IPI00453473RKTVTAMDVVYALKR 2 
A6779EIF4A1, DDX2A, EIF4AEukaryotic initiation factor 4A-IIPI00025491RKVDWLTEKM 2 
A4564AIM1, CRYBG1Absent in melanoma 1 proteinIPI00294840RKVEFPTDPKV 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RKVIVTVQARP 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKV 3 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512RKYTLPPGVDPTQVSSSLSPEGTLTVEAPM*PKL 3 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512RKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKL 3 
A0387ATP5H, My032ATP synthase D chain, mitochondrialIPI00220487RLAALPENPPAIDWAYYKA 2 
A4900KRTAP10-11, KRTAP18.11, KAP10.11Keratin-associated protein 10-11IPI00394674RLACYSLCSGKK 2 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RLADALQELRA 2 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformIPI00007682RLAEM*PADSGYPAYLGARL 2 
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformIPI00007682RLAEMPADSGYPAYLGARL 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186RLAPITSDPTEATAVGAVEASFKC 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683RLASCGSLLCRPTC 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683RLASCGSLLCRPTCSRLAC 2 
A4901KRTAP10-12, KAP10.12, KAP18-12Keratin-associated protein 10-12IPI00394683RLASCGSLLCRPTCSRLAC 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEV 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEV 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEVLEG 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEG 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEVLEG 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEVLEGYKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEVLEGYKK 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEGYKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEGYKK 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEVLEGYKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEVLEGYKK 3 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEVLEGYKKK 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLASELNHVQEVLEGYKKK 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEGYKKK 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEGYKKK 3 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEVLEGYKKK 2 
A3859KRT83, KRTHB3, HHB5Keratin, type II cuticular HB3IPI00297795RLASELNHVQEVLEGYKKK 3 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLASELNHVQEVLEGYKKKYEEEVSLR 3 
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1IPI00328257;IPI00413947;IPI00384489RLASQANIAQVLAELKE 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1IPI00024067;IPI00455383RLASTLVHLGEYQAAVDGARK 2 
A3826KRT25C, KRT27Keratin, type I cytoskeletal 27IPI00328103RLASYLDSVHALEEANADLEQKI 3 
A3827KRT25, KRT25AKeratin, type I cytoskeletal 25IPI00375911RLASYLDSVHALEEANADLEQKI 3 
A8871LAMTOR1, PDRO, PP7157RHOA activator C11ORF59IPI00016670RLAVLSSSLTHWKK 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625RLAVQLDNCKL 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625RLAVQLDNCKLATDDFKS 2 
A9931GSDMA, GSDM, GSDM1GasderminIPI00166200RLCALYAGLSLLQQLTKA 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLCEGIGPVNISVSS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLCEGIGPVNISVSSSKG 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLCEGVGSVNVCV 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLCEGVGSVNVCV 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLCEGVGSVNVCVSSSRG 2 
