PADB-logoLSSR - PepMap molecular information by study

Study ID 15253431
Species human
Disease healthy
Tissue / Source heart
Compartment mitochondria

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536AAALEQFK 2 Pept_E (Sonar search): 3.90E-02
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011AAASTDYYK 2 Pept_E (Sonar search): 3.00E-02
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025AAAVLPVLDLAQR 2 Pept_E (Sonar search): 1.70E-02
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025AAAVLPVLDLAQR 3 Pept_E (Sonar search): 6.80E-05
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:20455499AAAVLPVLDLAQR 1 
A7854SPG7, CAR, CMARParapleginGI:4507173AAEDELNIEAK 2 MS2 score: 55
A3793PHBProhibitinGI:4505773AAELIANSLATAGDGLIELR 2 Pept_E (Sonar search): 5.90E-04
A3793PHBProhibitinGI:4505773AAELIANSLATAGDGLIELR 2 Pept_E (Sonar search): 5.80E-03
A3793PHBProhibitinGI:4505773AAELIANSLATAGDGLIELR 3 Pept_E (Sonar search): 1.30E-03
A3793PHBProhibitinGI:4505773AAELIANSLATAGDGLIELR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080AAFGLSEAGFNTACVTK 2 Pept_E (Sonar search): 4.00E-03
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830AAFGLSEAGFNTACVTK 2 Pept_E (Sonar search): 3.10E-06
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590AAFTECCQAADK 2 Pept_E (Sonar search): 1.10E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345AAFTECCQAADK 2 Pept_E (Sonar search): 2.40E-04
A8170UK114, HRSP12, PSPRibonuclease UK114GI:5032215AAGCDFTNVVK 2 Pept_E (Sonar search): 6.70E-03
A9987MACROD1, LRP16O-acetyl-ADP-ribose deacetylase MACROD1GI:12653017AAGPLLTDECR 2 Pept_E (Sonar search): 7.40E-03
A3793PHBProhibitinGI:4505773AAIISAEGDSK 2 Pept_E (Sonar search): 2.50E-03
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807AALSASEGEEVPQDK 2 Pept_E (Sonar search): 3.70E-02
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AALTGLLHR 2 Pept_E (Sonar search): 1.40E-05
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AALTGLLHR 2 Pept_E (Sonar search): 1.10E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AALTGLLHR 2 
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429AANDAGYFNDEM*APIEVK 2 Pept_E (Sonar search): 3.70E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429AANDAGYFNDEM*APIEVK 3 Pept_E (Sonar search): 7.40E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429AANDAGYFNDEMAPIEVK 2 Pept_E (Sonar search): 1.20E-01
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759AANNGALPPDLSYIVR 2 Pept_E (Sonar search): 7.60E-03
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759AANNGALPPDLSYIVR 3 Pept_E (Sonar search): 9.10E-03
A163CMYL3, CMLC1Myosin light chain 3GI:9651188AAPAPAPPPEPERPK 3 Pept_E (Sonar search): 9.80E-03
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312AAQIGAHTLSGACLDPGAFK 3 Pept_E (Sonar search): 2.90E-03
A3793PHBProhibitinGI:4505773AATFGLILDDVSLTHLTFGK 2 Pept_E (Sonar search): 9.50E-08
A3793PHBProhibitinGI:4505773AATFGLILDDVSLTHLTFGK 2 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202AAVDAGFVPNDM*QVGQTGK 2 Pept_E (Sonar search): 6.60E-01
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202AAVDAGFVPNDMQVGQTGK 3 Pept_E (Sonar search): 1.10E-01
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379AAVEEGIVLGGGCALLR 2 Pept_E (Sonar search): 4.30E-03
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755AAYFGIYDTAK 2 Pept_E (Sonar search): 2.20E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558AAYFGVYDTAK 2 Pept_E (Sonar search): 3.30E-03
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2GI:113463AAYFGVYDTAK 2 Pept_E (Sonar search): 2.40E-01
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816AAYIYIR 2 Pept_E (Sonar search): 4.80E-02
A8170UK114, HRSP12, PSPRibonuclease UK114GI:5032215AAYQVAALPK 2 Pept_E (Sonar search): 6.50E-03
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080ACALSIEESCRPGDK 3 Pept_E (Sonar search): 4.60E-01
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1GI:4505763ACANPAAGSVILLENLR 2 Pept_E (Sonar search): 1.50E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611ADAVQDSEMVELVELEIR 3 Pept_E (Sonar search): 2.30E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590ADDKETCFAEEGK 3 Pept_E (Sonar search): 1.40E-04
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575ADGGTQVIDTK 2 Pept_E (Sonar search): 1.10E-02
A931BCYCS, CYCCytochrome CGI:15929398ADLIAYLK 2 Pept_E (Sonar search): 1.40E-02
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356ADLTEYLSTHYK 2 Pept_E (Sonar search): 1.30E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356ADLTEYLSTHYK 3 Pept_E (Sonar search): 6.60E-06
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841ADLTEYLSTHYK 2 Pept_E (Sonar search): 7.10E-06
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841ADLTEYLSTHYK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064ADMVIEAVFEDLSLK 2 Pept_E (Sonar search): 8.60E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325ADMVIEAVFEDLSLK 3 Pept_E (Sonar search): 6.00E-02
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171ADTLGELDLER 2 Pept_E (Sonar search): 1.50E-02
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611AEAGDNLGALVR 2 Pept_E (Sonar search): 4.00E-03
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6GI:14781307AEEVVSFVK 2 Pept_E (Sonar search): 1.60E-01
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:627367AEGPEVDVNLPK 2 Pept_E (Sonar search): 7.00E-02
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:6841440AEQINQAAGEASAVLAK 2 Pept_E (Sonar search): 8.00E-02
A5673ACOT2, PTE2, PTE2APeroxisomal acyl-coenzyme A thioester hydrolase 2aGI:7023514AESTFLFLVGQDDHNWK 2 Pept_E (Sonar search): 6.70E-03
A5673ACOT2, PTE2, PTE2APeroxisomal acyl-coenzyme A thioester hydrolase 2aGI:7023514AESTFLFLVGQDDHNWK 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525AEVITCDVLLVCIGR 2 Pept_E (Sonar search): 2.00E-03
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:7542837AFAGDIANQLATDAVQILGGNGFNTEYPVEK 3 
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774AFDLIVDRPVTLVR 3 Pept_E (Sonar search): 2.90E-03
A307CUQCR10, UCRC, HSPC119Cytochrome B-C1 complex subunit 9GI:9297078AFDQGADAIYDHINEGK 3 Pept_E (Sonar search): 1.60E-02
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312AFTGFIVEADTPGIQIGR 2 Pept_E (Sonar search): 1.50E-02
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312AFTGFIVEADTPGIQIGR 3 Pept_E (Sonar search): 2.90E-02
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:4930073AFVDFLSDEIKEER 3 Pept_E (Sonar search): 6.40E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541AGAGSATLSM*AYAGAR 2 Pept_E (Sonar search): 9.60E-05
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541AGAGSATLSM*AYAGAR 3 Pept_E (Sonar search): 2.60E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541AGAGSATLSMAYAGAR 2 Pept_E (Sonar search): 7.10E-05
A1390EHD4, HCA10, HCA11EH-domain containing protein 4GI:11066968AGGADAVQTVTGGLR 2 Pept_E (Sonar search): 7.20E-03
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817AGGAGVPAFYTPTGYGTLVQEGGSPIK 3 Pept_E (Sonar search): 1.00E-02
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817AGGAGVPAFYTPTGYGTLVQEGGSPIK 2 
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:6166556AGGANSNVFSMFEQTQIQEFK 2 
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorGI:4758040AGIFQSVK 2 Pept_E (Sonar search): 1.60E-02
A351BSMIM20Uncharacterized proteinGI:13543706AGIVQEDVQPPGLK 2 MS2 score: 40
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228AGLGSGLSLSGLVHPELSR 2 Pept_E (Sonar search): 2.10E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228AGLGSGLSLSGLVHPELSR 3 Pept_E (Sonar search): 4.80E-05
A3197MYH2, MYHSA2Myosin-2GI:8923940AGLLGLLEEMR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830AGLPCQDLEFVQFHPTGIYGAGCLITEGCR 3 Pept_E (Sonar search): 2.30E-04
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1GI:4504239AGLQFPVGR 2 Pept_E (Sonar search): 1.70E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559AGLVDDFEK 2 Pept_E (Sonar search): 1.80E-03
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559AGLVDDFEKK 2 Pept_E (Sonar search): 2.90E-03
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialGI:7643782AGM*SAEQAQGLLEK 2 MS2 score: 46
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialGI:7643782AGMSAEQAQGLLEK 2 MS2 score: 48
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007AGQTTYSGVIDCFR 2 Pept_E (Sonar search): 1.80E-03
A3747SLC25A13, ARALAR2Calcium-binding mitochondrial carrier protein Aralar2GI:7657581AGQTTYSGVIDCFR 3 
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280AGTFQAFEQFGQQLLAHGHYASPEIK 3 Pept_E (Sonar search): 3.70E-04
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280AGTFQAFEQFGQQLLAHGHYASPEIK 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549AHGGYSVFAGVGER 2 Pept_E (Sonar search): 7.70E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549AHGGYSVFAGVGER 3 Pept_E (Sonar search): 2.80E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295AHGGYSVFAGVGER 2 Pept_E (Sonar search): 4.10E-10
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295AHGGYSVFAGVGER 2 
A4573ANXA11, ANX11Annexin A11GI:4557317AHLVAVFNEYQR 2 Pept_E (Sonar search): 1.00E-04
A4573ANXA11, ANX11Annexin A11GI:4557317AHLVAVFNEYQR 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549AIAELGIYPAVDPLDSTSR 2 Pept_E (Sonar search): 2.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549AIAELGIYPAVDPLDSTSR 3 Pept_E (Sonar search): 4.40E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295AIAELGIYPAVDPLDSTSR 2 Pept_E (Sonar search): 1.30E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295AIAELGIYPAVDPLDSTSR 2 
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547AIEM*LGGELGSK 2 Pept_E (Sonar search): 3.90E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547AIEMLGGELGSK 2 Pept_E (Sonar search): 1.90E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325AIGILSRFSAFR 2 Pept_E (Sonar search): 3.30E-01
A5570NUBPLIron-sulfur protein NUBPLGI:13376747AIGLLDVDVYGPSVPK 2 MS2 score: 50
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083AILEDMVR 2 Pept_E (Sonar search): 8.00E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536AISPDKDNFYFDVK 3 Pept_E (Sonar search): 3.70E-03
A3202MYH7, MYHCBMyosin-7GI:12053672AITDAAMMAEELKK 3 Pept_E (Sonar search): 2.80E-04
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:34707AIWNVINWENVTER 2 Pept_E (Sonar search): 4.00E-05
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:34707AIWNVINWENVTER 3 
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:442613AIWNVINWENVTER 2 Pept_E (Sonar search): 4.60E-04
A921CCAMSAP1L1, CAMSAP2Calmodulin-regulated Spectrin-associated protein 2GI:27481124AKIACNLAWLVAK 2 
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:27436929AKIHDIVLVGGSTR 2 Pept_E (Sonar search): 7.30E-06
A2008HSPA1LHeat shock 70 kDa protein 1-HOMGI:27436929AKIHDIVLVGGSTR 3 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327ALAMGYKPK 2 Pept_E (Sonar search): 9.10E-01
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305ALANSLACQGK 2 Pept_E (Sonar search): 1.00E+00
A7236REXO2, SFN, SMFNOligoribonuclease, mitochondrial precursorGI:4929697ALDDISESIK 2 Pept_E (Sonar search): 2.60E-02
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2GI:4505355ALENVLSGK 2 Pept_E (Sonar search): 6.10E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ALEQFATVVEAK 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ALEQFATVVEAK 2 Pept_E (Sonar search): 6.00E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ALEQFATVVEAK 3 Pept_E (Sonar search): 1.90E-01
A163CMYL3, CMLC1Myosin light chain 3GI:9651188ALGQNPTQAEVLR 1 
A6254DCXR, KIDCRL-xylulose reductaseGI:12804319ALGSVGPVDLLVNNAAVALLQPFLEVTK 3 Pept_E (Sonar search): 3.40E-07
A6254DCXR, KIDCRL-xylulose reductaseGI:12804319ALGSVGPVDLLVNNAAVALLQPFLEVTK 3 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4406579ALGTEVIQLFPEK 2 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807ALGTEVIQLFPEK 2 Pept_E (Sonar search): 9.00E-02
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189ALGVPSSPYTWLTVEVLER 2 Pept_E (Sonar search): 2.70E-07
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189ALGVPSSPYTWLTVEVLER 2 
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197ALIADSGLK 2 Pept_E (Sonar search): 1.00E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064ALMGLYHGQVLCK 3 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325ALMGLYHGQVLCK 3 Pept_E (Sonar search): 8.40E-03
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:14603309ALMLQGVDLLADAVAVTMGPK 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570ALNALCDGLIDELNQALK 3 Pept_E (Sonar search): 9.90E-03
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:14286220ALNALCDGLIDELNQALK 2 Pept_E (Sonar search): 7.00E-08
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ALNEGGFQSIPK 2 Pept_E (Sonar search): 7.00E-02
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238ALNVEPDGTGLTCSLAPNIISQL 2 Pept_E (Sonar search): 8.00E-04
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062ALPCIVDVR 2 Pept_E (Sonar search): 2.20E-02
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorGI:27923741ALQSTAVEQIGMFLGK 2 Pept_E (Sonar search): 9.30E-05
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127ALSEIAGM*TLPYDTLDQVR 2 Pept_E (Sonar search): 5.60E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127ALSEIAGM*TLPYDTLDQVR 3 Pept_E (Sonar search): 4.40E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127ALSEIAGMTLPYDTLDQVR 3 Pept_E (Sonar search): 2.10E-05
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575ALTGGIAHLFK 2 Pept_E (Sonar search): 1.40E-01
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525ALTGGIAHLFK 1 
A0647ANXA1, ANX1, LPC1Annexin A1GI:4502101ALTGHLEEVVLALLK 2 Pept_E (Sonar search): 8.80E-07
A0647ANXA1, ANX1, LPC1Annexin A1GI:4502101ALTGHLEEVVLALLK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325ALTSFER 2 Pept_E (Sonar search): 8.60E-01
A0261PFKM, PFKX6-phosphofructokinase, muscle typeGI:4505749ALVFQPVAELK 2 Pept_E (Sonar search): 2.00E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:4502027ALVLIAFAQYLQQCPFEDHVK 3 
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850ALVSGKPAESSAVAATEK 2 Pept_E (Sonar search): 5.70E-03
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850ALVSGKPAESSAVAATEK 3 Pept_E (Sonar search): 4.90E-04
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850ALVSGKPAESSAVAATEKK 3 Pept_E (Sonar search): 8.90E-04
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301AM*LPPNSFQGK 2 Pept_E (Sonar search): 1.60E-02
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550AM*YPDYFAK 2 Pept_E (Sonar search): 8.00E-02
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AMDSDWFAENYMGR 3 Pept_E (Sonar search): 1.30E-03
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorGI:4557833AMGEQAVALAR 2 Pept_E (Sonar search): 1.20E-02
A502AHIST1H2BH, H2BFJHistone H2B type 1-HGI:4504269AMGIMNSFVNDIFER 2 Pept_E (Sonar search): 6.90E-03
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550AMYPDYFAK 2 Pept_E (Sonar search): 2.80E-04
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ANCEPQTYGIGLK 2 Pept_E (Sonar search): 8.80E-03
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768ANCSDNEFTQALTAAIPPESLTR 3 Pept_E (Sonar search): 8.60E-03
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390ANNSTYGLAAAVFTK 2 Pept_E (Sonar search): 5.50E-01
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2GI:4505355ANPDLPILIR 2 Pept_E (Sonar search): 1.30E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541ANTFVAELK 2 Pept_E (Sonar search): 3.80E-03
A8170UK114, HRSP12, PSPRibonuclease UK114GI:5032215APGAIGPYSQAVLVDR 2 Pept_E (Sonar search): 3.70E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786APGFAHLAGLDK 2 Pept_E (Sonar search): 1.40E-05
A3202MYH7, MYHCBMyosin-7GI:12053672APGVMDNPLVM*HQLR 3 Pept_E (Sonar search): 4.50E-03
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777APIQWEER 2 Pept_E (Sonar search): 4.70E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536APM*VNPTLGVHEADLLK 3 Pept_E (Sonar search): 8.00E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536APMVNPTLGVHEADLLK 3 Pept_E (Sonar search): 4.60E-02
A4347HSPB6Heat-shock protein beta-6GI:21389433APSVALPVAQVPTDPGHFSVLLDVK 3 Pept_E (Sonar search): 5.50E-05
A4347HSPB6Heat-shock protein beta-6GI:21389433APSVALPVAQVPTDPGHFSVLLDVK 3 
A5541CRYAB, CRYA2Alpha crystallin B chainGI:4503057APSWFDTGLSEMR 2 Pept_E (Sonar search): 4.70E-04
A345ESPRYD4SPRY domain-containing protein 4GI:17474293APVEGIGQPEK 2 Pept_E (Sonar search): 6.00E-02
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:6841440APVPGTPDSLSSGSSR 2 Pept_E (Sonar search): 3.50E-03
A0380ATP5DATP synthase delta chain, mitochondrial precursorGI:4502297AQAELVGTADEATR 2 Pept_E (Sonar search): 5.50E-04
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AQDEGLLSDVVPFK 2 Pept_E (Sonar search): 1.10E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327AQDEGLLSDVVPFKVPGK 3 Pept_E (Sonar search): 2.00E-01
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:433413AQFAQPEILIGTIPGAGGTQR 2 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570AQFAQPEILIGTIPGAGGTQR 3 Pept_E (Sonar search): 1.20E-03
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570AQFEGIVTDLIR 2 Pept_E (Sonar search): 4.70E-04
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688AQFEGIVTDLIR 2 Pept_E (Sonar search): 6.50E-08
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688AQFEGIVTDLIR 2 
A0439PHB2, BAP, REAProhibitin 2GI:6005854AQFLVEK 2 Pept_E (Sonar search): 1.00E+00
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:4885431AQIHDLVLVGGSTR 2 Pept_E (Sonar search): 2.70E-04
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1GI:4885431AQIHDLVLVGGSTR 2 
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265AQIMNVSWSADHR 2 Pept_E (Sonar search): 1.50E-04
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265AQIMNVSWSADHR 3 
A0439PHB2, BAP, REAProhibitin 2GI:6005854AQVSLLIR 2 Pept_E (Sonar search): 1.20E-01
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536AQYPIADLVK 2 Pept_E (Sonar search): 9.60E-01
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069ASAELALGENSEVLK 2 Pept_E (Sonar search): 1.40E-03
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069ASAELALGENSEVLK 3 Pept_E (Sonar search): 4.80E-04
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589ASAFALQEQPVVNAVIDDTTK 2 Pept_E (Sonar search): 3.50E-03
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589ASAFALQEQPVVNAVIDDTTK 3 Pept_E (Sonar search): 4.90E-04
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorGI:7706485ASEPGLAQLLVDQIYENAMIAAGLVDDPR 3 
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:179354ASHNIGIAMDTEQGLIVPNVK 3 Pept_E (Sonar search): 1.60E-02
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265ASHNIGIAMDTEQGLIVPNVK 2 Pept_E (Sonar search): 2.60E-07
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ASNTAEVFFDGVR 2 Pept_E (Sonar search): 8.00E-04
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202ASSTSPVEISEWLDQK 2 Pept_E (Sonar search): 4.00E-02
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202ASSTSPVEISEWLDQK 3 Pept_E (Sonar search): 1.70E-01
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)GI:28714ASTPGAAAQIQEVK 2 MS2 score: 35
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981ASWSSLSMDEK 2 Pept_E (Sonar search): 4.00E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827ATAAPAGAPPQPQDLEFTK 3 Pept_E (Sonar search): 4.20E-03
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301ATAEQISSQTGNK 2 Pept_E (Sonar search): 1.50E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075ATDCVGHDVVTLLR 3 Pept_E (Sonar search): 1.00E-03
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:106643ATLVCLISDFYPGAVTVAWK 2 Pept_E (Sonar search): 6.70E-05
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322ATLVLQVVDKPSPPQDLR 2 
A195CNDUFA3NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3GI:4758772ATPYNYPVPVR 2 Pept_E (Sonar search): 3.90E-03
A7346PDK4, PDHK4Pyruvate dehydrogenase [lipoamide kinase] isozyme 4, mitochondrial precursorGI:4505693ATVEHQENQPSLTPIEVIVVLGK 3 
A3620AGK, MULKAcylglycerol kinase, mitochondrial precursorGI:8250243ATVFLNPAACK 2 MS2 score: 37
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827AVAFQNPQTHVIENLHAAAYR 3 Pept_E (Sonar search): 2.40E-05
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827AVAFQNPQTHVIENLHAAAYR 4 Pept_E (Sonar search): 2.30E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482AVAFQNPQTHVIENLHAAAYR 2 Pept_E (Sonar search): 2.50E-08
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482AVAFQNPQTHVIENLHAAAYR 3 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768AVDEAADALLK 2 Pept_E (Sonar search): 2.40E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810AVDSLVPIGR 2 Pept_E (Sonar search): 5.20E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001AVDSLVPIGR 1 
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356AVELLGDIVQNCSLEDSQIEK 2 Pept_E (Sonar search): 3.90E-01
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356AVELLGDIVQNCSLEDSQIEK 3 Pept_E (Sonar search): 1.40E-02
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841AVELLGDIVQNCSLEDSQIEK 2 Pept_E (Sonar search): 5.10E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356AVELLGDIVQNCSLEDSQIEKER 3 Pept_E (Sonar search): 2.70E-02
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:135397AVFVDLEPTVIDEVR 2 Pept_E (Sonar search): 6.00E-02
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997AVIGM*TAGATGAFVGTPAEVALIR 3 Pept_E (Sonar search): 1.90E-01
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997AVIGMTAGATGAFVGTPAEVALIR 3 Pept_E (Sonar search): 1.40E-03
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:14741856AVIM*GAPGSGK 2 Pept_E (Sonar search): 2.50E-02
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialGI:13636047AVLIDKDQSPK 3 Pept_E (Sonar search): 3.50E-02
A6823AK2, ADK2Adenylate kinase 2, mitochondrialGI:4502013AVLLGPPGAGK 2 Pept_E (Sonar search): 2.60E-02
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:5174735AVLVDLEPGTMDSVR 2 Pept_E (Sonar search): 1.60E-02
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292AVLVTGCDSGFGFSLAK 2 Pept_E (Sonar search): 1.80E-02
A5964CA2Carbonic anhydrase 2GI:4557395AVQQPDGLAVLGIFLK 2 Pept_E (Sonar search): 1.20E-09
A5964CA2Carbonic anhydrase 2GI:4557395AVQQPDGLAVLGIFLK 2 
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850AVTPAPPIK 2 Pept_E (Sonar search): 2.30E-02
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850AVTPAPPIKR 2 Pept_E (Sonar search): 9.70E-03
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536AVVLAANHFGR 2 Pept_E (Sonar search): 4.00E-06
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536AVVLAANHFGR 2 
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997AVVVNAAQLASYSQSK 2 Pept_E (Sonar search): 5.80E-04
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997AVVVNAAQLASYSQSK 3 Pept_E (Sonar search): 2.70E-03
A170DUNQ2439/PRO5000, PFTL2439, UNQ2439UPF0317 protein C14ORF159, mitochondrialGI:21749754AWNLHQK 2 
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorGI:4758040AYADFYR 2 Pept_E (Sonar search): 9.80E-01
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:9963777AYQIDTVINLNVPFEVIK 2 
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11GI:17455445AYSTTSIASVAGLTAAAYR 2 Pept_E (Sonar search): 5.80E-03
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11GI:17455445AYSTTSIASVAGLTAAAYR 3 Pept_E (Sonar search): 3.10E-03
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369CALDFFR 2 Pept_E (Sonar search): 2.90E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203CATITPDEAR 2 Pept_E (Sonar search): 3.80E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575CATITPDEAR 2 Pept_E (Sonar search): 2.30E-02
A3681GLUD2, GLUDP1Glutamate dehydrogenase 2, mitochondrial precursorGI:6912392CAVVDVPFGGAK 2 Pept_E (Sonar search): 2.40E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590CCAAADPHECYAK 3 Pept_E (Sonar search): 1.40E-04
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345CCAAADPHECYAK 3 Pept_E (Sonar search): 1.60E-04
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379CEFQDAYVLLSEK 2 Pept_E (Sonar search): 2.70E-02
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768CEVLQYSAR 2 Pept_E (Sonar search): 1.30E-02
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650CGPM*VLDALIK 2 Pept_E (Sonar search): 3.00E-02
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650CGPMVLDALIK 2 Pept_E (Sonar search): 4.00E-03
A332BMINOS1UPF0327 protein C1ORF151GI:17439908CLADAVVK 2 Pept_E (Sonar search): 2.30E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325CLAPMMSEVIR 2 Pept_E (Sonar search): 4.40E-02
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807CLIATGGTPR 2 Pept_E (Sonar search): 8.00E-02
A3745SLC25A20, CAC, CACTMitochondrial carnitine/acylcarnitine carrier proteinGI:4557403CLLQIQASSGESK 2 Pept_E (Sonar search): 7.30E-03
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:2134870CLPQGCGPYQTPQTR 2 Pept_E (Sonar search): 1.10E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075CNVSFLLSEDGSGK 2 Pept_E (Sonar search): 5.10E-03
A7827SIRT3, SIR2L3Sirtuin 3GI:5225322CPVCTGVVKPDIVFFGEPLPQR 3 MS2 score: 52
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777CSDFTEEICR 2 Pept_E (Sonar search): 4.60E-02
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817CTLPLTGK 2 Pept_E (Sonar search): 2.30E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867CTTDHISAAGPWLK 3 Pept_E (Sonar search): 2.90E-04
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049DAFPEAIIVKPSDIFGR 3 Pept_E (Sonar search): 8.50E-03
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069DAGM*QLQGYR 2 Pept_E (Sonar search): 6.00E-02
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069DAGMQLQGYR 2 Pept_E (Sonar search): 1.30E-02
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570DAGQISGLNVLR 2 Pept_E (Sonar search): 2.50E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DAINQGM*DEELER 2 Pept_E (Sonar search): 2.70E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DAINQGM*DEELERDEK 3 Pept_E (Sonar search): 1.80E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DAINQGMDEELER 2 Pept_E (Sonar search): 1.90E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DAINQGMDEELERDEK 3 Pept_E (Sonar search): 2.10E-02
A4573ANXA11, ANX11Annexin A11GI:8671175DAQELYAAGENR 2 MS2 score: 35
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteGI:18481635DASVAEAWLIAQEPYLASGDFGHTVDSVEK 3 Pept_E (Sonar search): 2.00E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DATLTALDR 2 Pept_E (Sonar search): 7.80E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826DCFIIYQGHHGDVGAPIADVILPGAAYTEK 3 Pept_E (Sonar search): 1.40E-07
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:16877874DCGATWVVLGHSER 2 Pept_E (Sonar search): 3.90E-04
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:16877874DCGATWVVLGHSER 3 
A5213TLN2Talin 2GI:27720623DDISVEALQEQLTSVVQEIGHLIDPIATAAR 3 
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804DDTIYEDEDVKEAIR 2 Pept_E (Sonar search): 7.70E-03
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804DDTIYEDEDVKEAIR 3 Pept_E (Sonar search): 1.40E-03
A0216SLMAP, SLAP, UNQ1847/PRO3577Sarcolemmal associated protein 1GI:10047277DEILLLHQAAAK 3 Pept_E (Sonar search): 9.60E-04
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062DEQQISAAVEK 2 Pept_E (Sonar search): 1.30E-02
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280DFDFWLSEVEALLASEDYGK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672DFELNALNAR 2 Pept_E (Sonar search): 3.60E-02
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755DFLAGGVAAAISK 2 Pept_E (Sonar search): 4.20E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455DFLAGGVAAAVSK 2 Pept_E (Sonar search): 9.30E-10
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455DFLAGGVAAAVSK 2 
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558DFLAGGVAAAVSK 2 Pept_E (Sonar search): 5.60E-04
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558DFLAGGVAAAVSK 3 Pept_E (Sonar search): 1.60E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DFLIPIGK 2 Pept_E (Sonar search): 6.00E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687DFLIPIGK 1 Pept_E (Sonar search): 1.20E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687DFLIPIGK 1 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DFM*YVSQDPK 2 Pept_E (Sonar search): 3.80E-02
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DFMYVSQDPK 2 Pept_E (Sonar search): 1.40E-02
A4940LDB3, ZASPLIM domain-binding protein 3GI:3327040DFNMPLTISR 2 MS2 score: 59
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075DFNPTATVK 2 Pept_E (Sonar search): 3.00E-01
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788DFPLSGYVELR 2 Pept_E (Sonar search): 1.90E-03
A0439PHB2, BAP, REAProhibitin 2GI:1673514DFSLILDDVAITELSFSR 2 
A0389ATP5J2, ATP5JL, ATP5J2-PTCD1ATP synthase f chain, mitochondrialGI:4757812DFSPSGIFGAFQR 2 Pept_E (Sonar search): 2.60E-04
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429DFTATDLSEFAAK 2 Pept_E (Sonar search): 2.80E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127DFYM*TDSISR 2 Pept_E (Sonar search): 6.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127DFYMTDSISR 2 Pept_E (Sonar search): 2.40E-03
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062DGANIVIAAK 2 Pept_E (Sonar search): 1.10E-02
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807DGEQHEDLNEVAK 3 Pept_E (Sonar search): 7.40E-05
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728DGLTDVYNK 2 Pept_E (Sonar search): 4.30E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DGPGFYTTR 2 Pept_E (Sonar search): 1.10E-03
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:27500021DGSELILHFVTQCNTR 3 Pept_E (Sonar search): 2.90E-09
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429DGTVTAGNASGVADGAGAVIIASEDAVK 3 Pept_E (Sonar search): 5.90E-05
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171DGYADIVDVLNSPLEGPDQK 2 Pept_E (Sonar search): 3.50E-03
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171DGYADIVDVLNSPLEGPDQK 3 Pept_E (Sonar search): 1.30E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DGYAQILR 2 Pept_E (Sonar search): 1.60E-02
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981DHPLPEVAHVK 3 Pept_E (Sonar search): 9.10E-04
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830DHVYLQLHHLPPEQLATR 3 
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025DIEEIIDELK 2 Pept_E (Sonar search): 2.50E-02
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199DIFAMDDKSENEPIENEAAK 3 Pept_E (Sonar search): 3.10E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844DIFQEIFDK 1 Pept_E (Sonar search): 7.60E-03
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:21756162DIIALNPLYR 1 Pept_E (Sonar search): 1.70E-03
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:21756162DIIALNPLYR 1 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687DIIFAIK 1 
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DINQEVYNFLATAGAK 2 Pept_E (Sonar search): 1.30E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DINQEVYNFLATAGAK 3 Pept_E (Sonar search): 3.00E-03
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817DIPDGATVLVGGFGLCGIPENLIDALLK 3 Pept_E (Sonar search): 2.50E-04
A0647ANXA1, ANX1, LPC1Annexin A1GI:4502101DITSDTSGDFR 2 Pept_E (Sonar search): 8.00E-02
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312DIVPGDIVEIAVGDKVPADIR 3 Pept_E (Sonar search): 1.00E-01
A4996MYOM2Myomesin 2GI:4505315DKLDKYAIQQMM 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203DLAGCIHGLSNVK 2 Pept_E (Sonar search): 2.40E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203DLAGCIHGLSNVK 3 Pept_E (Sonar search): 5.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844DLAGCIHGLSNVK 2 Pept_E (Sonar search): 1.90E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844DLAGCIHGLSNVK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575DLAGCIHGLSNVK 2 Pept_E (Sonar search): 1.20E-03
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:4758504DLAPIGIR 2 Pept_E (Sonar search): 2.90E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DLEDLQILIK 2 Pept_E (Sonar search): 8.00E-02
A3202MYH7, MYHCBMyosin-7GI:12053672DLEEATLQHEATAAALR 3 Pept_E (Sonar search): 1.40E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611DLEKPFLLPVEAVYSVPGR 3 Pept_E (Sonar search): 3.40E-04
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611DLEKPFLLPVEAVYSVPGR 4 Pept_E (Sonar search): 8.00E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DLGGIVLANACGPCIGQWDR 2 Pept_E (Sonar search): 7.00E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DLGGIVLANACGPCIGQWDR 3 Pept_E (Sonar search): 1.10E-02
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursorGI:6624122DLGLAQDSATSTK 2 Pept_E (Sonar search): 8.60E-04
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DLMPHDLAR 2 Pept_E (Sonar search): 6.80E-03
A5603TNNT2, HNTN1Troponin T, cardiac muscle isoformsGI:15290517DLNELQALIEAHFENR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DLNSDM*DSILASLK 2 Pept_E (Sonar search): 5.20E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DLNSDMDSILASLK 2 Pept_E (Sonar search): 6.60E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DLNSDMDSILASLK 3 Pept_E (Sonar search): 8.00E-02
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189DLNTLAEDLLSSGTFNVDQIVK 2 
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinGI:18959202DLPVTEAVFSALVTGHAR 2 
A0439PHB2, BAP, REAProhibitin 2GI:6005854DLQMVNISLR 2 Pept_E (Sonar search): 4.10E-02
A3793PHBProhibitinGI:4505773DLQNVNITLR 2 Pept_E (Sonar search): 6.80E-03
A3793PHBProhibitinGI:4505773DLQNVNLTLR 2 Pept_E (Sonar search): 6.80E-03
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorGI:5802974DLSLDDFK 2 Pept_E (Sonar search): 1.70E-02
A884BCLTCL1, CLH22, CLTCLClathrin heavy chain 2GI:9257202DLVKEAINSYIR 2 
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650DLVPDLSNFYAQYK 2 Pept_E (Sonar search): 5.10E-03
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883DLYANNVLSGGTTMYPGIADR 2 Pept_E (Sonar search): 7.70E-03
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:14250401DLYANTVLSGGTTMYPGIADR 2 
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429DM*DLVEVNEAFAPQYLAVER 3 Pept_E (Sonar search): 1.30E-04
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429DMDLVEVNEAFAPQYLAVER 3 Pept_E (Sonar search): 2.00E-01
A211CNDUFB8NADH-ubiquinone oxidoreductase ASHI subunit, mitochondrial precursorGI:4689104DMFPGPYPR 2 Pept_E (Sonar search): 1.20E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252DMVGQVAITR 2 Pept_E (Sonar search): 1.80E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DNGIRPSSLEQMAK 2 Pept_E (Sonar search): 9.00E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DNGIRPSSLEQMAK 3 Pept_E (Sonar search): 3.80E-04
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070DNNPVVVLENELMYGVPFEFPPEAQSK 3 Pept_E (Sonar search): 3.00E-02
A6888LDHDD-lactate dehydrogenase, mitochondrialGI:23821029DNVLNLEVVLPDGR 2 MS2 score: 46
A4576ANXA5, ANX5, ENX2Annexin A5GI:999926DPDAGIDEAQVEQDAQALFQAGELK 3 MS2 score: 40
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301DPDM*VQNTVSELIK 2 Pept_E (Sonar search): 8.00E-02
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301DPDMVQNTVSELIK 2 Pept_E (Sonar search): 1.40E-01
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202DPEAPIFQVADYGIVADLFK 3 Pept_E (Sonar search): 1.70E-03
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:4503607DPEAPIFQVADYGIVADLFK 2 Pept_E (Sonar search): 9.40E-07
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:4503607DPEAPIFQVADYGIVADLFK 2 
A3197MYH2, MYHSA2Myosin-2GI:8923940DPLNETVVGLYQK 3 
A3202MYH7, MYHCBMyosin-7GI:4557773DPLNETVVGLYQK 2 Pept_E (Sonar search): 3.50E-04
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199DPNVVGQLAK 2 Pept_E (Sonar search): 6.70E-03
A211CNDUFB8NADH-ubiquinone oxidoreductase ASHI subunit, mitochondrial precursorGI:4689104DPWYSWDQPGLR 2 Pept_E (Sonar search): 6.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549DQEGQDVLLFIDNIFR 2 Pept_E (Sonar search): 7.10E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549DQEGQDVLLFIDNIFR 3 Pept_E (Sonar search): 1.60E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295DQEGQDVLLFIDNIFR 2 Pept_E (Sonar search): 1.30E-07
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295DQEGQDVLLFIDNIFR 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DQLLLGPTYATPK 2 Pept_E (Sonar search): 9.10E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327DQLLLGPTYATPK 3 Pept_E (Sonar search): 2.20E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203DQTDDQVTIDSALATQK 2 Pept_E (Sonar search): 3.60E-05
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203DQTDDQVTIDSALATQK 3 Pept_E (Sonar search): 7.40E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575DQTDDQVTIDSALATQK 2 Pept_E (Sonar search): 1.60E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575DQTDDQVTIDSALATQK 3 Pept_E (Sonar search): 7.80E-03
A5688ACSS1, ACAS2LAcetyl-coenzyme A synthetase 2-like, mitochondrial precursorGI:6996429DSAGDSDVVVQELK 2 Pept_E (Sonar search): 9.70E-03
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:10764847DSFPNFLACK 2 Pept_E (Sonar search): 5.70E-03
A6888LDHDD-lactate dehydrogenase, mitochondrialGI:23821029DSGLWFPVDPGADASLCGMAATGASGTNAVR 3 MS2 score: 43
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064DSIFSNLTGQLDYQGFEK 2 Pept_E (Sonar search): 3.50E-08
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064DSIFSNLTGQLDYQGFEK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DSIFSNLTGQLDYQGFEK 2 Pept_E (Sonar search): 1.60E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DSIFSNLTGQLDYQGFEK 3 Pept_E (Sonar search): 7.10E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DSSGQHVDVSPTSQR 2 Pept_E (Sonar search): 6.50E-07
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867DSSGQHVDVSPTSQR 3 Pept_E (Sonar search): 3.10E-06
A0362YWHAG14-3-3 protein gammaGI:5726310DSTLIMQLLR 2 
A163CMYL3, CMLC1Myosin light chain 3GI:9651188DTGTYEDFVEGLR 2 Pept_E (Sonar search): 1.30E-03
A163CMYL3, CMLC1Myosin light chain 3GI:9651188DTGTYEDFVEGLR 2 Pept_E (Sonar search): 1.00E-02
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025DTPENNPDTPFDFTPENYK 3 Pept_E (Sonar search): 6.60E-04
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025DTPENNPDTPFDFTPENYKR 3 Pept_E (Sonar search): 1.70E-03
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialGI:6980693DTPGFIVNR 2 Pept_E (Sonar search): 2.90E-01
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325DTSASAVAVGLK 2 Pept_E (Sonar search): 1.30E-04
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionGI:5679520DTSSSTTYMELNR 2 
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:1082723DTSYLFITGPDVVK 2 Pept_E (Sonar search): 2.20E-01
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:4557044DTSYLFITGPDVVK 2 Pept_E (Sonar search): 2.90E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826DVAAIAGGLVDAEALVALK 2 Pept_E (Sonar search): 9.20E-09
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:12740549DVAKPVIELYK 3 Pept_E (Sonar search): 3.70E-02
A7156NFS1, NIFS, HUSSY-08Cysteine desulfurase, mitochondrial precursorGI:3646132DVALSSGSACTSASLEPSYVLR 2 
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759DVCTFLR 2 Pept_E (Sonar search): 1.50E-01
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:135397DVNAAIATIK 2 Pept_E (Sonar search): 6.00E-02
A928BCYTB, cytb, CTYBCytochrome bGI:17985528DVNYGWIIR 2 Pept_E (Sonar search): 3.00E-02
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600DVPIGAIICITVGKPEDIEAFK 2 Pept_E (Sonar search): 2.20E-08
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511DVPLGTPLCIIVEK 3 Pept_E (Sonar search): 2.00E-03
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600DVPLGTPLCIIVEK 3 
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:6841440DVQGTDASLDEELDR 2 Pept_E (Sonar search): 9.30E-04
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:4758504DVQTALALAK 2 Pept_E (Sonar search): 5.00E-02
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356DVVFNYLHATAFQGTPLAQAVEGPSENVR 3 Pept_E (Sonar search): 7.20E-04
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841DVVFNYLHATAFQGTPLAQAVEGPSENVR 3 Pept_E (Sonar search): 1.10E-06
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841DVVFNYLHATAFQGTPLAQAVEGPSENVR 3 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252DVVVDLVCYR 2 Pept_E (Sonar search): 4.90E-03
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:10764847DYCAHHLIR 2 Pept_E (Sonar search): 2.30E-04
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:10764847DYCAHHLIR 2 Pept_E (Sonar search): 2.30E-05
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorGI:5802974DYGVLLEGSGLALR 2 Pept_E (Sonar search): 1.30E-03
A3202MYH7, MYHCBMyosin-7GI:4557773DYHIFYQILSNK 2 Pept_E (Sonar search): 9.70E-06
A3202MYH7, MYHCBMyosin-7GI:4557773DYHIFYQILSNK 3 
A3688CSCitrate synthase, mitochondrial precursorGI:4758076DYIWNTLNSGR 2 Pept_E (Sonar search): 3.20E-03
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774DYKVDQEIINIMQDR 2 Pept_E (Sonar search): 1.20E-04
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774DYKVDQEIINIMQDR 3 Pept_E (Sonar search): 9.70E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327EAALGAGFSDK 2 Pept_E (Sonar search): 1.60E-03
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550EAEEEFWYR 2 Pept_E (Sonar search): 5.20E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429EAEVVLCGGTESMSQAPYCVR 3 Pept_E (Sonar search): 7.00E-03
A214CNDUFB11, UNQ111/PRO1064, P17.3NADH-ubiquinone oxidoreductase ESSS subunit, mitochondrial precursorGI:9506683EANGLPIM*ESNCFDPSK 2 Pept_E (Sonar search): 4.30E-02
A214CNDUFB11, UNQ111/PRO1064, P17.3NADH-ubiquinone oxidoreductase ESSS subunit, mitochondrial precursorGI:9506683EANGLPIMESNCFDPSK 3 Pept_E (Sonar search): 9.20E-04
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575EANLAASFGK 2 Pept_E (Sonar search): 1.70E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536EANSIIITPGYGLCAAK 2 Pept_E (Sonar search): 1.40E-01
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536EANSIIITPGYGLCAAK 3 Pept_E (Sonar search): 2.20E-02
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:6166556EAPGPINFTVFLTMFGEK 2 Pept_E (Sonar search): 3.30E-06
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:6166556EAPGPINFTVFLTMFGEK 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199EAQVYQAFK 2 Pept_E (Sonar search): 1.50E-01
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589EAVTFLR 2 Pept_E (Sonar search): 6.00E-02
A275ACBX4Chromobox protein homolog 4GI:4502603EAVTGNGIGGKMK 2 Pept_E (Sonar search): 6.70E-05
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816EAYEAGLIGK 2 Pept_E (Sonar search): 9.30E-03
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728EAYM*GNVLQGGEGQAPTR 2 Pept_E (Sonar search): 5.10E-01
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728EAYM*GNVLQGGEGQAPTR 3 Pept_E (Sonar search): 5.40E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810EAYPGDVFYLHSR 2 Pept_E (Sonar search): 4.20E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810EAYPGDVFYLHSR 3 Pept_E (Sonar search): 3.80E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001EAYPGDVFYLHSR 2 Pept_E (Sonar search): 1.20E-08
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001EAYPGDVFYLHSR 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110EAYPGDVFYLHSR 2 Pept_E (Sonar search): 1.20E-05
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369EDAVSFAEK 2 Pept_E (Sonar search): 1.10E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867EDIANLADEFK 2 Pept_E (Sonar search): 1.30E-03
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:14735899EDLEELQAR 2 Pept_E (Sonar search): 9.90E-03
A643CTF, PRO1400Serotransferrin precursorGI:4557871EDLIWELLNQAQEHFGK 2 
A0999CFL1, CFLCofilin, non-muscle isoformGI:5031635EDLVFIFWAPESAPLK 2 Pept_E (Sonar search): 8.70E-04
A0999CFL1, CFLCofilin, non-muscle isoformGI:5031635EDLVFIFWAPESAPLK 2 
A7369PTGES2, PGES2Prostaglandin E synthase 2GI:13376617EDLYEAADK 2 Pept_E (Sonar search): 3.90E-01