A3857KRTHB6, KRT86, GHHKB6Keratin, type II cuticular HB6IPI00182655RLCEGVGSVNVCVSSSRG 2 
A6871PKM2, OIP3, PK2Pyruvate kinase, M1 isozymeIPI00479186RLDIDSPPITARN 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RLDIEVTAAPSADLNQVLQEM*RC 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RLDIEVTAAPSADLNQVLQEMRC 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RLDQLIYIPLPDEKS 2 
A9974LGALS7, PIG1, LGALS7BGalectin-7IPI00219221RLDTSEVVFNSKE 2 
A4798FAM83H, PP2121Hypothetical proteinIPI00394829RLDYVPSSASRE 2 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RLECEINTYRG 1 
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5IPI00294649RLECEINTYRG 2 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RLECEINTYRS 1 
A3833type I hair keratin, KRT31, HHA1Keratin, type I cuticular HA1IPI00383759RLECEINTYRS 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RLECEINTYRS 2 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RLECEINTYRS 1 
A3835KRT33B, HHA3-II, HKA3BKeratin, type I cuticular HA3-IIIPI00031423RLECEINTYRS 2 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RLECEINTYRS 1 
A3836KRT34, HHA4, HKA4Keratin, type I cuticular HA4IPI00292715RLECEINTYRS 2 
A4875KRT39, KA35Keratin, type I cytoskeletal 39IPI00465330RLECEITTYRS 2 
A6422ENGASECytosolic endo-beta-N-acetylglucosaminidaseIPI00168838RLEDGFNVALEPLACRQ 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RLEFIVSTGPYPSESAM*TKA 2 
A7970TGM3Protein-glutamine glutamyltransferase E precursorIPI00300376RLEFIVSTGPYPSESAMTKA 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00008692RLEGEIATYRH 2 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RLEGEINTYRS 1 
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2IPI00291540RLEGEINTYRS 2 
A3211CKAP4, P63P63 proteinIPI00141318RLEGLGSSEADQDGLASTVRS 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLESELCSLQ 1 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLESELCSLQAALEGYKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLESELCSLQAALEGYKK 3 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLESELCSLQAALEGYKKK 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2IPI00300053RLESELCSLQAALEGYKKK 3 
A2492LMNB2, LMN2Lamin B2IPI00009771RLESLSYQLSGLQKQ 2 
A3584FASN, FASFatty acid synthaseIPI00418433RLFDHPESPTPNPTEPLFLAQAEVYKE 3 
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1IPI00025512RLFDQAFGLPRL 2 
A9654RPS940S ribosomal protein S9IPI00221088RLFEGNALLRR 2 
A457AGCN1L1, PRIC295, HSGCN1Translational activator GCN1IPI00001159;IPI00478513;IPI00027040RLFNDSSPVVLEESWDALNAITKK 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524RLFPLIQAM*HPTLAGKI 2 
A2508PABPC1, PAB1, PABP1Polyadenylate-binding protein 1IPI00008524RLFPLIQAMHPTLAGKI 2 
A6422ENGASECytosolic endo-beta-N-acetylglucosaminidaseIPI00168838RLFSLQAPVPPKI 2 
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richIPI00010740;IPI00216613RLFVGNLPADITEDEFKR 2 
A1014SFPQ, PSFSplicing factor, proline-and glutamine-richIPI00010740;IPI00216613RLFVGNLPADITEDEFKRL 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596RLFVGNLPPDITEEEM*RK 2 
A784ANONO, NRB5454 kDa nuclear RNA- and DNA-binding proteinIPI00304596RLFVGNLPPDITEEEMRK 2 
A747BVSIG8V-set and immunoglobulin domain-containing protein 8IPI00376274RLGCPYVLDPEDYGPNGLDIEWMQ 2 