A7200ND6, NADH6, MT-ND6NADH-ubiquinone oxidoreductase chain 6GI:66192EDPIGAGALYDYGR 2 MS2 score: 52
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103EDPNLVPSISNK 2 Pept_E (Sonar search): 8.00E-02
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103EDPNLVPSISNKR 3 Pept_E (Sonar search): 3.80E-03
A216CNDUFC2, HLC1NADH dehydrogenase [ubiquinone] 1 subunit C2GI:4886457EDYLYAVR 2 MS2 score: 58
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429EECDKYALQSQQR 3 Pept_E (Sonar search): 6.00E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007EEFAQSAIR 2 Pept_E (Sonar search): 6.80E-01
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525EEGIEYKVGKFPFAANSR 2 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007EEGPSAFWK 2 Pept_E (Sonar search): 1.30E-03
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997EEGVLTLWR 2 Pept_E (Sonar search): 4.10E-02
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312EEIIPVAAEYDK 2 Pept_E (Sonar search): 1.00E-01
A4750DSTN, ACTDP, DSNDestrinGI:5802966EELMFFLWAPELAPLK 2 
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312EFDELNPSAQR 2 Pept_E (Sonar search): 1.80E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558EFHGLGDCIIK 2 Pept_E (Sonar search): 2.00E-04
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558EFHGLGDCIIK 3 Pept_E (Sonar search): 1.10E-01
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817EFNGQHFILEEAITGDFALVK 2 
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursorGI:6624122EFQDAGEQVVSSPADVAEK 3 Pept_E (Sonar search): 1.80E-02
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069EFSIYMTK 2 Pept_E (Sonar search): 9.20E-01
A3793PHBProhibitinGI:4505773EFTEAVEAK 2 Pept_E (Sonar search): 1.70E-02
A1742HBB, beta-globinHemoglobin beta chainGI:229149EFTPPVQAAYQK 2 Pept_E (Sonar search): 2.60E-01
A1742HBB, beta-globinHemoglobin beta chainGI:1431650EFTPPVQAAYQK 2 Pept_E (Sonar search): 1.50E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327EGGQYGLVAACAAGGQGHAM*IVEAYPK 3 Pept_E (Sonar search): 3.30E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327EGGQYGLVAACAAGGQGHAMIVEAYPK 3 Pept_E (Sonar search): 1.00E-01
A3745SLC25A20, CAC, CACTMitochondrial carnitine/acylcarnitine carrier proteinGI:4557403EGITGLYR 2 Pept_E (Sonar search): 6.00E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075EGLLFEGR 2 Pept_E (Sonar search): 3.40E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228EGMAALQSDPWQQELYR 3 Pept_E (Sonar search): 9.90E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549EGNDLYHEM*IESGVINLK 3 Pept_E (Sonar search): 1.70E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549EGNDLYHEMIESGVINLK 3 Pept_E (Sonar search): 8.50E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295EGNDLYHEMIESGVINLK 2 Pept_E (Sonar search): 1.30E-07
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295EGNDLYHEMIESGVINLK 2 
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774EGQNYQQNCIK 2 Pept_E (Sonar search): 4.20E-02
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228EGSIEIDIPVPK 2 Pept_E (Sonar search): 1.20E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070EGVECEVINM*R 2 Pept_E (Sonar search): 2.10E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070EGVECEVINMR 2 Pept_E (Sonar search): 1.60E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541EGVVECSFVK 2 Pept_E (Sonar search): 3.40E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867EGWPLDIR 2 Pept_E (Sonar search): 1.30E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867EHAALEPRHLGGRAIITK 2 
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427EHINLGCDMDFDIAGPSIR 3 Pept_E (Sonar search): 1.50E-02
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609EIDGGLETLR- 2 Pept_E (Sonar search): 8.30E-03
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743EIEQEAAVELSQLR 2 Pept_E (Sonar search): 4.30E-04
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743EIEQEAAVELSQLR 3 Pept_E (Sonar search): 6.60E-04
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743EIEQEAAVELSQLRDPQHDLDR 3 Pept_E (Sonar search): 1.00E-02
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:414046EIFDIAFPDEQAEALAVER 3 Pept_E (Sonar search): 5.20E-03
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011EILAELTGR 2 Pept_E (Sonar search): 2.40E-02
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883EITALAPSTMK 2 Pept_E (Sonar search): 4.60E-02
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:23958133EIVHLQAGQCGNQIGAK 2 Pept_E (Sonar search): 6.80E-05
A0970CASQ2Calsequestrin, cardiac muscle isoform precursorGI:23503043EIVLELVAQVLEHK 2 Pept_E (Sonar search): 2.00E-07
A0970CASQ2Calsequestrin, cardiac muscle isoform precursorGI:23503043EIVLELVAQVLEHK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001EIVTNFLAGFEA 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110EIVTNFLAGFEA 2 Pept_E (Sonar search): 1.20E-07
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999EIWDMFGVFFANHPDLR 2 Pept_E (Sonar search): 1.70E-06
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999EIWDMFGVFFANHPDLR 2 
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:3859864EIYPYVIQELRPTLNELGISTPEELGLDK 3 Pept_E (Sonar search): 5.30E-03
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:3859864EIYPYVIQELRPTLNELGISTPEELGLDK 3 
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:3859864EIYPYVIQELRPTLNELGISTPEELGLDKV 3 
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759ELAAEVEVQDGPNEDGEMFMRPGK 3 Pept_E (Sonar search): 1.80E-01
A0388ATP5I, ATP5KATP synthase e chain, mitochondrialGI:6005717ELAEDDSILK 2 Pept_E (Sonar search): 3.80E-02
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611ELAMPGEDLK 2 Pept_E (Sonar search): 8.00E-02
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:16877874ELASQPDVDGFLVGGASLKPEFVDIINAK 3 Pept_E (Sonar search): 1.30E-03
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:16877874ELASQPDVDGFLVGGASLKPEFVDIINAK 3 
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080ELDPIQK 2 Pept_E (Sonar search): 5.40E-01
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768ELDSITPEVLPGWK 2 Pept_E (Sonar search): 7.90E-03
A0362YWHAG14-3-3 protein gammaGI:9507245ELEAVCQDVLSLLDNYLIK 2 Pept_E (Sonar search): 5.60E-06
A3692CKM, CKMMCreatine kinase, M chainGI:13938619ELFDPIISDR 2 Pept_E (Sonar search): 1.00E-01
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ELFPDWK 2 Pept_E (Sonar search): 1.90E-01
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ELGAFGLQVPSELGGVGLCNTQYAR 3 Pept_E (Sonar search): 9.30E-03
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390ELGEYGLQAYTEVK 2 Pept_E (Sonar search): 3.50E-03
A1863TSPO, BZRP, MBRTranslocator proteinGI:488425ELGGFTEK 2 MS2 score: 37
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735ELGIETYK 2 Pept_E (Sonar search): 2.20E-02
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291ELGLETYK 2 Pept_E (Sonar search): 2.20E-02
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteGI:18481635ELHLLGVQVQQFQDVATR 3 Pept_E (Sonar search): 3.50E-06
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteGI:18481635ELHLLGVQVQQFQDVATR 3 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325ELHSEFSEVMNEIWASDQIR 3 Pept_E (Sonar search): 7.80E-03
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363ELIDHSPK 2 Pept_E (Sonar search): 2.20E-01
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810ELIIGDR 2 Pept_E (Sonar search): 2.40E-01
A4406TRAP1, HSP75Heat shock protein 75 kDa, mitochondrial precursorGI:1082886ELISNASDALEK 2 MS2 score: 49
A0533S100A1, S100AProtein S100-A1GI:7428728ELLQTELSGFLDAQK 2 MS2 score: 60
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611ELLTEFGYK 2 Pept_E (Sonar search): 2.80E-02
A204CNDUFB1NADH dehydrogenase (ubiquinone) 1 beta subcomplex, subunit 1, 7kDaGI:3342004ELQPSEEVTWK 2 MS2 score: 42
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ELSGLGSALK 2 Pept_E (Sonar search): 1.00E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ELVEPVSR 2 Pept_E (Sonar search): 1.00E+00
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807ELWFSDDPNVTK 2 Pept_E (Sonar search): 4.30E-02
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ELWVIDEK 2 Pept_E (Sonar search): 4.40E-01
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:10764847EMVATQQEMMDAQLR 2 Pept_E (Sonar search): 4.30E-03
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918ENLEEEAIIMK 2 Pept_E (Sonar search): 2.90E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827ENM*AYTVECLR 2 Pept_E (Sonar search): 1.60E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827ENMAYTVECLR 2 Pept_E (Sonar search): 1.70E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827ENMAYTVECLR 3 Pept_E (Sonar search): 2.50E-02
A607CTIMM21, HSPC154, TIM21Mitochondrial import inner membrane translocase subunit Tim21GI:6841530ENPGSGEYDFR 2 MS2 score: 42
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777ENTEGEYSGIEHVIVDGVVQSIK 3 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777ENTEGEYSGIEHVIVDGVVQSIK 2 Pept_E (Sonar search): 3.00E-05
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312ENVLIGDGAGFK 2 Pept_E (Sonar search): 2.20E-03
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371EPATINYPFEK 2 Pept_E (Sonar search): 2.40E-01
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197EPIDIEEGIK 2 Pept_E (Sonar search): 9.60E-01
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080EPIPVLPTVHYNMGGIPTNYK 3 Pept_E (Sonar search): 2.90E-01
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810EPMQTGIK 2 Pept_E (Sonar search): 1.00E-01
A209CNDUFB6NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6GI:4505365EPVLPPQK 2 Pept_E (Sonar search): 5.00E-02
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197EQALQLAQK 2 Pept_E (Sonar search): 3.50E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618EQEHMINWVEK 2 Pept_E (Sonar search): 3.90E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618EQEHMINWVEK 3 Pept_E (Sonar search): 8.80E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558EQGFLSFWR 2 Pept_E (Sonar search): 3.50E-02
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199EQIDIFEGIK 2 Pept_E (Sonar search): 4.70E-02
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorGI:998943EQLGEFYEALDCLR 2 MS2 score: 73
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301EQWDTIEELIR 2 Pept_E (Sonar search): 1.80E-02
A3537DNAJC11DNAJ (HSP40) homolog, subfamily C, member 11GI:8922629ESAATDVLQK 2 Pept_E (Sonar search): 3.40E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788ESAGADTRPTVRPR 3 Pept_E (Sonar search): 7.00E-02
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981ESFAEMNR 2 Pept_E (Sonar search): 3.30E-02
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228ESLCQAALGLILK 2 Pept_E (Sonar search): 9.70E-03
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228ESLCQAALGLILK 2 
A5626ORM2, AGP2, AGP-BAlpha-1-acid glycoprotein 2 precursorGI:15680083ESTLHLVLR 2 
A6099COX3, COIII, CO3Cytochrome c oxidase polypeptide IIIGI:66257ESTYQGHHTPPVQK 3 Pept_E (Sonar search): 1.80E-03
A0439PHB2, BAP, REAProhibitin 2GI:6005854ESVFTVEGGHR 2 Pept_E (Sonar search): 6.00E-02
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850ESVPPSIIMSSQK 2 Pept_E (Sonar search): 1.10E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786ETAHWKPPPWNDVDPPKDTIVK 4 Pept_E (Sonar search): 2.90E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875ETAIELGYLTAEQFDEWVK 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238ETDLLLDDSLVSIFGNR 2 Pept_E (Sonar search): 2.50E-06
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238ETDLLLDDSLVSIFGNR 2 
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429ETPALTINR 2 Pept_E (Sonar search): 4.60E-02
A4576ANXA5, ANX5, ENX2Annexin A5GI:4502107ETSGNLEQLLLAVVK 2 Pept_E (Sonar search): 2.50E-05
A4576ANXA5, ANX5, ENX2Annexin A5GI:4502107ETSGNLEQLLLAVVK 2 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817ETVTILPGASFFSSDESFAMIR 2 Pept_E (Sonar search): 3.40E-05
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817ETVTILPGASFFSSDESFAMIR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810EVAAFAQFGSDLDAATQQLLSR 3 Pept_E (Sonar search): 3.40E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001EVAAFAQFGSDLDAATQQLLSR 2 Pept_E (Sonar search): 1.00E-08
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001EVAAFAQFGSDLDAATQQLLSR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110EVAAFAQFGSDLDAATQQLLSR 2 Pept_E (Sonar search): 6.70E-10
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536EVDILISTALIPGK 2 Pept_E (Sonar search): 6.00E-02
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007EVDVGLAADVGTLQR 2 Pept_E (Sonar search): 3.10E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325EVEAVIPDHCIFASNTSALPISEIAAVSK 3 Pept_E (Sonar search): 6.90E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325EVEAVIPDHCIFASNTSALPISEIAAVSK 4 Pept_E (Sonar search): 6.00E-02
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855EVENVAITALEGLK 2 Pept_E (Sonar search): 1.20E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855EVENVAITALEGLK 3 Pept_E (Sonar search): 2.30E-02
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774EVEQFTQVAK 2 Pept_E (Sonar search): 9.70E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356EVESM*GAHLNAYSTR 3 Pept_E (Sonar search): 7.10E-07
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356EVESMGAHLNAYSTR 2 Pept_E (Sonar search): 2.60E-05
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356EVESMGAHLNAYSTR 3 Pept_E (Sonar search): 1.10E-03
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609EVIAVSCGPAQCQETIR 2 Pept_E (Sonar search): 2.30E-01
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609EVIAVSCGPAQCQETIR 3 Pept_E (Sonar search): 1.00E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536EVLASDLVVK 2 Pept_E (Sonar search): 9.20E-03
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875EVM*LVGIGDK 2 Pept_E (Sonar search): 6.50E-04
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875EVMLVGIGDK 2 Pept_E (Sonar search): 3.80E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792EVNENFAIDLIAEQPVSEVETR 3 Pept_E (Sonar search): 1.30E-02
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359EVPNTVHQFQLDITVK 2 Pept_E (Sonar search): 4.00E-06
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359EVPNTVHQFQLDITVK 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327EVVDYIIFGTVIQEVK 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728EVVIVSATR 2 Pept_E (Sonar search): 7.50E-01
A0808MSNMoesinGI:14625824EVWFFGLQYQDTK 3 
A0326VIL2, EZREzrinGI:119717EVWYFGLHYVDNK 3 
A218CNDUFS5NADH dehydrogenase [ubiquinone] iron-sulfur protein 5GI:4758790EWIECAHGIGYTR 2 Pept_E (Sonar search): 6.40E-03
A218CNDUFS5NADH dehydrogenase [ubiquinone] iron-sulfur protein 5GI:4758790EWIECAHGIGYTR 3 Pept_E (Sonar search): 1.10E-03
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669EYLLQYNDPNR 2 Pept_E (Sonar search): 2.00E-01
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669EYLLQYNDPNRR 2 Pept_E (Sonar search): 3.80E-01
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669EYLLQYNDPNRR 3 Pept_E (Sonar search): 9.60E-01
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069EYLPIGGLAEFCK 2 Pept_E (Sonar search): 6.00E-03
A0439PHB2, BAP, REAProhibitin 2GI:6005854EYTAAVEAK 2 Pept_E (Sonar search): 1.80E-02
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011FAAAYCR 2 Pept_E (Sonar search): 2.80E-02
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775FACFER 2 Pept_E (Sonar search): 3.20E-02
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312FAEEADVVIVGAGPAGLSAAVR 3 Pept_E (Sonar search): 1.20E-06
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312FAEEADVVIVGAGPAGLSAAVR 2 
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorGI:2737886FAFDYATK 2 MS2 score: 39
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:1082723FANPFPAAVR 2 Pept_E (Sonar search): 1.30E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203FAQMLEK 2 Pept_E (Sonar search): 3.60E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575FAQMLEK 2 Pept_E (Sonar search): 2.20E-01
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816FAQQHQAR 2 Pept_E (Sonar search): 8.70E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FASEIAGVDDLGTTGR 2 Pept_E (Sonar search): 6.00E-05
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FASEIAGVDDLGTTGR 2 Pept_E (Sonar search): 1.60E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FASEIAGVDDLGTTGR 3 Pept_E (Sonar search): 1.50E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FAYDGLK 2 Pept_E (Sonar search): 3.10E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FAYDGLKR 2 Pept_E (Sonar search): 8.80E-03
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312FCPAGVYEFVPVEQGDGFR 3 Pept_E (Sonar search): 3.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FCYHER 2 Pept_E (Sonar search): 1.70E-01
A3793PHBProhibitinGI:4505773FDAGELITQR 2 Pept_E (Sonar search): 3.80E-03
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369FDECVLDK 2 Pept_E (Sonar search): 3.20E-02
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:135397FDGALNVDLTEFQTNLVPYPR 3 Pept_E (Sonar search): 1.90E-02
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:32015FDGALNVDLTEFQTNLVPYPR 2 Pept_E (Sonar search): 3.00E-03
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:32015FDGALNVDLTEFQTNLVPYPR 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301FDGGEEVLISGEFNDLR 2 Pept_E (Sonar search): 1.10E-02
A5984CTSD, CPSDCathepsin D precursorGI:67677FDGILGMAYPR 2 MS2 score: 49
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788FDLNSPWEAFPVYR 2 Pept_E (Sonar search): 1.10E-02
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999FDLNSPWEAFPVYR 2 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127FEAPLFNAR 2 Pept_E (Sonar search): 8.80E-03
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AGI:118102FEDENFILK 2 MS2 score: 33
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080FEDPKFEVIEKPQA 3 Pept_E (Sonar search): 1.20E-02
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999FEIVYNLLSLR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810FENAFLSHVVSQHQALLGTIR 3 Pept_E (Sonar search): 4.70E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810FENAFLSHVVSQHQALLGTIR 4 Pept_E (Sonar search): 8.00E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001FENAFLSHVVSQHQALLGTIR 3 Pept_E (Sonar search): 5.30E-11
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001FENAFLSHVVSQHQALLGTIR 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110FENAFLSHVVSQHQALLGTIR 3 Pept_E (Sonar search): 1.80E-11
A713BTMEM65Transmembrane protein 65GI:18569391FESIAIAQEK 2 Pept_E (Sonar search): 6.00E-02
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080FEVIEKPQA 2 Pept_E (Sonar search): 1.50E-01
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228FFEEVNDPAK 2 Pept_E (Sonar search): 1.10E-03
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850FFESFGDLSTPDAVMGNPK 3 Pept_E (Sonar search): 1.60E-03
A1742HBB, beta-globinHemoglobin beta chainGI:1431650FFESFGDLSTPDAVMGNPK 3 Pept_E (Sonar search): 6.00E-02
A5589SAA1Serum amyloid A proteinGI:337748FFGHGAEDSLADQAANEWGR 3 Pept_E (Sonar search): 8.50E-04
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359FFHETEAPRPK 2 Pept_E (Sonar search): 2.20E-03
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359FFHETEAPRPK 3 Pept_E (Sonar search): 6.10E-03
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359FFHETEAPRPK 2 Pept_E (Sonar search): 4.50E-04
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359FFHETEAPRPK 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301FFSPLQK 2 Pept_E (Sonar search): 1.20E-01
A5653ACAD9Acyl-CoA dehydrogenase family member 9, mitochondrial precursorGI:10436258FFTEEVDSR 2 Pept_E (Sonar search): 2.00E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536FFTGQITAAGK 2 Pept_E (Sonar search): 1.80E-04
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199FFVADTANEALEAAK 2 Pept_E (Sonar search): 1.50E-01
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199FFVADTANEALEAAK 3 Pept_E (Sonar search): 3.80E-02
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:27485520FFVADTANEALEAAK 2 Pept_E (Sonar search): 9.60E-08
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:27485520FFVADTANEALEAAK 2 
A3573BSG, hEMMPRIN, UNQ6505/PRO21383Basigin precursorGI:3492872FFVSSSQGR 2 MS2 score: 39
A7369PTGES2, PGES2Prostaglandin E synthase 2GI:13376617FGAVEGAVAK 2 Pept_E (Sonar search): 3.70E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FGELVM*TK 2 Pept_E (Sonar search): 4.80E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FGELVMTK 2 Pept_E (Sonar search): 2.50E-03
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775FGFYEVFK 2 Pept_E (Sonar search): 1.70E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FGGGNPELLTQM*VSK 2 Pept_E (Sonar search): 9.00E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FGGGNPELLTQMVSK 2 Pept_E (Sonar search): 1.80E-05
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FGGGNPELLTQMVSK 3 Pept_E (Sonar search): 2.90E-01
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536FGIHPVAGR 2 Pept_E (Sonar search): 7.70E-03
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312FGILTEK 2 Pept_E (Sonar search): 8.00E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252FGLEGCEVLIPALK 2 Pept_E (Sonar search): 1.80E-01
A218CNDUFS5NADH dehydrogenase [ubiquinone] iron-sulfur protein 5GI:4758790FGLNIDR 2 Pept_E (Sonar search): 2.90E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007FGLYLPK 2 Pept_E (Sonar search): 1.30E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228FGMAAALAGTMR 2 Pept_E (Sonar search): 7.50E-04
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728FGNEVIPVTVTVK 2 Pept_E (Sonar search): 1.20E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049FGPIPLGSLGWK 2 Pept_E (Sonar search): 2.60E-02
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292FGVEAFSDCLR 2 Pept_E (Sonar search): 2.80E-01
A317CRAB21Ras-related protein Rab-21GI:576556FHALGPIYYR 2 
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049FIHVSHLNANIK 2 Pept_E (Sonar search): 2.20E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:13097156FIHVSHLNANIK 2 Pept_E (Sonar search): 6.90E-05
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:13097156FIHVSHLNANIK 2 
A0369LDHBL-lactate dehydrogenase B chainGI:1200083FIIPQIVK 2 MS2 score: 39
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:15991829FKASGVEGADVVKLLNKAIK 2 
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080FLCLEFSQVNNPLISR 2 Pept_E (Sonar search): 8.30E-07
A348BCOA3, CCDC56, HSPC009Cytochrome c oxidase assembly factor 3 homolog, mitochondrialGI:12803723FLDELEDEAK 2 MS2 score: 62
A0535DES, CSM-7, CSM-6DesminGI:19698555FLEQQNAALAAEVNR 2 
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)GI:4507021FLFVLLGPEAPHIDYTQLGR 2 Pept_E (Sonar search): 3.20E-06
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)GI:4507021FLFVLLGPEAPHIDYTQLGR 2 
A7984TSTThiosulfate sulfurtransferaseGI:17402865FLGTEPEPDAVGLDSGHIR 3 Pept_E (Sonar search): 2.70E-03
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049FLNSFASMHR 2 Pept_E (Sonar search): 3.40E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049FLNSFASMHR 3 Pept_E (Sonar search): 8.60E-03
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080FLNYVQSQHQR 2 Pept_E (Sonar search): 6.20E-04
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080FLNYVQSQHQR 2 
A216CNDUFC2, HLC1NADH dehydrogenase [ubiquinone] 1 subunit C2GI:4886457FLPDEAR 2 MS2 score: 45
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorGI:4557833FLSDVYPDGFK 2 Pept_E (Sonar search): 1.40E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549FLSQPFQVAEVFTGHM*GK 3 Pept_E (Sonar search): 2.90E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549FLSQPFQVAEVFTGHMGK 3 Pept_E (Sonar search): 1.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295FLSQPFQVAEVFTGHMGK 2 Pept_E (Sonar search): 1.30E-06
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295FLSQPFQVAEVFTGHMGK 2 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327FNFLAPELPAVSEFSTSETMGHSADR 3 Pept_E (Sonar search): 5.90E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327FNNWGGSLSLGHPFGATGCR 3 Pept_E (Sonar search): 4.80E-05
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327FNNWGGSLSLGHPFGATGCR 3 Pept_E (Sonar search): 8.00E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867FNPETDYLTGTDGK 2 Pept_E (Sonar search): 3.30E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867FNPETDYLTGTDGKK 3 Pept_E (Sonar search): 9.00E-02
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075FNTSDVSAIEK 2 Pept_E (Sonar search): 6.00E-02
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301FNVIQPGPIK 2 Pept_E (Sonar search): 2.40E-02
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657FNVTGTPEQYVPYSTTR 2 Pept_E (Sonar search): 8.40E-03
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657FNVTGTPEQYVPYSTTR 3 Pept_E (Sonar search): 8.10E-03
A4372PPIF, CYP3Peptidyl-prolyl cis-trans isomerase FGI:5031987FPDENFTLK 2 MS2 score: 40
A7452PNPT1, PNPASE, OLD35Polyribonucleotide nucleotidyltransferase 1, mitochondrial precursorGI:24943088FPEADPYEIIESFNVVAK 2 
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985FPNQNQTR 2 Pept_E (Sonar search): 2.50E-02
A7199ND5, MTND5, NADH5NADH-ubiquinone oxidoreductase chain 5GI:13273155FPTLTNINENNPTLLNPIKR 3 Pept_E (Sonar search): 5.00E-04
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2GI:30582727FQLTDCQIYEVLSVIR 2 Pept_E (Sonar search): 7.20E-03
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2GI:30582727FQLTDCQIYEVLSVIR 2 
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345FQNALLVR 2 Pept_E (Sonar search): 2.40E-01
A520AH3F3A, H3F3B, H3.3AH3 histone, family 3AGI:4504279FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK 3 Pept_E (Sonar search): 5.30E-07
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371FRGEHALR 2 
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025FSCEPAGGLTSLTEPPK 3 Pept_E (Sonar search): 9.00E-02
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025FSCEPAGGLTSLTEPPKGPGFGVQAGL 3 Pept_E (Sonar search): 3.10E-01
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:12653199FSHEEIAMATVTALR 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493FSM*VVQDGIVK 2 Pept_E (Sonar search): 4.40E-02
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493FSMVVQDGIVK 2 Pept_E (Sonar search): 4.00E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303FSPLTTNLINLLAENGR 2 Pept_E (Sonar search): 2.30E-03
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303FSPLTTNLINLLAENGR 3 Pept_E (Sonar search): 7.00E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303FSPLTTNLINLLAENGR 2 
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356FTGSEIR 2 Pept_E (Sonar search): 1.60E-01
A9661MRPS10, MSTP040, PNAS-12228S ribosomal protein S10, mitochondrialGI:7022681FTLLQSVHIYK 2 Pept_E (Sonar search): 3.80E-03
A9661MRPS10, MSTP040, PNAS-12228S ribosomal protein S10, mitochondrialGI:7022681FTLLQSVHIYK 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549FTQAGSEVSALLGR 2 Pept_E (Sonar search): 5.00E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549FTQAGSEVSALLGR 3 Pept_E (Sonar search): 1.50E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295FTQAGSEVSALLGR 2 Pept_E (Sonar search): 2.10E-08
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295FTQAGSEVSALLGR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325FVDLYGAQK 2 Pept_E (Sonar search): 4.30E-02
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:1255604FVEGLPINDFSR 2 MS2 score: 43
A424AFHL1, SLIM1Skeletal muscle LIM-protein 1GI:2146974FVFHQEQVYCPDCAK 3 Pept_E (Sonar search): 4.70E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541FVFSLVDAM*NGK 2 Pept_E (Sonar search): 3.30E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541FVFSLVDAMNGK 2 Pept_E (Sonar search): 1.90E-02
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735FVGGSGQVSER 2 Pept_E (Sonar search): 4.10E-02
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291FVGGSGQVSER 2 Pept_E (Sonar search): 4.10E-02
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069FVTVQTISGTGALR 2 Pept_E (Sonar search): 1.10E-03
A4996MYOM2Myomesin 2GI:4505315FVVHGLTTGEQYIFR 2 Pept_E (Sonar search): 1.80E-05
A4996MYOM2Myomesin 2GI:4505315FVVHGLTTGEQYIFR 2 
A1609CALR, CRTCCalreticulin precursorGI:4757900FYALSASFEPFSNK 2 
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369FYFWTK 2 Pept_E (Sonar search): 8.60E-01
A607CTIMM21, HSPC154, TIM21Mitochondrial import inner membrane translocase subunit Tim21GI:6841530FYIEGSEPGK 2 MS2 score: 37
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735FYLGGPTSVR 2 Pept_E (Sonar search): 3.70E-01
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4GI:4505357FYSVNVDYSK 2 Pept_E (Sonar search): 4.00E-03
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4GI:4505357FYSVNVDYSK 2 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817FYTDPVEAVK 2 Pept_E (Sonar search): 2.80E-02
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359FYVGHDP 2 Pept_E (Sonar search): 5.30E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075GAALITAVGVR 2 Pept_E (Sonar search): 7.00E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558GADIM*YTGTVDCWR 2 Pept_E (Sonar search): 7.30E-04
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558GADIM*YTGTVDCWR 3 Pept_E (Sonar search): 1.30E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455GADIMYTGTVDCWR 2 Pept_E (Sonar search): 4.40E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:4502097GADIMYTGTVDCWR 3 
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558GADIMYTGTVDCWR 2 Pept_E (Sonar search): 2.00E-02
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2GI:113463GADIMYTGTVDCWR 2 Pept_E (Sonar search): 1.20E-01
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:17475023GADPEETILNAFK 2 Pept_E (Sonar search): 5.90E-03
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GAGAYICGEETALIESIEGK 2 Pept_E (Sonar search): 1.80E-04
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GAGAYICGEETALIESIEGK 3 Pept_E (Sonar search): 9.70E-04
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568GAGAYICGEETALIESIEGK 2 Pept_E (Sonar search): 8.10E-04
A5742AFG3L2AFG3-like protein 2GI:5802970GAILTGPPGTGK  2 Pept_E (Sonar search): 3.10E-03
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492GALQNIIPASTGAAK 2 Pept_E (Sonar search): 3.30E-02
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492GALQNIIPASTGAAK 3 Pept_E (Sonar search): 4.50E-01
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011GANQWIK 2 Pept_E (Sonar search): 7.10E-01
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312GAPLNTPVTEDR 2 Pept_E (Sonar search): 1.80E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558GAWSNVLR 2 Pept_E (Sonar search): 2.70E-01
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755GAWSNVLR 2 Pept_E (Sonar search): 3.80E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541GCDVVVIPAGVPR 2 Pept_E (Sonar search): 1.50E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541GCDVVVIPAGVPR 3 Pept_E (Sonar search): 6.00E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GDARPAEIDSLWEISK 2 Pept_E (Sonar search): 2.00E-01
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GDARPAEIDSLWEISK 3 Pept_E (Sonar search): 2.10E-07
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075GDFIALDLGGSSFR 2 Pept_E (Sonar search): 7.00E-03
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011GDFIPGLR 2 Pept_E (Sonar search): 2.30E-01
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363GDGPWYYYETIDK 2 Pept_E (Sonar search): 7.50E-04
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:442613GDVTAQIALQPALK 2 Pept_E (Sonar search): 8.60E-03
A4962MARCKS, MACS, PRKCSLMyristoylated alanine-rich C-kinase substrateGI:187385GEAAAERPGEAAVASSPSK 3 MS2 score: 34
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611GEETPVIVGSALCALEGR 2 Pept_E (Sonar search): 1.20E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611GEETPVIVGSALCALEGR 3 Pept_E (Sonar search): 7.30E-04
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786GEFGVYLVSDGSSRPYR 2 Pept_E (Sonar search): 4.30E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786GEFGVYLVSDGSSRPYR 3 Pept_E (Sonar search): 2.40E-04
A6992MDH1, MDHAMalate dehydrogenase, cytoplasmicGI:1255604GEFVTTVQQR 2 MS2 score: 62
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GEFYNEASNLQVAIR 2 Pept_E (Sonar search): 1.70E-05
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GEFYNEASNLQVAIR 2 Pept_E (Sonar search): 8.00E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GEFYNEASNLQVAIR 3 Pept_E (Sonar search): 2.00E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568GEFYNEASNLQVAIR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080GEGGILINSQGER 2 Pept_E (Sonar search): 2.20E-03
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:627367GEGPDVDVNLPK 2 Pept_E (Sonar search): 1.60E-01
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKGI:627367GEGPEVDVNLPK 2 Pept_E (Sonar search): 7.00E-02
A7844SOD2Superoxide dismutase [Mn], mitochondrial precursorGI:442613GELLEAIK 2 Pept_E (Sonar search): 7.30E-01
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303GEVPCTVTSASPLEEATLSELK 2 Pept_E (Sonar search): 5.50E-01
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011GFCHLCDGQEACCVGLEAGINPTDHLITAYR 4 Pept_E (Sonar search): 4.20E-01
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083GFEGSFEELCR 2 Pept_E (Sonar search): 2.20E-03
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201GFGFGLVK 2 Pept_E (Sonar search): 6.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549GFQQILAGEYDHLPEQAFYMVGPIEEAVAK 3 Pept_E (Sonar search): 6.00E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295GFQQILAGEYDHLPEQAFYMVGPIEEAVAK 3 Pept_E (Sonar search): 2.10E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295GFQQILAGEYDHLPEQAFYMVGPIEEAVAK 3 
A3688CSCitrate synthase, mitochondrial precursorGI:4758076GFSIPECQK 2 Pept_E (Sonar search): 7.70E-01
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:14735899GFVTADMIR 2 Pept_E (Sonar search): 4.10E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064GFYIYQEGVK 2 Pept_E (Sonar search): 9.10E-05
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064GFYIYQEGVK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325GFYIYQEGVK 2 Pept_E (Sonar search): 2.20E-03
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorGI:2250701GGAEVQIFAPDVPQMHVIDHTK 3 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GGAGFPTGLK 2 Pept_E (Sonar search): 7.80E-04
A3692CKM, CKMMCreatine kinase, M chainGI:13938619GGDDLDPNYVLSSR 2 Pept_E (Sonar search): 1.60E-03
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985GGDISVCEWYQR 2 Pept_E (Sonar search): 1.70E-03
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:30584127GGDISVCEWYQR 3 
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:30584127GGDISVCEWYQR 2 Pept_E (Sonar search): 1.70E-04
A3688CSCitrate synthase, mitochondrial precursorGI:14603295GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK 3 Pept_E (Sonar search): 6.00E-03
A3688CSCitrate synthase, mitochondrial precursorGI:14603295GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK 3 
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialGI:4008131GGEIQPVSVK 2 Pept_E (Sonar search): 4.10E-01
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GGHVDLTMLGAMQVSK 2 Pept_E (Sonar search): 1.10E-04
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GGHVDLTMLGAMQVSK 2 
A6230COX7A1, COX7AHCytochrome c oxidase polypeptide VIIa-heart, mitochondrial precursorGI:4502987GGIVDNILYR 2 Pept_E (Sonar search): 2.20E-01
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:4758504GGIVGMTLPIAR 2 Pept_E (Sonar search): 6.00E-02
A0647ANXA1, ANX1, LPC1Annexin A1GI:4502101GGPGSAVSPYPTFNPSSDVAALHK 3 Pept_E (Sonar search): 1.40E-02
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581GGQTHLGLPVFNTVK 2 Pept_E (Sonar search): 1.00E-03
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581GGQTHLGLPVFNTVK 3 Pept_E (Sonar search): 4.10E-03
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GGTWFAGFGR 2 Pept_E (Sonar search): 9.00E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568GGTWFAGFGR 1 Pept_E (Sonar search): 5.80E-03
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568GGTWFAGFGR 2 
A6231COX7A2, COX7ALCytochrome C oxidase polypeptide VIIa-liver/heart, mitochondrial precursorGI:4502989GGVADALLYR 2 Pept_E (Sonar search): 4.50E-03
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13436359GHHVAQLDPLGILDADLDSSVPADIISSTDK 3 
A6664GSR, GLUR, GRD1Glutathione reductase, mitochondrial precursorGI:10835189GHIIVDEFQNTNVK 2 Pept_E (Sonar search): 1.40E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867GHLDNISNNLLIGAINIENGK 3 Pept_E (Sonar search): 1.70E-05
A137CABCC5, MRP5ATP-binding cassette, sub-family C (CFTR/MRP), member 5GI:4587083GHLLLDSDER 2 
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:23958133GHYTEGAELVDSVLDVVR 2 Pept_E (Sonar search): 4.30E-08
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:2119276GHYTEGAELVDSVLDVVR 2 Pept_E (Sonar search): 2.60E-04
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:2119276GHYTEGAELVDSVLDVVR 2 
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312GIATNDVGIQK 2 Pept_E (Sonar search): 9.80E-04
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511GIDLTQVK 2 Pept_E (Sonar search): 4.00E-01
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768GIEQAVQSHAVAEEEAR 2 Pept_E (Sonar search): 1.70E-04
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768GIEQAVQSHAVAEEEAR 3 Pept_E (Sonar search): 1.30E-05
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GIFNGFSVTLK 2 Pept_E (Sonar search): 1.90E-03
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:6031192GIFNGFSVTLK 1 
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GIFNGFSVTLKEDGVR 3 Pept_E (Sonar search): 1.70E-03
A6823AK2, ADK2Adenylate kinase 2, mitochondrialGI:7524346GIHSAIDASQTPDVVFASILAAFSK 3 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609GIHVEVPPAEAER 3 Pept_E (Sonar search): 2.10E-03
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305GILAADESTGSIAK 2 Pept_E (Sonar search): 3.00E-05
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392GINTLVTYDMVPEPK 2 Pept_E (Sonar search): 2.50E-03
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392GINTLVTYDMVPEPK 2 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040GIQEIADSVK  2 Pept_E (Sonar search): 8.30E-03
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083GIQVSNNGPCLGSR 2 Pept_E (Sonar search): 6.40E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810GIRPAINVGLSVSR 3 Pept_E (Sonar search): 2.00E-05
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536GITHIGYTDLPSR 2 Pept_E (Sonar search): 9.30E-05
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536GITHIGYTDLPSR 2 Pept_E (Sonar search): 1.50E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:21732286GITHIGYTDLPSR 3 
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611GITINAAHVEYSTAAR 3 Pept_E (Sonar search): 1.30E-02
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384GITINAAHVEYSTAAR 2 Pept_E (Sonar search): 4.90E-07
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384GITINAAHVEYSTAAR 2 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312GIVFEDVK 2 Pept_E (Sonar search): 9.00E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049GIVNAVKDPDANGK 2 Pept_E (Sonar search): 1.00E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049GIVNAVKDPDANGK 3 Pept_E (Sonar search): 1.30E-05
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228GIVNEQFLLQR 2 Pept_E (Sonar search): 1.70E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521GIWHNYDK 1 Pept_E (Sonar search): 6.00E-03
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997GIYTGLSAGLLR 2 Pept_E (Sonar search): 3.00E-02
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359GKIELEETIK 2 Pept_E (Sonar search): 6.00E-02
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359GKIELEETIK 3 Pept_E (Sonar search): 1.10E-01
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171GLAPEQPVTLR 2 Pept_E (Sonar search): 6.80E-01
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875GLCGAIHSSIAK 3 Pept_E (Sonar search): 1.00E-01
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875GLCGAIHSSIAK 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103GLDPYNVLAPK 2 Pept_E (Sonar search): 5.20E-04
A6246MLYCDMalonyl-CoA decarboxylase, mitochondrial precursorGI:5231269GLFHHISK 2 
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorGI:5802974GLFIIDPNGVIK 2 Pept_E (Sonar search): 2.60E-02
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 2GI:7657347GLFTGLTPR 2 Pept_E (Sonar search): 1.60E-02
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:113950GLGTDEDSLIEIICSR 2 MS2 score: 40
A4576ANXA5, ANX5, ENX2Annexin A5GI:4502107GLGTDEESILTLLTSR 2 Pept_E (Sonar search): 1.10E-03
A4576ANXA5, ANX5, ENX2Annexin A5GI:4502107GLGTDEESILTLLTSR 2 
A5742AFG3L2AFG3-like protein 2GI:5802970GLGYAQYLPK 2 Pept_E (Sonar search): 9.90E-01
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669GLIENPALLR 2 Pept_E (Sonar search): 6.80E-03
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007GLIPQLIGVAPEK 2 Pept_E (Sonar search): 1.10E-02
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202GLLPEELTPLILATQK 2 Pept_E (Sonar search): 6.90E-01
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202GLLPEELTPLILATQK 3 Pept_E (Sonar search): 2.40E-02
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759GLLSSLDHTSIR 2 Pept_E (Sonar search): 2.60E-05
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759GLLSSLDHTSIR 3 Pept_E (Sonar search): 6.10E-05
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040GLLTPIIK 2 Pept_E (Sonar search): 7.00E-02
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2564245GLLTPIIK 1 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826GLLTYTSWEDALSR 2 Pept_E (Sonar search): 2.10E-10
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826GLLTYTSWEDALSR 3 
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorGI:2465178GLPDQMLYR 2 MS2 score: 45
A6230COX7A1, COX7AHCytochrome c oxidase polypeptide VIIa-heart, mitochondrial precursorGI:4502987GLPDQMLYR 2 Pept_E (Sonar search): 1.70E-02
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855GLSLPPACTR 2 Pept_E (Sonar search): 7.80E-01
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GLTAVSNNAGVDNFGLGLLLR 2 Pept_E (Sonar search): 2.80E-08
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GLTAVSNNAGVDNFGLGLLLR 2 
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GLTLIELWEGLTVDDVQK 2 Pept_E (Sonar search): 1.70E-05
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817GLTLIELWEGLTVDDVQK 2 
A0369LDHBL-lactate dehydrogenase B chainGI:1200083GLTSVINQK 2 MS2 score: 36
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:14250516GLVAVITGGASGLGLATAER 2 Pept_E (Sonar search): 2.80E-06
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:14250516GLVAVITGGASGLGLATAER 2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589GLVVPVIR 2 Pept_E (Sonar search): 7.00E-02
A3688CSCitrate synthase, mitochondrial precursorGI:4758076GLVYETSVLDPDEGIR 2 Pept_E (Sonar search): 8.90E-03
A3688CSCitrate synthase, mitochondrial precursorGI:4758076GLVYETSVLDPDEGIR 3 Pept_E (Sonar search): 4.20E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325GLYPAPLK 2 Pept_E (Sonar search): 2.00E-02
A5742AFG3L2AFG3-like protein 2GI:5802970GM*GGLFSVGETTAK 2 Pept_E (Sonar search): 1.30E-01
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810GM*SLNLEPDNVGVVVFGNDK 2 Pept_E (Sonar search): 1.90E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810GM*SLNLEPDNVGVVVFGNDK 3 Pept_E (Sonar search): 5.10E-04
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301GM*TTLLSSLGAQCVIASR 3 Pept_E (Sonar search): 3.30E-01
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455GMGGAFVLVLYDEIK 2 Pept_E (Sonar search): 3.70E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:4502097GMGGAFVLVLYDEIK 2 
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2GI:27764863GMGGAFVLVLYDELK 2 Pept_E (Sonar search): 3.20E-04