A7919GARSGlycyl-tRNA synthetaseIPI00465260RLGDAVEQGVINNTVLGYFIGRI 2 
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2IPI00017726RLGDPAEYAHLVQAIIENPFLNGEVIRL 3 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RLGDVISIQPCPDVKY 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RLGEKLSDEEVDEMIRA 2 
A8693CALML3Calmodulin-related protein NB-1IPI00216984RLGEKLSDEEVDEMIRA 3 
A0901SFN, HME114-3-3 protein sigmaIPI00013890RLGLALNFSVFHYEIANSPEEAISLAKT 3 
A7989TKT, TKT1TransketolaseIPI00021716RLGQSDPAPLQHQM*DIYQKR 2 
A7989TKT, TKT1TransketolaseIPI00021716RLGQSDPAPLQHQMDIYQKR 2 
A509BLRRC15, LIBLeucine-rich repeat-containing protein 15IPI00152871RLGTDTVPVCFSPANVRG 2 
A166ATOLLIPToll-interacting proteinIPI00100154RLGYAVYETPTAHNGAKN 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RLHFFM*PGFAPLT 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RLHFFM*PGFAPLT 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RLHFFM*PGFAPLTSRG 2 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RLHFFM*PGFAPLTSRG 3 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RLHFFM*PGFAPLTSRG 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainIPI00007752RLHFFM*PGFAPLTSRG 3 
A5189TUBB2A, TUBB2, TUBBTubulin beta-2A chainIPI00013475RLHFFMPGFAPLTSRG 2 
A3584FASN, FASFatty acid synthaseIPI00418433RLHLSGIDANPNALFPPVEFPAPRG 2 
A0112CTNNB1, CTNNB, PRO2286Beta-cateninIPI00017292RLHYGLPVVVKL 1 
A789ANOP58, NOL5, NOP5Nucleolar protein 58IPI00006379RLIAHAGSLLNLAKH 2 
A9638RPS2040S ribosomal protein S20IPI00012493RLIDLHSPSEIVKQ 1 
A9638RPS2040S ribosomal protein S20IPI00012493RLIDLHSPSEIVKQ 2 
A3831KRT36, HHA6, HKA6Keratin, type I cuticular HA6IPI00456625RLIDNLENQLAEIRC 2 
A5178TUBA1A, TUBA3Tubulin alpha-1A chainIPI00180675RLIGQIVSSITASLRF 2 
A1351EIF2S3, EIF2GEukaryotic translation initiation factor 2 subunit 3IPI00297982RLIGWGQIRR 2 
A5797LAP3, LAPEP, PEPSCytosol aminopeptidaseIPI00419237RLILADALCYAHTFNPKV 2 
A3815RPS2, rps2, RPS440S ribosomal protein S2IPI00013485;IPI00479366;IPI00455532;IPI00165486RLIPAPRGTGIVSAPVPKK 2 
A6977LPCAT3, MBOAT5, OACT5Lysophospholipid acyltransferase 5IPI00306419RLIQESPTLSKL 2 
A5180TUBA1C, TUBA6Tubulin alpha-1C chainIPI00387144RLISQIVSSITASLRF 2 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainIPI00007750RLISQIVSSITASLRF 2 
A3834KRT33A, HHA3-I, HKA3AKeratin, type I cuticular HA3-IIPI00297632RLITNVESQLAEIRS 2 
A3918VCPTransitional endoplasmic reticulum ATPaseIPI00022774;IPI00478540RLIVDEAINEDNSVVSLSQPKM 2 
A0454DSPDesmoplakinIPI00013933RLKAEFQEEAKR 2 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RLKDLEALLNSKE 1 
A1374LMNA, LMN1Lamin A/CIPI00021405;IPI00216952RLKDLEALLNSKE 2 
A378AEIF3S6, EIF3E, INT6Eukaryotic translation initiation factor 3 subunit 6IPI00013068RLKETIDNNSVSSPLQSLQQRT 2 
A0454DSPDesmoplakinIPI00013933RLKNTLTQTTENLRR 2 
A1941PLEC1, PLECPlectinIPI00186711RLLDPEDVDVPQPDEKS 2 
A1941PLEC1, PLECPlectinIPI00186711RLLEAQACTGGIIDPSTGERFPVTDAVNKG 3 
A0454DSPDesmoplakinIPI00013933RLLEAQACTGGIIHPTTGQKL 2 
A0454DSPDesmoplakinIPI00013933RLLEAQACTGGIIHPTTGQKL 3 
A0454DSPDesmoplakinIPI00013933RLLEAQIASGGVVDPVNSVFLPKD 2 
A0454DSPDesmoplakinIPI00013933RLLEAQIASGGVVDPVNSVFLPKD 3 
A1941PLEC1, PLECPlectinIPI00186711RLLEAQIATGGIIDPEE 2 
A0454DSPDesmoplakinIPI00013933RLLEAQIATGGIIDPKE 2 
A3856KRT85, KRTHB5, HHB5Keratin, type II cuticular HB5IPI00032541RLLEGEEHRLC 2 
A3860KRT82, KRTHB2, HB2Keratin type II cuticular HB2I