A5742AFG3L2AFG3-like protein 2GI:5802970GMGGLFSVGETTAK 2 Pept_E (Sonar search): 3.70E-02
A370BPLGRKT, MDS030Transmembrane protein C9ORF46GI:12314123GMITFESIEK 2 Pept_E (Sonar search): 2.20E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810GMSLNLEPDNVGVVVFGNDK 3 Pept_E (Sonar search): 1.40E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001GMSLNLEPDNVGVVVFGNDK 2 Pept_E (Sonar search): 3.10E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001GMSLNLEPDNVGVVVFGNDK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110GMSLNLEPDNVGVVVFGNDK 2 Pept_E (Sonar search): 3.10E-04
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301GMTTLLSSLGAQCVIASR 3 Pept_E (Sonar search): 8.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127GNDM*QVGTYIEK 2 Pept_E (Sonar search): 2.90E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127GNDMQVGTYIEK 2 Pept_E (Sonar search): 7.00E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558GNLANVIR 2 Pept_E (Sonar search): 3.60E-02
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755GNLANVIR 2 Pept_E (Sonar search): 3.60E-02
A5742AFG3L2AFG3-like protein 2GI:5802970GPAGIGRTGRGMGGLFSVGETTAK 2 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816GPDWILGEIK 2 Pept_E (Sonar search): 2.30E-02
A5589SAA1Serum amyloid A proteinGI:337748GPGGVWAAEAISDAR 2 Pept_E (Sonar search): 5.10E-03
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171GPGVGLLGISK 2 Pept_E (Sonar search): 1.20E-04
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011GPILM*ELQTYR 2 Pept_E (Sonar search): 4.10E-02
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011GPILMELQTYR 2 Pept_E (Sonar search): 3.40E-04
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:4572548GPILMELQTYR 2 Pept_E (Sonar search): 2.80E-05
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:4572548GPILMELQTYR 2 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687GPNGASAGVAAQHSQCFAAWYGHCPGLK 3 Pept_E (Sonar search): 2.90E-05
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083GPNVFKGYLK 2 Pept_E (Sonar search): 4.90E-03
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083GPNVFQGYLKDPAK 3 Pept_E (Sonar search): 2.50E-02
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:14735899GPSGLLTYTGK 2 Pept_E (Sonar search): 1.10E-04
A7121CYB5R3, DIA1, B5RDiaphoraseGI:352335GPSGLLVYQGK 2 Pept_E (Sonar search): 3.30E-04
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionGI:8918518GPSVFPLAPSSK 2 MS2 score: 37
A210CNDUFB7NADH-ubiquinone oxidoreductase B18 subunitGI:10764847GQGPGEVDPK 2 Pept_E (Sonar search): 7.00E-02
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463GQHWLLDGFPR 2 Pept_E (Sonar search): 3.20E-04
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463GQHWLLDGFPR 2 
A0261PFKM, PFKX6-phosphofructokinase, muscle typeGI:14043654GQIEEAGWSYVGGWTGQGGSK 2 Pept_E (Sonar search): 7.10E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228GQLTTDQVFPYPSVLNEEQTQFLK 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228GQLTTDQVFPYPSVLNEEQTQFLK 3 Pept_E (Sonar search): 4.20E-02
A3202MYH7, MYHCBMyosin-7GI:4557773GQNVQQVIYATGALAK 2 Pept_E (Sonar search): 2.50E-06
A3202MYH7, MYHCBMyosin-7GI:4557773GQNVQQVIYATGALAK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203GRPTSTNPIASIFAWTR 3 Pept_E (Sonar search): 6.30E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575GRPTSTNPIASIFAWTR 3 Pept_E (Sonar search): 7.40E-01
A0439PHB2, BAP, REAProhibitin 2GI:6005854GSDSLIK 2 Pept_E (Sonar search): 2.60E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786GSGIQWDLR 2 Pept_E (Sonar search): 2.00E-03
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007GSGSVVGELMYK 2 Pept_E (Sonar search): 5.00E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR 4 Pept_E (Sonar search): 8.00E-02
A5616NS5ATP1, HIBADH3-hydroxyisobutyrate dehydrogenase, mitochondrial precursorGI:6624122GSLLIDSSTIDPAVSK 2 Pept_E (Sonar search): 3.30E-01
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GSSASLVLK 2 Pept_E (Sonar search): 3.10E-01
A3202MYH7, MYHCBMyosin-7GI:4557773GSSFQTVSALHR 2 
A425AFHL2, DRAL, SLIM3Skeletal muscle LIM-protein 3GI:21361124GSSWHETCFICHR 2 Pept_E (Sonar search): 2.10E-06
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorGI:5802974GTAVVNGEFK 2 Pept_E (Sonar search): 6.30E-03
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850GTFATLSELHCDK 2 Pept_E (Sonar search): 7.80E-03
A1742HBB, beta-globinHemoglobin beta chainGI:229149GTFATLSELHCDK 2 Pept_E (Sonar search): 7.80E-03
A1742HBB, beta-globinHemoglobin beta chainGI:229149GTFATLSELHCDK 3 Pept_E (Sonar search): 6.00E-02
A1742HBB, beta-globinHemoglobin beta chainGI:1431650GTFATLSELHCDK 2 Pept_E (Sonar search): 7.80E-03
A1742HBB, beta-globinHemoglobin beta chainGI:1431650GTFATLSELHCDK 3 Pept_E (Sonar search): 1.90E-02
A1742HBB, beta-globinHemoglobin beta chainGI:4504349GTFATLSELHCDK 3 
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855GTGGVDTAAVADVYDISNIDR 2 Pept_E (Sonar search): 1.60E-06
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855GTGGVDTAAVADVYDISNIDR 3 Pept_E (Sonar search): 9.10E-05
A3692CKM, CKMMCreatine kinase, M chainGI:13938619GTGGVDTAAVGSVFDVSNADR 2 Pept_E (Sonar search): 8.00E-02
A3202MYH7, MYHCBMyosin-7GI:4557773GTLEDQIIQANPALEAFGNAK 2 
A8813GLRX5Glutaredoxin-related protein 5, mitochondrialGI:28193244GTPEQPQCGFSNAVVQILR 2 Pept_E (Sonar search): 8.30E-03
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202GTSFDAAATSGGSASSEK 2 Pept_E (Sonar search): 3.10E-03
A1143EPB3, SLC4A1, AE1Solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)GI:4507021GTVLLDLQETSLAGVANQLLDR 2 
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611GTVVTGTLER 2 Pept_E (Sonar search): 3.30E-02
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5042402GVAGALRPLVQATVPATPEQPVLDLK 2 
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743GVAGALRPLVQATVPATPEQPVLDLK 3 Pept_E (Sonar search): 8.80E-06
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743GVAGALRPLVQATVPATPEQPVLDLK 4 Pept_E (Sonar search): 1.90E-01
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GVAPLWM*R 2 Pept_E (Sonar search): 1.20E-01
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GVAPLWMR 2 Pept_E (Sonar search): 5.80E-03
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:113950GVDEVTIVNILTNR 2 MS2 score: 37
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:8699626GVDNTFADELVELSTALEHQEYITFLEDLK 3 Pept_E (Sonar search): 1.20E-05
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:8699626GVDNTFADELVELSTALEHQEYITFLEDLK 3 
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511GVETIANDVVSLATK 2 Pept_E (Sonar search): 3.40E-03
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511GVETIANDVVSLATK 3 Pept_E (Sonar search): 3.20E-02
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600GVETIANDVVSLATK 2 Pept_E (Sonar search): 3.50E-06
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorGI:2250700GVEVTVGHEQEEGGK 3 Pept_E (Sonar search): 1.60E-05
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080GVIALCIEDGSIHR 3 Pept_E (Sonar search): 1.40E-01
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:4758504GVIINTASVAAFEGQVGQAAYSASK 3 Pept_E (Sonar search): 4.60E-01
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493GVLFGVPGAFTPGCSK 2 Pept_E (Sonar search): 6.00E-02
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463GVLHQFSGTETNK 3 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688GVPQIEVTFDIDANGIVHVSAK 2 
A0451HSPA5, GRP78Heat shock 70kDa protein 5GI:16507237GVPQIEVTFEIDVNGILR 2 
A3793PHBProhibitinGI:4505773GVQDIVVGEGTHFLIPWVQK 2 
A3793PHBProhibitinGI:4505773GVQDIVVGEGTHFLIPWVQKPIIFDCR 3 Pept_E (Sonar search): 2.50E-07
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305GVVPLAGTNGETTTQGLDGLSER 3 Pept_E (Sonar search): 7.20E-01
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768GVYSEETLR 2 Pept_E (Sonar search): 1.30E-02
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775GWAPTFLGYSMQGLCK 2 Pept_E (Sonar search): 1.00E-01
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855GWEFMWNER 2 Pept_E (Sonar search): 2.30E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127GWNILTNSEK 2 Pept_E (Sonar search): 1.70E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541GYLGPEQLPDCLK 2 Pept_E (Sonar search): 2.50E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541GYLGPEQLPDCLK 3 Pept_E (Sonar search): 2.50E-02
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883GYSFVTTAER 2 Pept_E (Sonar search): 4.50E-03
A4555ACTA1, ACTAActin, alpha skeletal muscleGI:4501881GYSFVTTAER 2 
A3202MYH7, MYHCBMyosin-7GI:12053672HADSVAELGEQIDNLQR 3 Pept_E (Sonar search): 3.90E-05
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816HAGGVTGGWDNLLAVIPGGSSTPLIPK 3 Pept_E (Sonar search): 1.60E-01
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568HAGGVTGGWDNLLAVIPGGSSTPLIPK 2 Pept_E (Sonar search): 4.40E-06
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568HAGGVTGGWDNLLAVIPGGSSTPLIPK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810HALIIYDDLSK 2 Pept_E (Sonar search): 3.60E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810HALIIYDDLSK 3 Pept_E (Sonar search): 1.80E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001HALIIYDDLSK 2 Pept_E (Sonar search): 9.80E-06
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001HALIIYDDLSK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110HALIIYDDLSK 2 Pept_E (Sonar search): 5.20E-08
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001HALIIYDDLSKQAVAYR 2 
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369HCAEPFTEYWTCIDYTGQQLFR 3 Pept_E (Sonar search): 4.50E-07
A5932BLVRB, FLRFlavin reductaseGI:4502419HDLGHFMLR 2 Pept_E (Sonar search): 3.20E-04
A5932BLVRB, FLRFlavin reductaseGI:4502419HDLGHFMLR 2 
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:4758012HDVVFLITK 2 
A9807AZU1Azurocidin precursorGI:27924394HFCGGALIHAR 3 Pept_E (Sonar search): 3.80E-05
A9807AZU1Azurocidin precursorGI:27924394HFCGGALIHAR 3 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069HFIEQGINVCLCQSYAK 3 Pept_E (Sonar search): 6.30E-07
A159CMBMyoglobinGI:17389985HGATVLTALGGILK 2 Pept_E (Sonar search): 2.10E-16
A159CMBMyoglobinGI:17389985HGATVLTALGGILK 2 
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759HGGEDYVFSLLTGYCEPPTGVSLR 3 Pept_E (Sonar search): 1.10E-06
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:19353103HGGEDYVFSLLTGYCEPPTGVSLR 2 Pept_E (Sonar search): 3.10E-08
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189HGLLESAVAAR 2 
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:21735621HGVYNPNK 2 
A7346PDK4, PDHK4Pyruvate dehydrogenase [lipoamide kinase] isozyme 4, mitochondrial precursorGI:4505693HHNVVPTMAQGIIEYK 2 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13436359HHVLHDQNVDK 2 
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:7706455HIYLSTR 2 
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:123678HIYYITGETK 2 Pept_E (Sonar search): 8.10E-03
A0191HSP90AA1, HSP90A, HSPC1Heat shock protein HSP 90-alphaGI:123678HIYYITGETK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325HLAILGAGLMGAGIAQVSVDK 3 Pept_E (Sonar search): 1.30E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356HLGGIPWTYAEDAVPTLTPCR 3 Pept_E (Sonar search): 6.80E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841HLGGIPWTYAEDAVPTLTPCR 2 Pept_E (Sonar search): 2.10E-06
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875HLLIGVSSDR 2 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:21361103HLNYTEFTQFLQELQLEHAR 3 Pept_E (Sonar search): 2.10E-08
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:21361103HLNYTEFTQFLQELQLEHAR 3 
A495AH2AFZ, H2AZHistone H2A.zGI:4504255HLQLAIR 2 
A7227BCKDHA2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursorGI:8176547HLQTYGEHYPLDHFDK 3 
A7501PRDX3, mer5, AOP1Thioredoxin-dependent peroxide reductase, mitochondrial precursorGI:5802974HLSVNDLPVGR 2 Pept_E (Sonar search): 2.20E-02
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759HLVGVCYTEDEAK 3 Pept_E (Sonar search): 3.40E-04
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189HLWDLLLELTLEK 2 Pept_E (Sonar search): 1.70E-04
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189HLWDLLLELTLEK 3 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777HMGLFDHAAR 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1GI:8923930HNEETGDNVGPLIIK 3 Pept_E (Sonar search): 2.10E-05
A7979ACAA2Acetyl-CoA acyltransferase 2GI:12804931HNFTPLAR 2 
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorGI:5901982HNNLDLVIIR 2 
A6096COQ6, CGI-10Ubiquinone biosynthesis monooxgenase COQ6GI:28193180HNTALLAATDLLK 2 Pept_E (Sonar search): 4.00E-08
A6096COQ6, CGI-10Ubiquinone biosynthesis monooxgenase COQ6GI:28193180HNTALLAATDLLK 2 
A1581ALB, GIG20, GIG42Serum albumin precursorGI:7959791HPDYSVVLLLR 2 Pept_E (Sonar search): 4.00E-04
A1581ALB, GIG20, GIG42Serum albumin precursorGI:7959791HPDYSVVLLLR 2 
A159CMBMyoglobinGI:230638HPGDFGADAQGAM*NK 3 Pept_E (Sonar search): 7.00E-06
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867HPNGTQETILLNHTFNETQIEWFR 3 
A1581ALB, GIG20, GIG42Serum albumin precursorGI:4502027HPYFYAPELLFFAK 2 
A0535DES, CSM-7, CSM-6DesminGI:19698555HQIQSYTCEIDALK 3 
A0007ACTN2Alpha-actinin 2GI:4501893HRPDLIDYSK 3 Pept_E (Sonar search): 9.20E-04
A0007ACTN2Alpha-actinin 2GI:4501893HRPDLIDYSK 2 
A6934LYPLAL1Lysophospholipase-like 1GI:20270341HSASLIFLHGSGDSGQGLR 2 Pept_E (Sonar search): 5.30E-04
A6934LYPLAL1Lysophospholipase-like 1GI:20270341HSASLIFLHGSGDSGQGLR 2 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040HSLDASQGTATGPR 3 Pept_E (Sonar search): 1.80E-06
A6517FMO6P, FMO6Putative dimethylaniline monooxygenase [N-oxide forming] 6GI:27677886HSQFIGYPITLFVEK 2 Pept_E (Sonar search): 5.50E-05
A4815FLNC, ABPL, FLN2Filamin CGI:4557597HTIIISWGGVNVPK 2 
A0007ACTN2Alpha-actinin 2GI:4501893HTNYTMEHIR 3 Pept_E (Sonar search): 4.70E-04
A306CUQCRQ, QP-CCytochrome B-C1 complex subunit 8GI:7657486HVISYSLSPFEQR 3 Pept_E (Sonar search): 1.10E-03
A163CMYL3, CMLC1Myosin light chain 3GI:9651188HVLATLGER 2 
A4372PPIF, CYP3Peptidyl-prolyl cis-trans isomerase FGI:5031987HVVFGHVK 2 Pept_E (Sonar search): 6.80E-03
A4372PPIF, CYP3Peptidyl-prolyl cis-trans isomerase FGI:5031987HVVFGHVK 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618HVVQSISTQQEK 3 Pept_E (Sonar search): 1.50E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618HVVQSISTQQEKETIAK 3 Pept_E (Sonar search): 2.10E-03
A9666MRPS16, RPMS16, CGI-13228S ribosomal protein S16, mitochondrial precursorGI:7705626HWIGCGAHLSK 2 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13436359HWLDSPWPGFFTLDGQPR 2 Pept_E (Sonar search): 4.00E-03
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13436359HWLDSPWPGFFTLDGQPR 2 
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384HYAHTDCPGHADYVK 2 Pept_E (Sonar search): 1.10E-06
A7365PGAM4, PGAM3, PGAM-BProbable phosphoglycerate mutase 4GI:26006838HYGGLTGLNK 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618HYLFDVQR 1 Pept_E (Sonar search): 3.70E-03
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618HYLFDVQR 2 Pept_E (Sonar search): 7.00E-02
A7227BCKDHA2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursorGI:8176547HYLLSQGWWDEEQEK 2 
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981HYVYGPLPQSFDK 3 Pept_E (Sonar search): 2.60E-03
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:5921895HYVYGPLPQSFDK 2 Pept_E (Sonar search): 8.30E-04
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:5921895HYVYGPLPQSFDK 3 
A345ESPRYD4SPRY domain-containing protein 4GI:18089178HYWEVTVK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069IAAAILNTPDLR 2 Pept_E (Sonar search): 9.80E-03
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280IAALQAFADQLIAAGHYAK 2 Pept_E (Sonar search): 3.90E-05
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007IADLPPANPDHIGGYR 3 Pept_E (Sonar search): 6.00E-02
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777IAEFAFEYAR 2 Pept_E (Sonar search): 5.50E-04
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777IAEFAFEYAR 2 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777IAEFAFEYAR 2 Pept_E (Sonar search): 1.30E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356IAEVDASVVR 2 Pept_E (Sonar search): 8.50E-04
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322IAFQYGVTDLR 2 
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918IALLPLLQAETDR 2 Pept_E (Sonar search): 2.00E-01
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918IALLPLLQAETDRR 2 Pept_E (Sonar search): 1.30E-01
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918IALLPLLQAETDRR 3 Pept_E (Sonar search): 2.30E-01
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007IAPLAEGALPYNLAELQR 3 Pept_E (Sonar search): 6.70E-03
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463IAQNFGLQHLSSGHFLR 2 Pept_E (Sonar search): 3.80E-07
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463IAQNFGLQHLSSGHFLR 2 
A1948MGST3Microsomal glutathione S-transferase 3GI:4758714IASGLGLAWIVGR 2 Pept_E (Sonar search): 2.40E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826IASQVAALDLGYKPGVEAIR 2 Pept_E (Sonar search): 1.90E-06
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127IASQVAALDLGYKPGVEAIR 3 Pept_E (Sonar search): 1.30E-02
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735ICDGVQFGAGIR 2 Pept_E (Sonar search): 4.30E-03
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252ICEEAFAR 2 Pept_E (Sonar search): 4.40E-02
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735ICELYAK 2 Pept_E (Sonar search): 8.00E-02
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:27499463ICEVDLVISLNIPFETLK 2 Pept_E (Sonar search): 4.00E-03
A6825AK3L1, AK3L2, AK3Adenylate kinase isoenzyme 4, mitochondrialGI:30147958ICEVDLVISLNIPFETLK 2 Pept_E (Sonar search): 3.10E-04
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197ICNQVLVCER 2 Pept_E (Sonar search): 1.50E-03
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:433413ICPVETLVEEAIQCAEK 2 Pept_E (Sonar search): 7.80E-07
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:14286220ICPVETLVEEAIQCAEK 2 Pept_E (Sonar search): 1.40E-04
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199IDATQVEVNPFGETPEGQVVCFDAK 3 Pept_E (Sonar search): 2.70E-04
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356IDDMMFVLQGQWMR 2 Pept_E (Sonar search): 1.90E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075IDEAILITWTK 2 Pept_E (Sonar search): 9.00E-02
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080IDEYDYSKPIQGQQK 3 Pept_E (Sonar search): 2.20E-01
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575IDVSIEAASGGK 2 Pept_E (Sonar search): 1.30E-04
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777IEAACFATIK 2 Pept_E (Sonar search): 3.10E-02
A0380ATP5DATP synthase delta chain, mitochondrial precursorGI:4502297IEANEALVK 2 Pept_E (Sonar search): 9.50E-03
A1423COL6A3Collagen alpha 3(VI) chain precursorGI:17149811IEDGVPQHLVLVLGGK 2 
A3202MYH7, MYHCBMyosin-7GI:4557773IEDMAMLTFLHEPAVLYNLK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672IEELEEELEAER 2 Pept_E (Sonar search): 1.60E-02
A163CMYL3, CMLC1Myosin light chain 3GI:9651188IEFTPEQIEEFK 2 Pept_E (Sonar search): 2.30E-01
A206CNDUFB3NADH-ubiquinone oxidoreductase B12 subunitGI:4505361IEGTPLETIQK 2 Pept_E (Sonar search): 9.20E-01
A206CNDUFB3NADH-ubiquinone oxidoreductase B12 subunitGI:4505361IEGTPLETIQKK 3 Pept_E (Sonar search): 5.10E-03
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221IETSINLAWTAGSNNTR 2 Pept_E (Sonar search): 6.00E-01
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609IEVIKPGDLGVDLTSK 2 Pept_E (Sonar search): 2.50E-02
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609IEVIKPGDLGVDLTSK 3 Pept_E (Sonar search): 7.70E-03
A218CNDUFS5NADH dehydrogenase [ubiquinone] iron-sulfur protein 5GI:4758790IEYDDFVECLLR 2 Pept_E (Sonar search): 6.00E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547IEYDTFGELK 2 Pept_E (Sonar search): 7.00E-02
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570IFEEDPAVGAIVLTGGDK 3 Pept_E (Sonar search): 1.40E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228IFEGTNDILR 2 Pept_E (Sonar search): 8.00E-02
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735IFFAGTETATK 2 Pept_E (Sonar search): 1.20E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228IFGSEAAWK 2 Pept_E (Sonar search): 2.20E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541IFGVTTLDIVR 2 Pept_E (Sonar search): 5.60E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:21735621IFGVTTLDIVR 2 Pept_E (Sonar search): 1.40E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:21735621IFGVTTLDIVR 2 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816IFTNLYGR 2 Pept_E (Sonar search): 9.40E-03
A3793PHBProhibitinGI:4505773IFTSIGEDYDER 2 Pept_E (Sonar search): 5.40E-03
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:2661039IGAEVYHNLK 2 Pept_E (Sonar search): 2.60E-05
A3615ENO1, ENO1L1, MBPB1Alpha enolaseGI:2661039IGAEVYHNLK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069IGASFLQR 2 Pept_E (Sonar search): 1.10E-02
A5769ALDH9A1, ALDH4, ALDH7Aldehyde dehydrogenase 9A1GI:1354222IGDPLLEDTR 2 Pept_E (Sonar search): 1.50E-03
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305IGEHTPSALAIMENANVLAR 3 Pept_E (Sonar search): 3.50E-05
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083IGFFQGDIR 2 Pept_E (Sonar search): 1.40E-02
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2GI:1220311IGGIGTVPVGR 2 Pept_E (Sonar search): 2.20E-02
A0439PHB2, BAP, REAProhibitin 2GI:6005854IGGVQQDTILAEGLHFR 2 Pept_E (Sonar search): 1.60E-03
A0439PHB2, BAP, REAProhibitin 2GI:6005854IGGVQQDTILAEGLHFR 3 Pept_E (Sonar search): 6.20E-05
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorGI:4557233IGIASQALGIAQTALDCAVNYAENR 3 Pept_E (Sonar search): 1.10E-06
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312IGIFGQDEDVTSK 2 Pept_E (Sonar search): 2.90E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IGLFGGAGVGK 2 Pept_E (Sonar search): 6.30E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IGLFGGAGVGK 1 Pept_E (Sonar search): 2.40E-06
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IGLFGGAGVGK 2 
A3201MYH6, MYHCA, alpha-MHCMyosin-6GI:27764861IHFGATGK 1 Pept_E (Sonar search): 8.80E-04
A3202MYH7, MYHCBMyosin-7GI:4557773IHFGATGK 1 
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:32015IHFPLATYAPVISAEK 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228IHNFGLIQEK 1 Pept_E (Sonar search): 5.30E-04
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228IHNFGLIQEK 2 
A0742TTNTitinGI:17066105IHSLVLHNCR 3 Pept_E (Sonar search): 8.60E-04
A0742TTNTitinGI:17066105IHSLVLHNCR 2 
A3681GLUD2, GLUDP1Glutamate dehydrogenase 2, mitochondrial precursorGI:6912392IIAEGANGPTTPEADK 2 Pept_E (Sonar search): 9.80E-04
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687IIDTPISEMGFAGIAVGAAMAGLR 2 
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228IIEEAPAPGIK 2 Pept_E (Sonar search): 5.10E-03
A6822AK1Adenylate kinase isoenzyme 1GI:66932IIFVVGGPGSGK 2 MS2 score: 43
A887APTRF, FKSG13Polymerase I and transcript release factorGI:11034809IIGAVDQIQLTQAQLEER 2 
A887APTRF, FKSG13Polymerase I and transcript release factorGI:27484006IIGAVDQIQLTQAQLEER 3 MS2 score: 60
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844IIWQFIK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575IIWQFIK 2 Pept_E (Sonar search): 8.90E-01
A6934LYPLAL1Lysophospholipase-like 1GI:20270341IIYPTAPPR 2 MS2 score: 51
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786IKAPGFAHLAGLDK 3 Pept_E (Sonar search): 1.10E-01
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197ILACDDLDEAAR 2 Pept_E (Sonar search): 2.90E-04
A6658GRHPR, GLXR, MSTP035Glyoxylate reductaseGI:6912396ILDAAGANLK 2 MS2 score: 53
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:2134870ILDDPSPPQPGEEK 2 Pept_E (Sonar search): 1.30E-02
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:2134870ILDDPSPPQPGEEK 3 Pept_E (Sonar search): 3.10E-02
A6094COQ3, UG0215E05Hexaprenyldihydroxybenzoate methyltransferase, mitochondrialGI:14754031ILDVGCGGGLLTEPLGR 2 Pept_E (Sonar search): 1.80E-01
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848ILDVLEEIPK 2 Pept_E (Sonar search): 5.10E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070ILEDNSIPQVK 2 Pept_E (Sonar search): 5.00E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070ILEDNSIPQVK 3 Pept_E (Sonar search): 1.70E-01
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:21756162ILEFIAVSQLR 2 
A6888LDHDD-lactate dehydrogenase, mitochondrialGI:23821029ILELNQEDFSVVVEPGVTR 2 MS2 score: 34
A3793PHBProhibitinGI:4505773ILFRPVASQLPR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810ILGADTSVDLEETGR 2 Pept_E (Sonar search): 2.30E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810ILGADTSVDLEETGR 3 Pept_E (Sonar search): 7.00E-02
A7646CRYZCrystallin zetaGI:585013ILGTAGTEEGQK 2 MS2 score: 68
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390ILGYINTGK 2 Pept_E (Sonar search): 5.70E-01
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536ILIVGGGVAGLASAGAAK 2 Pept_E (Sonar search): 2.50E-03
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:21732286ILIVGGGVAGLASAGAAK 2 Pept_E (Sonar search): 6.00E-03
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:21732286ILIVGGGVAGLASAGAAK 2 
A0850VIMVimentinGI:37852ILLAELEQLK 2 MS2 score: 63
A6096COQ6, CGI-10Ubiquinone biosynthesis monooxgenase COQ6GI:4680659ILLLEAGPK 2 MS2 score: 57
A0045GNA12Guanine nucleotide-binding protein, alpha-12 subunitGI:4156172ILLLGAGESGK 2 Pept_E (Sonar search): 8.90E-03
A9358IL23R, IL-23RInterleukin-23 receptorGI:24430212ILLLIPK 2 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040ILM*PSLSPTM*EEGNIVK 3 Pept_E (Sonar search): 2.70E-01
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040ILMPSLSPTMEEGNIVK 2 Pept_E (Sonar search): 3.30E-03
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199ILNNSGLPITSAIDLEDAAK 3 Pept_E (Sonar search): 1.90E-04
A3202MYH7, MYHCBMyosin-7GI:12053672ILNPAAIPEGQFIDSR 3 Pept_E (Sonar search): 1.10E-02
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807ILPEYLSNWTMEK 2 Pept_E (Sonar search): 1.00E-01
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807ILPEYLSNWTMEK 3 Pept_E (Sonar search): 1.00E+00
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826ILQDIASGSHPFSQVLK 2 Pept_E (Sonar search): 1.20E-06
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127ILQDIASGSHPFSQVLK 2 Pept_E (Sonar search): 8.50E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127ILQDIASGSHPFSQVLK 3 Pept_E (Sonar search): 4.90E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325ILQEGVDPK 2 Pept_E (Sonar search): 2.20E-01
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788ILTDYGFEGHPFR 3 Pept_E (Sonar search): 3.10E-04
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999ILTDYGFEGHPFR 2 
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511ILVAEGTR 2 Pept_E (Sonar search): 1.30E-01
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016ILYM*TDEVNDPSLTIK 2 Pept_E (Sonar search): 4.90E-03
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016ILYM*TDEVNDPSLTIK 3 Pept_E (Sonar search): 8.90E-03
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016ILYMTDEVNDPSLTIK 2 Pept_E (Sonar search): 2.70E-02
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016ILYMTDEVNDPSLTIK 3 Pept_E (Sonar search): 2.50E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IM*DPNIVGSEHYDVAR 3 Pept_E (Sonar search): 1.70E-05
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070IM*EGPAFNFLDAPAVR 2 Pept_E (Sonar search): 2.00E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070IM*EGPAFNFLDAPAVR 3 Pept_E (Sonar search): 7.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IM*NVIGEPIDER 2 Pept_E (Sonar search): 5.10E-01
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735IMDLLGDQVK 2 Pept_E (Sonar search): 2.90E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IMDPNIVGSEHYDVAR 3 Pept_E (Sonar search): 4.60E-06
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070IMEGPAFNFLDAPAVR 2 Pept_E (Sonar search): 2.70E-04
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070IMEGPAFNFLDAPAVR 2 Pept_E (Sonar search): 3.70E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070IMEGPAFNFLDAPAVR 3 Pept_E (Sonar search): 2.40E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687IMEGPAFNFLDAPAVR 2 Pept_E (Sonar search): 8.50E-05
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687IMEGPAFNFLDAPAVR 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IMNVIGEPIDER 2 Pept_E (Sonar search): 2.60E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IMNVIGEPIDER 3 Pept_E (Sonar search): 1.10E-02
A4616CDH13, CDHHCadherin-13 precursorGI:4502719INENTGSVSVTR 2 Pept_E (Sonar search): 1.30E-03
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199INFDDNAEFR 2 Pept_E (Sonar search): 1.80E-02
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197INFDSNSAYR 2 Pept_E (Sonar search): 2.50E-03
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorGI:4557833INGWAVECR 2 Pept_E (Sonar search): 7.00E-02
A5191TUBB2C, TUBB4B, TUBB2Tubulin beta-2 chainGI:5174735INVYYNEATGGK 2 Pept_E (Sonar search): 3.00E-02
A9867Em:AF200455.10, DEFA1, Em:AF200455.12Neutrophil defensin 1 precursorGI:228797IPACIAGER 2 Pept_E (Sonar search): 6.40E-03
A5541CRYAB, CRYA2Alpha crystallin B chainGI:4503057IPADVDPLTITSSLSSDGVLTVNGPR 3 Pept_E (Sonar search): 3.30E-06
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322IPDTIVVVAGNK 2 
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291IPEDEIWQSEPESVDVPAQPITTTFLER 3 Pept_E (Sonar search): 9.00E-02
A170DUNQ2439/PRO5000, PFTL2439, UNQ2439UPF0317 protein C14ORF159, mitochondrialGI:21749754IPEVHHISQDPLHYSIASVSASQK 3 Pept_E (Sonar search): 3.00E-06
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265IPHFGYCDEIDLTELVK 2 Pept_E (Sonar search): 4.20E-07
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356IPLAEWESR 2 Pept_E (Sonar search): 2.50E-03
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228IPLSQEEITLQGHAFEAR 3 Pept_E (Sonar search): 1.50E-03
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575IPNIYAIGDVVAGPMLAHK 3 Pept_E (Sonar search): 3.00E-05
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525IPNIYAIGDVVAGPMLAHK 2 Pept_E (Sonar search): 3.10E-06
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525IPNIYAIGDVVAGPMLAHK 3 
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049IPQAIAQLSK 2 Pept_E (Sonar search): 4.60E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IPSAVGYQPTLATDM*GTM*QER 3 Pept_E (Sonar search): 6.00E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IPSAVGYQPTLATDMGTMQER 3 Pept_E (Sonar search): 1.70E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IPSAVGYQPTLATDMGTMQER 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549IPVGPETLGR 2 Pept_E (Sonar search): 5.80E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IPVGPETLGR 1 Pept_E (Sonar search): 1.10E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IPVGPETLGR 1 
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547IPVHPNDHVNK 3 Pept_E (Sonar search): 1.20E-01
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875IPVHPNDHVNK 2 
A0439PHB2, BAP, REAProhibitin 2GI:6005854IPWFQYPIIYDIR 2 Pept_E (Sonar search): 6.10E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541IQEAGTEVVK 2 Pept_E (Sonar search): 2.60E-02
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379IQEIIEQLDVTTSEYEK 3 Pept_E (Sonar search): 5.00E-02
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657IQEWIPPSTPYK 2 Pept_E (Sonar search): 3.30E-02
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657IQEWIPPSTPYK 3 Pept_E (Sonar search): 1.10E-02
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorGI:27436901IQQLVQDIASLTLLEISDLNELLK 3 Pept_E (Sonar search): 9.90E-05
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorGI:27436901IQQLVQDIASLTLLEISDLNELLK 3 
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775IQTQPGYANTLR 2 Pept_E (Sonar search): 1.50E-03
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775IQTQPGYANTLR 3 Pept_E (Sonar search): 2.80E-03
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581ISALQSAGVVVSMSPAQLGTTIYK 3 Pept_E (Sonar search): 8.70E-03
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807ISGLGLTPEQK 2 Pept_E (Sonar search): 4.50E-03
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4GI:223582ISGLIYEETR 2 Pept_E (Sonar search): 9.70E-03
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379ISSIQSIVPALEIANAHR 3 Pept_E (Sonar search): 3.10E-04
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511ISVNDFIIK 2 Pept_E (Sonar search): 2.40E-01
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228ITAFVVER 2 Pept_E (Sonar search): 2.40E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:12804931ITAHLVHELR 2 Pept_E (Sonar search): 9.50E-05
A7979ACAA2Acetyl-CoA acyltransferase 2GI:12804931ITAHLVHELR 2 
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorGI:2250700ITDLANLSAANHDAAIFPGGFGAAK 3 Pept_E (Sonar search): 5.70E-03
A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursorGI:227487ITEIYEGTSEIQR 2 MS2 score: 47
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1GI:6456828ITLPVDFVTADKFDENAK 3 Pept_E (Sonar search): 1.30E-02
A5669ACOT13, THEM2, HT012Acyl-coenzyme A thioesterase 13GI:4210351ITLVSAAPGK 2 Pept_E (Sonar search): 5.90E-04
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionGI:5679520ITMSRDTSSSTTYM 2 
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075ITPELLTR 2 Pept_E (Sonar search): 1.40E-01
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855ITQGQFDEHYVLSSR 2 Pept_E (Sonar search): 6.80E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855ITQGQFDEHYVLSSR 3 Pept_E (Sonar search): 1.10E-05
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521ITQGQFDEHYVLSSR 2 
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768ITSAYLQDIENAYK 2 Pept_E (Sonar search): 4.80E-04
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768ITSAYLQDIENAYKK 2 Pept_E (Sonar search): 3.80E-01
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768ITSAYLQDIENAYKK 3 Pept_E (Sonar search): 2.00E-04
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ITTHYTIYPR 2 Pept_E (Sonar search): 8.20E-04
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312ITTHYTIYPR 2 
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorGI:30584913ITVHFINR 2 
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorGI:30584913ITVHFINR 2 Pept_E (Sonar search): 5.50E-04
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728IVAFADAAVEPIDFPIAPVYAASMVLK 3 Pept_E (Sonar search): 1.20E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IVAVIGAVVDVQFDEGLPPILNALEVQGR 3 Pept_E (Sonar search): 3.70E-08
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IVAVIGAVVDVQFDEGLPPILNALEVQGR 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295IVAVIGAVVDVQFDEGLPPILNALEVQGRETR 3 
A170DUNQ2439/PRO5000, PFTL2439, UNQ2439UPF0317 protein C14ORF159, mitochondrialGI:13376437IVEDAVEQGVLK 2 Pept_E (Sonar search): 9.60E-03
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559IVEYEKEMEK 3 Pept_E (Sonar search): 3.00E-01
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197IVFSPEEAK 2 Pept_E (Sonar search): 2.70E-02
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:30584725IVGCICEEDNTSVVWFWLHK 3 Pept_E (Sonar search): 6.60E-06
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:4557237IVGHLTHALK 2 Pept_E (Sonar search): 1.50E-05
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:4557237IVGHLTHALK 2 
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1GI:8923930IVHAFDM*EDLGDK 3 Pept_E (Sonar search): 6.30E-03
A8711CISD1, ZCD1, MDS029CDGSH iron sulfur domain-containing protein 1GI:8923930IVHAFDMEDLGDK 3 Pept_E (Sonar search): 1.70E-02
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261IVNSAQTGSFK 2 Pept_E (Sonar search): 1.10E-03
A3688CSCitrate synthase, mitochondrial precursorGI:4758076IVPNVLLEQGK 2 Pept_E (Sonar search): 4.40E-04
A0439PHB2, BAP, REAProhibitin 2GI:6005854IVQAEGEAEAAK 2 Pept_E (Sonar search): 8.50E-04
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007IVQLLAGVADQTK 2 Pept_E (Sonar search): 1.80E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007IVQLLAGVADQTK 3 Pept_E (Sonar search): 1.40E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867IVYGHLDDPASQEIER 2 Pept_E (Sonar search): 2.80E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867IVYGHLDDPASQEIER 3 Pept_E (Sonar search): 5.20E-05
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1GI:14250401IWHHTFYNELR 2 Pept_E (Sonar search): 4.50E-09
A4552ACTG1, ACTGActin, cytoplasmic 2GI:30158852IWHHTFYNKLR 2 
A4100COQ7Ubiquinone biosynthesis protein COQ7 homologGI:7706391IYAGQMAVLGR 2 Pept_E (Sonar search): 6.00E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547IYELAAGGTAVGTGLNTR 2 Pept_E (Sonar search): 2.80E-05
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875IYELAAGGTAVGTGLNTR 2 Pept_E (Sonar search): 4.80E-03
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875IYELAAGGTAVGTGLNTR 2 
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875IYGLGSLALYEK 2 Pept_E (Sonar search): 8.30E-05
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875IYGLGSLALYEK 2 Pept_E (Sonar search): 2.10E-03
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875IYGLGSLALYEK 2 
A0439PHB2, BAP, REAProhibitin 2GI:1673514IYLTADNLVLNLQDESFTR 2 
A0439PHB2, BAP, REAProhibitin 2GI:6005854IYLTADNLVLNLQDESFTR 2 Pept_E (Sonar search): 2.00E-02
A0439PHB2, BAP, REAProhibitin 2GI:6005854IYLTADNLVLNLQDESFTR 3 Pept_E (Sonar search): 1.70E-03
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312IYQIYEGTSQIQR 2 Pept_E (Sonar search): 1.70E-02
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:7542837IYQIYEGTSQIQR 3 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007IYSTLAGTR 2 Pept_E (Sonar search): 8.80E-03
A3793PHBProhibitinGI:4505773KAAIISAEGDSK 2 Pept_E (Sonar search): 2.60E-02
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807KAALSASEGEEVPQDK 3 Pept_E (Sonar search): 4.90E-01
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2GI:4505355KANPDLPILIR 3 Pept_E (Sonar search): 6.60E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327KAQDEGLLSDVVPFK 3 Pept_E (Sonar search): 3.30E-03
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883KDLYANNVLSGGTTMYPGIADR 3 Pept_E (Sonar search): 6.00E-02
A0999CFL1, CFLCofilin, non-muscle isoformGI:5031635KEDLVFIFWAPESAPLK 2 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011KEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVR 4 Pept_E (Sonar search): 1.10E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788KFDLNSPWEAFPVYR 3 Pept_E (Sonar search): 3.30E-04
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291KFVGGSGQVSER 3 Pept_E (Sonar search): 2.10E-01
A678E Hypothetical protein XP_105089GI:18543694KGEKGVTKPYK 2 
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103KGLDPYNVLAPK 2 Pept_E (Sonar search): 2.90E-03
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103KGLDPYNVLAPK 3 Pept_E (Sonar search): 1.10E-04
A7194ND1, NADH1, ROPN1BNADH-ubiquinone oxidoreductase chain 1GI:17062054KGPNVVGPYGLLQPFADAMK 3 Pept_E (Sonar search): 1.60E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR 4 Pept_E (Sonar search): 7.00E-01
A7731POLR1A, RPA1DNA-directed RNA polymerase I largest subunitGI:7661686KHMMGK 1 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064KLDSLTTSFGFPVGAATLVDEVGVDVAK 3 Pept_E (Sonar search): 3.40E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064KLDSLTTSFGFPVGAATLVDEVGVDVAK 3 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325KLDSLTTSFGFPVGAATLVDEVGVDVAK 3 Pept_E (Sonar search): 8.90E-03
A3793PHBProhibitinGI:4505773KLEAAEDIAYQLSR 2 Pept_E (Sonar search): 3.50E-02
A3793PHBProhibitinGI:4505773KLEAAEDIAYQLSR 3 Pept_E (Sonar search): 4.00E-04
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848KLEDQLQGGQLEEVILQAEHELNLAR 3 Pept_E (Sonar search): 2.80E-03
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848KLEDQLQGGQLEEVILQAEHELNLAR 4 Pept_E (Sonar search): 4.80E-03
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848KLEDQLQGGQLEEVILQAEHELNLAR 3 Pept_E (Sonar search): 8.10E-12
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848KLEDQLQGGQLEEVILQAEHELNLAR 3 
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427KLETAVNLAWTAGNSNTR 3 Pept_E (Sonar search): 1.80E-04
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322KLEVYQSIADLMVGAK 2 Pept_E (Sonar search): 3.20E-03
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10280538KPAPVPAEPFDNTTYK 3 Pept_E (Sonar search): 9.40E-05
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10835087KPAPVPAEPFDNTTYK 2 Pept_E (Sonar search): 1.10E-02
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10835087KPAPVPAEPFDNTTYK 3 Pept_E (Sonar search): 4.50E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127KPMVVLGSSALQR 2 Pept_E (Sonar search): 4.40E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127KPMVVLGSSALQR 3 Pept_E (Sonar search): 3.80E-03
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875KPPTFGDASVIALELLNSGYEFDEGSIIFNK 3 Pept_E (Sonar search): 1.40E-05
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875KPPTFGDASVIALELLNSGYEFDEGSIIFNK 3 
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867KQGLLPLTFADPADYNK 3 Pept_E (Sonar search): 4.50E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127KTESIDVMDAVGSNIVVSTR 3 Pept_E (Sonar search): 1.10E-03
A931BCYCS, CYCCytochrome CGI:15929398KTGQAPGYSYTAANK 3 Pept_E (Sonar search): 3.30E-04
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345KVPQVSTPTLVEVSR 3 Pept_E (Sonar search): 1.60E-03
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768KVVEDIEYLK 2 Pept_E (Sonar search): 2.40E-02
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768KVVEDIEYLK 3 Pept_E (Sonar search): 8.90E-04
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734KVYDQMPEPR 2 Pept_E (Sonar search): 7.00E-02
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialGI:13528777KWEQDPETFLIIIK 2 Pept_E (Sonar search): 2.20E-03
A6725HIBCH3-Hydroxyisobutyryl-coenzyme A hydrolase, mitochondrialGI:13528777KWEQDPETFLIIIK 3 
A0970CASQ2Calsequestrin, cardiac muscle isoform precursorGI:23503043KYDLLCLYYHEPVSSDK 2 Pept_E (Sonar search): 5.60E-06
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559KYPYWPHQPIENL 2 Pept_E (Sonar search): 2.70E-04
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559KYPYWPHQPIENL 3 Pept_E (Sonar search): 1.70E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559KYPYWPHQPIENL 3 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327LAAAFAVSR 2 Pept_E (Sonar search): 6.60E-05
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559LAALPENPPAIDWAYYK 2 Pept_E (Sonar search): 3.20E-02
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559LAALPENPPAIDWAYYK 3 Pept_E (Sonar search): 1.20E-03
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559LAALPENPPAIDWAYYK 2 
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062LAGCTVFITGASR 2 Pept_E (Sonar search): 5.70E-06
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062LAGCTVFITGASR 2 
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4GI:4505357LALFNPDVCWDR 2 Pept_E (Sonar search): 1.20E-02
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4GI:4505357LALFNPDVCWDR 3 Pept_E (Sonar search): 6.00E-02
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280LAQFVEHWK 2 Pept_E (Sonar search): 5.60E-03
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280LAQFVEHWK 2 
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083LAQGEYIAPEK 2 Pept_E (Sonar search): 9.90E-03
A5570NUBPLIron-sulfur protein NUBPLGI:13376747LAQTLGLEVLGDIPLHLNIR 2 Pept_E (Sonar search): 5.20E-07
A5570NUBPLIron-sulfur protein NUBPLGI:13376747LAQTLGLEVLGDIPLHLNIR 2 
A3202MYH7, MYHCBMyosin-7GI:12053672LASADIETYLLEK 2 Pept_E (Sonar search): 1.00E-01
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228LASGETVAAFCLTEPSSGSDAASIR 3 Pept_E (Sonar search): 4.40E-04
A5742AFG3L2AFG3-like protein 2GI:5802970LASLTPGFSGADVANVCNEAALIAAR 3 Pept_E (Sonar search): 5.00E-03
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007LATATFAGIENK 2 Pept_E (Sonar search): 8.10E-03
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261LATFWYYAK 2 Pept_E (Sonar search): 9.30E-03
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:123571LATQSNEITIPVTFESR 2 Pept_E (Sonar search): 2.00E-02
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371LCEAICPAQAITIEAEPR 3 Pept_E (Sonar search): 5.20E-05
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291LCELYAK 2 Pept_E (Sonar search): 8.00E-02
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429LCGSGFQSIVNGCQEICVK 3 Pept_E (Sonar search): 1.20E-01
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841LCQSFQTFSICYAETGLLGAHFVCDR 3 Pept_E (Sonar search): 4.80E-06
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356LCTSATESEVAR 2 Pept_E (Sonar search): 3.30E-03
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590LCTVATLR 2 Pept_E (Sonar search): 3.00E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345LCTVATLR 2 Pept_E (Sonar search): 2.10E-01
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883LCYVALDFENEMATAASSSSLEK 3 Pept_E (Sonar search): 1.50E-01
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734LDDLVNWAR 2 Pept_E (Sonar search): 1.20E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LDELEELLTNNR 2 Pept_E (Sonar search): 1.50E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LDELEELLTNNR 3 Pept_E (Sonar search): 1.40E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LDGNQDLIR 2 Pept_E (Sonar search): 7.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575LDGNQDLIR 2 Pept_E (Sonar search): 9.00E-02
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369LDITTLTGVPEEHIK 2 Pept_E (Sonar search): 1.00E-03
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369LDITTLTGVPEEHIK 3 Pept_E (Sonar search): 1.30E-02
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorGI:5901982LDLFANVVHVK 2 
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301LDPTGTFEK 2 Pept_E (Sonar search): 9.00E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618LDYHISVQNMMR 3 Pept_E (Sonar search): 3.90E-03
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LEAADEGSGDVK 2 Pept_E (Sonar search): 1.10E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867LEAPDADELPK 2 Pept_E (Sonar search): 2.70E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867LEAPDADELPKGEFDPGQDTYQHPPK 3 Pept_E (Sonar search): 1.90E-01
A713BTMEM65Transmembrane protein 65GI:18569391LEAPPPTPGQLR 2 Pept_E (Sonar search): 1.10E-02
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728LEDLIVK 2 Pept_E (Sonar search): 4.00E-01
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848LEDQLQGGQLEEVILQAEHELNLAR 3 Pept_E (Sonar search): 1.30E-05
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848LEDQLQGGQLEEVILQAEHELNLAR 3 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011LEEGPPVTTVLTR 2 Pept_E (Sonar search): 1.30E-05
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011LEEGPPVTTVLTR 3 Pept_E (Sonar search): 1.30E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127LEEVSPNLVR 2 Pept_E (Sonar search): 1.20E-02
A0007ACTN2Alpha-actinin 2GI:4501893LEGDHQLIQEALVFDNK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810LELAQYR 2 Pept_E (Sonar search): 1.00E-01
A3202MYH7, MYHCBMyosin-7GI:4557773LELDDVTSNMEQIIK 2 Pept_E (Sonar search): 3.50E-04
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735LELNYCVPMGVQTGDR 2 Pept_E (Sonar search): 1.60E-01
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327LEQDEYALR 2 Pept_E (Sonar search): 2.60E-03
A271DSDR39U1, HCDIEpimerase family protein SDR39U1GI:12654333LETTQLLAK 2 MS2 score: 36
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202LEVAPISDIIAIK 2 Pept_E (Sonar search): 2.10E-03
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202LEVAPISDIIAIK 3 Pept_E (Sonar search): 7.80E-05
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743LEVLDSTK 2 Pept_E (Sonar search): 2.40E-01
A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursorGI:30268183LFDFQGLQHQVAHVATQLEAAR 3 Pept_E (Sonar search): 2.80E-05
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:123571LFDQAFGLPR 2 Pept_E (Sonar search): 4.00E-01
A3698CYC1Cytochrome c1, heme protein, mitochondrialGI:117759LFDYFPKPYPNSEAAR 3 Pept_E (Sonar search): 2.90E-03
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LFEMVLGPAAYNVPLPK 3 Pept_E (Sonar search): 1.80E-02
A475DFUNDC2, HCBP6, DC44Hepatitis C virus core-binding protein 6GI:14781307LFGQESGPSAEK 2 Pept_E (Sonar search): 1.20E-03
A766CAPOA1BP, AIBP, YJEFN1Apolipoprotein A-I binding proteinGI:21068652LFGYEPTIYYPK 2 MS2 score: 37
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568LFNISGHVNHPCTVEEEMSVPLK 3 Pept_E (Sonar search): 1.40E-07
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855LFPPSADYPDLR 2 Pept_E (Sonar search): 2.30E-02
A6231COX7A2, COX7ALCytochrome C oxidase polypeptide VIIa-liver/heart, mitochondrial precursorGI:4502989LFQEDDEIPLYLK 2 Pept_E (Sonar search): 7.50E-01
A6230COX7A1, COX7AHCytochrome c oxidase polypeptide VIIa-heart, mitochondrial precursorGI:4502987LFQEDNDIPLYLK 2 Pept_E (Sonar search): 1.40E-02
A6230COX7A1, COX7AHCytochrome c oxidase polypeptide VIIa-heart, mitochondrial precursorGI:4502987LFQEDNDIPLYLK 3 Pept_E (Sonar search): 1.90E-02
A5959CA1Carbonic anhydrase 1GI:4502517LFQFHFHWGSTNEHGSEHTVDGVK 3 Pept_E (Sonar search): 2.40E-06
A7214NUDT9, NUDT10, UNQ3012/PRO9771ADP-ribose pyrophosphatase, mitochondrialGI:22761477LFSQDHLVIYK 2 
A6960ME2NAD-dependent malic enzyme, mitochondrial precursorGI:187300LFTPDVIR 2 MS2 score: 34
A5937BPHL, MCNAABiphenyl hydrolase-like proteinGI:4757862LFTVVAWDPR 2 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228LFVALQGCMDK 2 Pept_E (Sonar search): 3.70E-03
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570LFYSTFATDDR 2 Pept_E (Sonar search): 1.40E-02
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:433413LFYSTFATDDRK 2 Pept_E (Sonar search): 7.00E-05
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:433413LFYSTFATDDRK 3 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525LGADVTAVEFLGHVGGVGIDMEISK 2 Pept_E (Sonar search): 1.70E-04
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525LGADVTAVEFLGHVGGVGIDMEISK 2 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialGI:20141424LGAGYPMGPFELLDYVGLDTTK 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830LGANSLLDLVVFGR 2 Pept_E (Sonar search): 2.20E-06
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830LGANSLLDLVVFGR 2 
A6094COQ3, UG0215E05Hexaprenyldihydroxybenzoate methyltransferase, mitochondrialGI:14754031LGASVIGIDPVDENIK 2 Pept_E (Sonar search): 1.90E-01
A794BFDX1, ADXAdrenodoxin, mitochondrial precursorGI:182747LGCQICLTK 2 Pept_E (Sonar search): 5.10E-04
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:14250516LGDPAEYAHLVQAIIENPFLNGEVIR 3 
A0389ATP5J2, ATP5JL, ATP5J2-PTCD1ATP synthase f chain, mitochondrialGI:4757812LGELPSWILMR 2 Pept_E (Sonar search): 2.60E-02
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589LGFMSAFVK 2 Pept_E (Sonar search): 4.10E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LGFYGLDESDLDK 2 Pept_E (Sonar search): 7.90E-04
A6523FXN, x25, FRDAFrataxin, mitochondrial precursorGI:1218025LGGDLGTYVINK 2 MS2 score: 42
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202LGGEVSCLVAGTK 2 Pept_E (Sonar search): 7.70E-03
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997LGIYTVLFER 2 Pept_E (Sonar search): 2.00E-02
A0439PHB2, BAP, REAProhibitin 2GI:6005854LGLDYEER 2 Pept_E (Sonar search): 6.10E-03
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:414046LGLLDNHSSEFNVTR 3 Pept_E (Sonar search): 3.20E-03
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390LGPALATGNVVVM*K 2 Pept_E (Sonar search): 4.60E-02
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609LGPLQVAR 2 Pept_E (Sonar search): 2.90E-03
A196CNDUFA4NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4GI:4505357LGPNDQYK 2 Pept_E (Sonar search): 4.80E-02
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728LGSIAIQGAIEK 2 Pept_E (Sonar search): 1.20E-03
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2564245LGSLIGLIVEEGEDWK 2 Pept_E (Sonar search): 1.40E-06
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2564245LGSLIGLIVEEGEDWK 2 
A3692CKM, CKMMCreatine kinase, M chainGI:13938619LGSSEVEQVQLVVDGVK 2 Pept_E (Sonar search): 1.30E-02
A3692CKM, CKMMCreatine kinase, M chainGI:21536288LGSSEVEQVQLVVDGVK 2 Pept_E (Sonar search): 1.60E-07
A3692CKM, CKMMCreatine kinase, M chainGI:21536288LGSSEVEQVQLVVDGVK 2 
A3692CKM, CKMMCreatine kinase, M chainGI:21536288LGSSEVEQVQLVVDGVKLMVEMEK 3 Pept_E (Sonar search): 8.20E-03
A3692CKM, CKMMCreatine kinase, M chainGI:21536288LGSSEVEQVQLVVDGVKLMVEMEK 3 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLGI:17461670LGSSSEIEVPAK 2 Pept_E (Sonar search): 3.90E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862LGVEFDETTADDR 2 Pept_E (Sonar search): 2.70E-03
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075LGVEPSDDDCVSVQHVCTIVSFR 3 Pept_E (Sonar search): 1.00E+00
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228LGVQTVAVYSEADR 2 Pept_E (Sonar search): 4.10E-01
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369LGWVRPDLGELSK 2 Pept_E (Sonar search): 9.30E-03
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8GI:7657369LGWVRPDLGELSK 3 Pept_E (Sonar search): 8.80E-04
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855LGYILTCPSNLGTGLR 2 Pept_E (Sonar search): 1.50E-01
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855LGYILTCPSNLGTGLR 3 Pept_E (Sonar search): 5.20E-04
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197LHGGTPANFLDVGGGATVHQVTEAFK 2 Pept_E (Sonar search): 1.50E-11
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197LHGGTPANFLDVGGGATVHQVTEAFK 3 Pept_E (Sonar search): 4.70E-03
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197LHGGTPANFLDVGGGATVHQVTEAFK 4 Pept_E (Sonar search): 2.00E-06
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LHNMIVDLDNVVK 3 Pept_E (Sonar search): 5.20E-04
A6804PPA1, IOPPP, PPInorganic pyrophosphataseGI:727225LIAINANDPEASK 2 MS2 score: 39
A4815FLNC, ABPL, FLN2Filamin CGI:4557597LIALLEVLSQK 2 
A0369LDHBL-lactate dehydrogenase B chainGI:1200083LIAPVAEEEATVPNNK 2 MS2 score: 50
A0369LDHBL-lactate dehydrogenase B chainGI:1200083LIAPVAEEEATVPNNK 3 MS2 score: 51
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855LIDDHFLFDKPVSPLLTCAGMAR 4 Pept_E (Sonar search): 3.60E-06
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LIDDMVAQVLK 2 Pept_E (Sonar search): 1.40E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844LIDDMVAQVLK 1 Pept_E (Sonar search): 5.90E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575LIDDMVAQVLK 2 Pept_E (Sonar search): 1.30E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LIFCTGK 2 Pept_E (Sonar search): 2.20E-01
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GI:13937391LIIWDSYTTNK 2 
A303CUQCR11, UQCRCytochrome B-C1 complex subunit 10GI:3850565LILDWVPYINGK 2 MS2 score: 38
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:27462180LILEVHQFSR 2 
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:30315658LILEVHQFSR 2 Pept_E (Sonar search): 7.80E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LILPHVDIQLK 3 Pept_E (Sonar search): 8.20E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844LILPHVDIQLK 1 Pept_E (Sonar search): 4.90E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:4758328LILTLTHGTAVCTR 2 Pept_E (Sonar search): 1.60E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:4758328LILTLTHGTAVCTR 3 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:14741856LIPDDVMTR 2 Pept_E (Sonar search): 1.80E-02
A5964CA2Carbonic anhydrase 2GI:4557395LIQFHFHWGSLDGQGSEHTVDK 3 Pept_E (Sonar search): 7.30E-09
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053LISWYDNEFGYSNR 2 Pept_E (Sonar search): 5.10E-08
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053LISWYDNEFGYSNR 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492LISWYDNEFGYSNR 2 Pept_E (Sonar search): 9.60E-03
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:30584593LISWYDNEFGYSNR 2 Pept_E (Sonar search): 5.10E-08
A0382MT-ATP6, ATP6, ATPASE6ATP synthase F0 subunit 6GI:114443LITTQQWLIK 2 Pept_E (Sonar search): 2.00E-02
A0382MT-ATP6, ATP6, ATPASE6ATP synthase F0 subunit 6GI:23193545LITTQQWLIK 2 
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568LKPPFPADVGVFGCPTTVANVETVAVSPTICR 3 Pept_E (Sonar search): 6.90E-05
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493LLADPTGAFGK 2 Pept_E (Sonar search): 1.80E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611LLDAVDTYIPVPAR 2 Pept_E (Sonar search): 4.50E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611LLDAVDTYIPVPAR 3 Pept_E (Sonar search): 2.80E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384LLDAVDTYIPVPAR 2 
A5644ABHD11, WBSCR21, PP1226Abhydrolase domain-containing protein 11GI:23200008LLDGEAALPAVVFLHGLFGSK 2 
A5984CTSD, CPSDCathepsin D precursorGI:30584113LLDIACWIHHK 2 
A5984CTSD, CPSDCathepsin D precursorGI:30584113LLDIACWIHHK 2 Pept_E (Sonar search): 8.50E-03
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189LLDLLHLQLICR 2 Pept_E (Sonar search): 5.10E-03
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LLDTAFDLDVFK 2 Pept_E (Sonar search): 8.00E-02
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016LLDVDNR 2 Pept_E (Sonar search): 1.20E-01
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816LLEGCLVGGR 2 Pept_E (Sonar search): 4.30E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LLFCTGK 2 Pept_E (Sonar search): 2.20E-01
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570LLGQFTLIGIPPAPR 2 Pept_E (Sonar search): 7.40E-01
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688LLGQFTLIGIPPAPR 2 
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062LLGTIYTAAEEIEAVGGK 2 Pept_E (Sonar search): 1.20E-07
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062LLGTIYTAAEEIEAVGGK 3 Pept_E (Sonar search): 4.20E-02
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062LLGTIYTAAEEIEAVGGK 2 
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291LLHDSGLNVVVLEAR 2 
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291LLHDSGLNVVVLEAR 3 Pept_E (Sonar search): 5.50E-03
A3166MYH9Myosin heavy chain 9, non-muscleGI:12654391LLIALLESNQQK 2 Pept_E (Sonar search): 3.40E-04
A3166MYH9Myosin heavy chain 9, non-muscleGI:12654391LLIALLESNQQK 2 
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083LLLEGVENK 2 Pept_E (Sonar search): 2.60E-01
A0620RAB8A, MEL, RAB8Ras-related protein Rab-8AGI:234746LLLIGDSGVGK 2 MS2 score: 34
A309CRAB13, GIG4Ras-related protein Rab-13GI:4506363LLLIGDSGVGK 2 MS2 score: 37
A314CRAB1A, RAB1Ras-related protein Rab-1AGI:55457LLLIGDSGVGK 2 MS2 score: 45
A7856SPRSepiapterin reductaseGI:464801LLLINNAGSLGDVSK 2 MS2 score: 52
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455LLLQVQHASK 1 Pept_E (Sonar search): 2.40E-03
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:4502097LLLQVQHASK 2 
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558LLLQVQHASK 2 Pept_E (Sonar search): 1.40E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558LLLQVQHASK 3 Pept_E (Sonar search): 8.80E-03
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755LLLQVQHASK 2 Pept_E (Sonar search): 4.40E-02
A0850VIMVimentinGI:37848LLQDSVDFSLADAINTEFK 2 
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768LLQYSDALEHLLTTGQGVVLER 3 Pept_E (Sonar search): 1.50E-03
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:21411521LLQYSDALEHLLTTGQGVVLER 3 Pept_E (Sonar search): 1.60E-07
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:21411521LLQYSDALEHLLTTGQGVVLER 2 
A3202MYH7, MYHCBMyosin-7GI:12053672LLSSLDIDHNQYK 3 Pept_E (Sonar search): 3.30E-02
A3202MYH7, MYHCBMyosin-7GI:4557773LLSTLFANYAGADAPIEK 2 Pept_E (Sonar search): 5.50E-06
A3202MYH7, MYHCBMyosin-7GI:4557773LLSTLFANYAGADAPIEK 2 
A1742HBB, beta-globinHemoglobin beta chainGI:1431650LLVIYPWTQR 2 Pept_E (Sonar search): 9.70E-01
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850LLVVYPWTQR 2 Pept_E (Sonar search): 5.30E-03
A1742HBB, beta-globinHemoglobin beta chainGI:1431650LLVVYPWTQR 2 Pept_E (Sonar search): 6.00E-02
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202LLYDLADQLHAAVGASR 2 Pept_E (Sonar search): 6.80E-05
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202LLYDLADQLHAAVGASR 3 Pept_E (Sonar search): 4.00E-03
A791BNDUFAB1Acyl carrier protein, mitochondrial precursorGI:4826852LM*CPQEIVDYIADKK 3 Pept_E (Sonar search): 1.40E-02
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327LM*LDLNK 2 Pept_E (Sonar search): 5.00E-02
A791BNDUFAB1Acyl carrier protein, mitochondrial precursorGI:4826852LMCPQEIVDYIADK 2 Pept_E (Sonar search): 4.20E-02
A791BNDUFAB1Acyl carrier protein, mitochondrial precursorGI:4826852LMCPQEIVDYIADKK 3 Pept_E (Sonar search): 6.20E-03
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327LMLDLNK 2 Pept_E (Sonar search): 6.10E-01
A3948MTCH1, PSAP, CGI-64Mitochondrial carrier homolog 1GI:4929597LMSNALSTVTR 2 MS2 score: 43
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807LNDGSQITYEK 2 Pept_E (Sonar search): 2.00E-03
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875LNDHFPLVVWQTGSGTQTNMNVNEVISNR 3 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844LNEHFLNTMDFLDTIK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LNEHFLNTTDFLDTIK 2 Pept_E (Sonar search): 8.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LNEHFLNTTDFLDTIK 3 Pept_E (Sonar search): 3.70E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:20141568LNEHFLNTTDFLDTIK 2 
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728LNVTPLAR 2 Pept_E (Sonar search): 8.40E-01
A3692CKM, CKMMCreatine kinase, M chainGI:13938619LNYKPEEEYPDLSK 3 Pept_E (Sonar search): 2.70E-02
A3873ANK2Ankyrin 2GI:10947054LPALHIAAR 2 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609LPAVVTADLR 2 Pept_E (Sonar search): 7.90E-04
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011LPCIFICENNR 2 Pept_E (Sonar search): 9.80E-04
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:4504517LPEEWSQWLGGSSWPGYVR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830LPGISETAMIFAGVDVTK 2 
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049LPHLPGLEDLGIQATPLELK 3 Pept_E (Sonar search): 4.70E-05
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827LPNGLVIASLENYSPVSR 3 Pept_E (Sonar search): 3.30E-04
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482LPNGLVIASLENYSPVSR 2 Pept_E (Sonar search): 6.50E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482LPNGLVIASLENYSPVSR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325LPPKSEVSSDEDIQFR 3 Pept_E (Sonar search): 6.00E-03
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775LPRPPPPEM*PESLK 3 Pept_E (Sonar search): 3.90E-02
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775LPRPPPPEMPESLK 3 Pept_E (Sonar search): 3.90E-05
A5932BLVRB, FLRFlavin reductaseGI:4502419LPSEGPRPAHVVVGDVLQAADVDK 3 
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850LPVGPSHK 2 Pept_E (Sonar search): 2.40E-01
A5957CRAT, CAT1Carnitine O-acetyltransferaseGI:4755132LPVPPLQQSLDHYLK 3 Pept_E (Sonar search): 4.70E-02
A6823AK2, ADK2Adenylate kinase 2, mitochondrialGI:4502013LQAYHTQTTPLIEYYR 3 Pept_E (Sonar search): 9.00E-02
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650LQDPFSLYR 2 Pept_E (Sonar search): 4.30E-02
A6639GPD1LGlycerol-3-phosphate dehydrogenase 1-like proteinGI:17443437LQGPQTSAEVYR 2 Pept_E (Sonar search): 1.80E-02
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918LQIEDFEAR 2 Pept_E (Sonar search): 2.50E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867LQLLEPFDK 2 Pept_E (Sonar search): 3.00E-01
A9506TOMM22, TOM22, MST065Mitochondrial import receptor subunit TOM22 homologGI:24212074LQMEQQQQLQQR 3 MS2 score: 34
A3202MYH7, MYHCBMyosin-7GI:4557773LQNEIEDLMVDVER 3 
A3202MYH7, MYHCBMyosin-7GI:12053672LQNEIEDLMVDVER 3 Pept_E (Sonar search): 3.30E-05
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600LQPHEFQGGTFTISNLGMFGIK 3 Pept_E (Sonar search): 6.60E-04
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600LQPHEFQGGTFTISNLGMFGIK 3 
A5862ATAD1ATPase family AAA domain-containing protein 1GI:21740032LQPSIIFIDEIDSFLR 2 
A3197MYH2, MYHSA2Myosin-2GI:8923940LQQFFNHHMFVLEQEEYK 3 
A3202MYH7, MYHCBMyosin-7GI:4557773LQQFFNHHMFVLEQEEYK 2 Pept_E (Sonar search): 6.60E-03
A3197MYH2, MYHSA2Myosin-2GI:8923940LQQFFNHHMFVLEQEEYKK 3 
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305LQSIGTENTEENR 2 Pept_E (Sonar search): 3.30E-02
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305LQSIGTENTEENRR 3 Pept_E (Sonar search): 2.30E-02
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768LQSWLYSSR 2 Pept_E (Sonar search): 4.10E-02
A3745SLC25A20, CAC, CACTMitochondrial carnitine/acylcarnitine carrier proteinGI:4557403LQTQPPSLPGQPPM*YSGTFDCFR 3 Pept_E (Sonar search): 2.40E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007LQVAGEITTGPR 2 Pept_E (Sonar search): 4.40E-02
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorGI:10835165LRENELTYYCCK 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379LSDGVAVLK 2 Pept_E (Sonar search): 1.00E-02
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197LSEIVTLAK 2 Pept_E (Sonar search): 2.70E-02
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855LSEMTEQDQQR 2 Pept_E (Sonar search): 1.20E-02
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390LSENVIDR 2 Pept_E (Sonar search): 6.00E-02
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LSEQELQFR 2 Pept_E (Sonar search): 1.30E-01
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:4507189LSEVASLWEELLEATK 2 Pept_E (Sonar search): 1.00E-05
A9613MRPL43, bMRP36a, BMRP36AMitochondrial ribosomal protein L43GI:28872734LSFSVSRDGASSR 2 
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:30851190LSIIATDHTYR 2 Pept_E (Sonar search): 3.80E-04
A1410COL6A1Collagen alpha 1(VI) chain precursorGI:30851190LSIIATDHTYR 2 
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850LSNNYYCTR 2 Pept_E (Sonar search): 2.30E-01
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303LSNTQGVVSAFSTMMSVHR 3 Pept_E (Sonar search): 4.50E-04
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LSQEQVDNFTLDINTAYAR 2 Pept_E (Sonar search): 2.30E-04
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LSQEQVDNFTLDINTAYAR 3 Pept_E (Sonar search): 2.60E-03
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221LSQNNFALGYK 2 Pept_E (Sonar search): 1.00E-03
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:414046LSSDVLTLLIK 2 Pept_E (Sonar search): 2.00E-01
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:21756162LSSDVLTLLIK 2 
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorGI:4557833LSSQEAASSFGDDR 2 Pept_E (Sonar search): 1.80E-03
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768LSTDDLNSLIAHAHR 4 Pept_E (Sonar search): 1.70E-04
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:2134870LSTSQIPQSQIR 2 Pept_E (Sonar search): 1.00E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127LSVAGNCR 2 Pept_E (Sonar search): 1.20E-01
A3692CKM, CKMMCreatine kinase, M chainGI:13938619LSVEALNSLTGEFK 2 Pept_E (Sonar search): 2.30E-03
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609LSVISVEDPPQR 2 Pept_E (Sonar search): 1.30E-01
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609LSVISVEDPPQR 3 Pept_E (Sonar search): 1.40E-02
A791BNDUFAB1Acyl carrier protein, mitochondrial precursorGI:4826852LSVNSHFMK 2 Pept_E (Sonar search): 1.80E-01
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110LTELLK 1 Pept_E (Sonar search): 2.40E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127LTEPMVR 2 Pept_E (Sonar search): 1.60E-01
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427LTFDSSFSPNTGK 2 Pept_E (Sonar search): 2.30E-04
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427LTFDSSFSPNTGKK 3 Pept_E (Sonar search): 8.90E-05
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201LTFDTTFSPNTGK 2 Pept_E (Sonar search): 2.00E-04
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201LTFDTTFSPNTGKK 3 Pept_E (Sonar search): 5.40E-04
A1956GSTM3, GST5Glutathione S-transferase Mu 3GI:14250650LTFVDFLTYDILDQNR 2 Pept_E (Sonar search): 2.60E-04
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997LTGADGTPPGFLLK 2 Pept_E (Sonar search): 5.30E-04
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867LTGSLSGWSSPK 2 Pept_E (Sonar search): 4.70E-03
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735LTGSYNTMVGNNEGSMVLGLK 3 Pept_E (Sonar search): 5.50E-01
A7091MUTMethylmalonyl-CoA mutase, mitochondrialGI:896283LTGTIQNDILK 2 MS2 score: 42
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007LTLADIER 2 Pept_E (Sonar search): 1.70E-01
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221LTLDTIFVPNTGK 2 Pept_E (Sonar search): 8.00E-03
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5733504LTLDTIFVPNTGK 3 
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221LTLDTIFVPNTGKK 3 Pept_E (Sonar search): 4.30E-03
A7198ND4, NADH4, MT-ND4NADH-ubiquinone oxidoreductase chain 4GI:13272790LTLILNPLTK 2 Pept_E (Sonar search): 3.70E-02
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221LTLSALIDGK 2 Pept_E (Sonar search): 1.40E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427LTLSALLDGK 2 Pept_E (Sonar search): 1.40E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:4507879LTLSALLDGK 1 
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:17436513LTLSALLDGK 2 Pept_E (Sonar search): 1.00E-01
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201LTLSALVDGK 2 Pept_E (Sonar search): 7.70E-04
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875LTLTFNR 2 Pept_E (Sonar search): 2.10E-01
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541LTLYDIAHTPGVAADLSHIETK 3 Pept_E (Sonar search): 1.80E-02
A3202MYH7, MYHCBMyosin-7GI:12053672LTQESIMDLENDKQQLDER 3 Pept_E (Sonar search): 1.70E-01
A6104COX7A2L, COX7AR, COX7RPCytochrome c oxidase subunit VIIa-related protein, mitochondrial precursorGI:2465178LTSDSTVYDYAGK 2 MS2 score: 57
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007LTVNDFVR 2 Pept_E (Sonar search): 2.40E-02
A5831ASAH1, ASAH, HSD33Acid ceramidase precursorGI:16877108LTVYTTLIDVTK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672LTYTQQLEDLKR 3 Pept_E (Sonar search): 8.00E-02
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075LVDEYSLNAGK 2 Pept_E (Sonar search): 1.20E-01
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13436359LVEDHLAVQSLIR 3 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252LVEDHLAVQSLIR 3 Pept_E (Sonar search): 8.20E-04
A9597MRPL22, MRPL25, RPML2539S ribosomal protein L22, mitochondrialGI:7020807LVEGPPPPPEPPK 2 Pept_E (Sonar search): 1.90E-03
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2GI:4758504LVGQGASAVLLDLPNSGGEAQAK 3 Pept_E (Sonar search): 1.50E-03
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorGI:8922356LVHSYPYDWR 2 Pept_E (Sonar search): 4.10E-03
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorGI:8922356LVHSYPYDWR 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492LVINGNPITIFQER 2 Pept_E (Sonar search): 4.40E-02
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492LVINGNPITIFQER 3 Pept_E (Sonar search): 3.80E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549LVLEVAQHLGESTVR 2 Pept_E (Sonar search): 7.60E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549LVLEVAQHLGESTVR 3 Pept_E (Sonar search): 2.70E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295LVLEVAQHLGESTVR 2 Pept_E (Sonar search): 5.30E-09
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295LVLEVAQHLGESTVR 2 
A0359RAB5A, RAB5, HCC-10Ras-related protein Rab-5AGI:106189LVLLGESAVGK 2 MS2 score: 46
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LVMELSGEM*VR 2 Pept_E (Sonar search): 2.20E-03
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LVMELSGEMVR 2 Pept_E (Sonar search): 7.10E-04
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LVMELSGEMVRK 3 Pept_E (Sonar search): 2.30E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590LVNEVTEFAK 2 Pept_E (Sonar search): 3.10E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345LVNEVTEFAK 2 Pept_E (Sonar search): 1.40E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127LVNQQLLADPLVPPQLTIK 2 Pept_E (Sonar search): 7.00E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127LVNQQLLADPLVPPQLTIK 3 Pept_E (Sonar search): 1.50E-04
A6879LACTB, MRPL56, UNQ843/PRO1781Serine beta lactamase-like protein LACTB, mitochondrialGI:17380287LVNTPYVDNSYK 2 Pept_E (Sonar search): 1.80E-02
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:1082723LVPELDTIVPLESTK 2 Pept_E (Sonar search): 2.10E-01
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:4557044LVPELDTIVPLESTK 3 Pept_E (Sonar search): 2.60E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LVPGWTKPITIGR 2 Pept_E (Sonar search): 1.60E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203LVPGWTKPITIGR 3 Pept_E (Sonar search): 1.10E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575LVPGWTKPITIGR 2 Pept_E (Sonar search): 7.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575LVPGWTKPITIGR 3 Pept_E (Sonar search): 5.90E-03
A0971COX5BCytochrome c oxidase polypeptide Vb, mitochondrial precursorGI:117103LVPQQLAH 2 Pept_E (Sonar search): 6.10E-03
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379LVQDVANNTNEEAGDGTTTATVLAR 3 Pept_E (Sonar search): 3.30E-05
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303LVRPPVQVYGIEGR 3 Pept_E (Sonar search): 1.10E-06
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303LVRPPVQVYGIEGR 3 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303LVRPPVQVYGIEGR 3 Pept_E (Sonar search): 1.90E-04
A0323RAP1A, KREV1Ras-related protein Rap-1AGI:1942609LVVLGSGGVGK 2 MS2 score: 38
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848LWEPLVEEPPADQWK 3 Pept_E (Sonar search): 2.10E-04
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228LWISNGGLADIFTVFAK 2 Pept_E (Sonar search): 2.30E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228LWISNGGLADIFTVFAK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810LYCIYVAIGQK 2 Pept_E (Sonar search): 1.70E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001LYCIYVAIGQK 2 Pept_E (Sonar search): 4.10E-06
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001LYCIYVAIGQK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110LYCIYVAIGQK 2 Pept_E (Sonar search): 4.10E-06
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810LYCIYVAIGQKR 3 Pept_E (Sonar search): 1.60E-01
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:27666102LYDLYSFQVIPVIGEVIAGDWK 2 Pept_E (Sonar search): 9.80E-06
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080LYDLYSFQVIPVLGEVIAGDWK 2 Pept_E (Sonar search): 9.80E-06
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080LYDLYSFQVIPVLGEVIAGDWK 2 
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:27485520LYNLFLK 2 
A3745SLC25A20, CAC, CACTMitochondrial carnitine/acylcarnitine carrier proteinGI:4557403LYQEFGIR 2 Pept_E (Sonar search): 4.80E-02
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorGI:15928808LYQQHGAGLFDVTR 2 Pept_E (Sonar search): 1.70E-06
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239LYTEGYQVPPGATYTAIEAPK 2 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LYTEGYQVPPGATYTAIEAPK 2 Pept_E (Sonar search): 1.10E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786LYTEGYQVPPGATYTAIEAPK 3 Pept_E (Sonar search): 6.00E-02
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265LYYNLDDIAYVGK 3 
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265LYYNLDDIAYVGKPLVDIETEALK 3 Pept_E (Sonar search): 8.60E-06
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265LYYNLDDIAYVGKPLVDIETEALK 3 
A3601PCCAPropionyl-CoA carboxylase alpha chain, mitochondrial precursorGI:4557833M*ADEAVCVGPAPTSK 2 Pept_E (Sonar search): 6.00E-03
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786M*FEFYER 2 Pept_E (Sonar search): 3.00E-01
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325M*GLVDQLVEPLGPGLKPPEER 3 Pept_E (Sonar search): 1.00E-01
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049M*GSQVIIPYR 2 Pept_E (Sonar search): 6.80E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127M*HEDINEEWISDK 3 Pept_E (Sonar search): 1.80E-04
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541M*ISDAIPELK 2 Pept_E (Sonar search): 9.00E-02
A0439PHB2, BAP, REAProhibitin 2GI:6005854M*LGEALSK 2 Pept_E (Sonar search): 5.60E-01
A304CUQCRHUbiquinol-cytochrome C reductase complex 11 kDa protein, mitochondrial precursorGI:5174745M*LTESGDPEEEEEEEEELVDPLTTVR 3 Pept_E (Sonar search): 3.40E-02
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007M*M*ADEALGSGLVSR 2 Pept_E (Sonar search): 4.00E-04
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069M*NLGVGAYR 2 Pept_E (Sonar search): 6.00E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325M*QLLEIITTEK 2 Pept_E (Sonar search): 9.60E-04
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356M*VLAAAGGVEHQQLLDLAQK 3 Pept_E (Sonar search): 7.30E-04
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011M*VNSNLASVEELKEIDVEVR 3 Pept_E (Sonar search): 3.90E-02
A0388ATP5I, ATP5KATP synthase e chain, mitochondrialGI:6005717M*VPPVQVSPLIK 2 Pept_E (Sonar search): 8.00E-02
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:27485520MAENLGFVGPLK 1 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827MALIGLGVSHPVLK 3 Pept_E (Sonar search): 3.10E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482MALIGLGVSHPVLK 2 Pept_E (Sonar search): 2.50E-08
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482MALIGLGVSHPVLK 2 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127MCLVEIEK 2 Pept_E (Sonar search): 2.40E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127MCLVEIEKAPK 3 Pept_E (Sonar search): 8.00E-02
A3202MYH7, MYHCBMyosin-7GI:12053672MDADLSQLQTEVEEAVQECR 3 Pept_E (Sonar search): 6.50E-03
A3202MYH7, MYHCBMyosin-7GI:12053672MEGDLNEMEIQLSHANR 3 Pept_E (Sonar search): 2.10E-02
A0876TAX1BP1, T6BP, PRO0105TAX1-binding protein 1GI:6690160MELKWKEQVKIAENVK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672MELQSALEEAEASLEHEEGK 3 Pept_E (Sonar search): 2.20E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786MFEFYER 2 Pept_E (Sonar search): 3.50E-02
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850MFLSFPTTK 2 Pept_E (Sonar search): 1.30E-02
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:13195586MFLSFPTTK 2 
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581MGHAGAIIAGGK 2 Pept_E (Sonar search): 6.50E-04
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581MGHAGAIIAGGK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325MGLVDQLVEPLGPGLKPPEER 3 Pept_E (Sonar search): 6.30E-04
A3914NIPSNAP1NipSnap1 proteinGI:4505399MGPNIYELR 2 Pept_E (Sonar search): 5.40E-03
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049MGSQVIIPYR 2 Pept_E (Sonar search): 1.10E-01
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLGI:17461670MGVITVSGLAGLVSAR 2 Pept_E (Sonar search): 1.00E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127MHEDINEEWISDK 2 Pept_E (Sonar search): 4.20E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127MHEDINEEWISDK 3 Pept_E (Sonar search): 8.40E-04
A931BCYCS, CYCCytochrome CGI:15929398MIFVGIK 2 Pept_E (Sonar search): 2.10E-01
A7199ND5, MTND5, NADH5NADH-ubiquinone oxidoreductase chain 5GI:13273155MILLTLTGQPR 2 Pept_E (Sonar search): 1.10E-02
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:27500021MLIPYIEHWPR 2 Pept_E (Sonar search): 2.30E-03
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:27500021MLIPYIEHWPR 2 XCorr (Sequest): 3.43
A0392ATP8, ATPASE8, ATPase 8ATP synthase protein 8GI:29690691MLNTNYHLPPSPK 3 XCorr (Sequest): 3.5422
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016MM*ITSQDVLHSWAVPTLGLK 3 Pept_E (Sonar search): 8.60E-01
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016MMITSQDVLHSWAVPTLGLK 3 Pept_E (Sonar search): 8.00E-02
A7391PCBD2, DCOH2, DCOHMPterin-4-alpha-carbinolamine dehydratase 2GI:14149825MNHHPEWFNVYNK 2 XCorr (Sequest): 2.90E-03
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069MNLGVGAYR 2 Pept_E (Sonar search): 9.40E-03
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312MNVFDTELK 2 Pept_E (Sonar search): 7.30E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:7959791MPCAEDYLSVVLNQLCVLHEK 3 Pept_E (Sonar search): 2.30E-06
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10280538MPQPSSGR 2 Pept_E (Sonar search): 1.40E-01
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10835087MPQPSSGR 2 Pept_E (Sonar search): 2.00E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064MQLLEIITTEK 2 Pept_E (Sonar search): 3.50E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064MQLLEIITTEK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325MQLLEIITTEK 2 Pept_E (Sonar search): 1.30E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325MQLLEIITTEK 3 Pept_E (Sonar search): 2.20E-01
A475AHIST1H1T, H1FT, H1THistone H1TGI:20544168MSETVPAASASAGVAAMEKLPTK 2 
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:14735899MSQYLDSLK 2 Pept_E (Sonar search): 1.80E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127MTSGVTGDWK 2 Pept_E (Sonar search): 2.80E-01
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325MVGVPAALDMMLTGR 2 Pept_E (Sonar search): 1.80E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325MVGVPAALDMMLTGR 3 Pept_E (Sonar search): 5.00E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356MVLAAAGGVEHQQLLDLAQK 3 Pept_E (Sonar search): 5.80E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841MVLAAAGGVEHQQLLDLAQK 2 Pept_E (Sonar search): 4.10E-12
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841MVLAAAGGVEHQQLLDLAQK 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AGI:17450333MVNPTVFDIAVDGKPLGR 2 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AGI:17450333MVNPTVFDIAVDGKPLGRVSFEPFADK 3 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011MVNSNLASVEELKEIDVEVR 3 Pept_E (Sonar search): 1.60E-03
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292MWEELPEVVR 2 Pept_E (Sonar search): 8.00E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816NACGSGYDFDVFVVR 2 Pept_E (Sonar search): 1.10E-05
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:20149568NACGSGYDFDVFVVR 2 Pept_E (Sonar search): 8.30E-09
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312NAENAIEALKEYEPEMGK 3 Pept_E (Sonar search): 2.80E-01
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379NAGVEGSLIVEK 2 Pept_E (Sonar search): 2.00E-01
A3202MYH7, MYHCBMyosin-7GI:4557773NALAHALQSAR 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827NALANPLYCPDYR 2 Pept_E (Sonar search): 2.10E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827NALANPLYCPDYR 3 Pept_E (Sonar search): 2.70E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356NALVSHLDGTTPVCEDIGR 3 Pept_E (Sonar search): 4.40E-05
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875NASEMIDK 2 Pept_E (Sonar search): 9.00E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NAVTQEFGPVPDTAR 2 Pept_E (Sonar search): 9.70E-04
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NAVTQEFGPVPDTAR 3 Pept_E (Sonar search): 1.80E-04
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5042402NAVTQFVSSMSASADVLALAK 2 Pept_E (Sonar search): 5.10E-04
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5042402NAVTQFVSSMSASADVLALAK 2 
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743NAVTQFVSSMSASADVLALAK 3 Pept_E (Sonar search): 5.30E-04
A3202MYH7, MYHCBMyosin-7GI:4557773NAYEESLEHLETFK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672NAYEESLEHLETFK 2 Pept_E (Sonar search): 1.30E-01
A3202MYH7, MYHCBMyosin-7GI:12053672NAYEESLEHLETFK 3 Pept_E (Sonar search): 1.30E-01
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985NCWQNYLDFHR 2 Pept_E (Sonar search): 1.70E-03
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985NCWQNYLDFHR 3 Pept_E (Sonar search): 8.00E-05
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:30584127NCWQNYLDFHR 3 
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:30584127NCWQNYLDFHR 3 Pept_E (Sonar search): 9.40E-05
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228NDALEMVEETTWQGLK 3 Pept_E (Sonar search): 7.00E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NDANPETHAFVTSPEIVTALAIAGTLK 3 Pept_E (Sonar search): 2.90E-05
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NDANPETHAFVTSPEIVTALAIAGTLK 3 Pept_E (Sonar search): 3.00E-04
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NDANPETHAFVTSPEIVTALAIAGTLK 3 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826NDGAAILAAVSSIAQK 2 Pept_E (Sonar search): 1.20E-09
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127NDGAAILAAVSSIAQK 2 Pept_E (Sonar search): 6.30E-06
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127NDGAAILAAVSSIAQK 3 Pept_E (Sonar search): 2.80E-07
A3202MYH7, MYHCBMyosin-7GI:12053672NDLQLQVQAEQDNLADAEER 3 Pept_E (Sonar search): 2.70E-01
A1952GSTK1, HDCMD47PGlutathione S-transferase, mitochondrialGI:7643782NEDITEPQSILAAAEK 2 MS2 score: 41
A3672MAOAAmine oxidase [flavin-containing] AGI:4557735NEHVDYVDVGGAYVGPTQNR 3 Pept_E (Sonar search): 1.20E-04
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728NEQDAYAINSYTR 2 Pept_E (Sonar search): 3.00E-03
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:181575NETLGGTCLNVGCIPSK 3 Pept_E (Sonar search): 9.30E-01
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650NEVDSTLTFR 2 Pept_E (Sonar search): 2.30E-02
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650NEVDSTLTFR   Pept_E (Sonar search): 6.00E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049NFDFEDVFVK 2 Pept_E (Sonar search): 5.80E-01
A8092UBA1, UBE1, A1S9TUbiquitin-activating enzyme E1GI:24485NFPNAIEHTLQWAR 2 Pept_E (Sonar search): 3.90E-04
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363NFYDSPEK 2 Pept_E (Sonar search): 1.50E-01
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011NFYGGNGIVGAQVPLGAGIALACK 2 Pept_E (Sonar search): 1.90E-02
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011NFYGGNGIVGAQVPLGAGIALACK 3 Pept_E (Sonar search): 6.90E-04
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011NFYGGNGIVGAQVPLGAGIALACK 3 Pept_E (Sonar search): 1.00E-01
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:17475302NGDIITLK 2 Pept_E (Sonar search): 5.90E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862NGDILTLK 2 Pept_E (Sonar search): 5.90E-03
A6823AK2, ADK2Adenylate kinase 2, mitochondrialGI:4502013NGFLLDGFPR 2 Pept_E (Sonar search): 5.70E-03
A3731SLC25A11, SLC20A4Solute carrier family 25 member 11GI:4506997NGLDVLFK 2 Pept_E (Sonar search): 1.80E-01
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369NGWSYDIEER 2 Pept_E (Sonar search): 1.10E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007NIFLQYASTEVDGER 2 Pept_E (Sonar search): 8.00E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007NIFLQYASTEVDGER 3 Pept_E (Sonar search): 2.10E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203NILGGTVFREPIICK 3 Pept_E (Sonar search): 1.10E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844NILGGTVFREPIICK 2 Pept_E (Sonar search): 5.30E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575NILGGTVFREPIICK 3 Pept_E (Sonar search): 1.00E-01
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525NILIATGSEVTPFPGITIDEDTIVSSTGALSLK 3 Pept_E (Sonar search): 2.50E-04
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525NILIATGSEVTPFPGITIDEDTIVSSTGALSLK 3 
A3951SFXN1Sideroflexin 1GI:18561987NILLTNEQLESAR 2 Pept_E (Sonar search): 1.50E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239NITLNFGPQHPAAHGVLR 2 Pept_E (Sonar search): 1.30E-05
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239NITLNFGPQHPAAHGVLR 2 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786NITLNFGPQHPAAHGVLR 3 Pept_E (Sonar search): 3.90E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786NITLNFGPQHPAAHGVLR 4 Pept_E (Sonar search): 1.90E-01
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252NITLSLVANPSHLEAADPVVMGK 3 Pept_E (Sonar search): 5.00E-02
A5423OCIAD1, OCIA, TPA018OCIA domain-containing protein 1GI:25376787NITYEELR 2 MS2 score: 37
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083NIVSDCSAFVK 2 Pept_E (Sonar search): 1.40E-01
A3197MYH2, MYHSA2Myosin-2GI:8923940NKDPLNETVVGLYQK 2 
A3202MYH7, MYHCBMyosin-7GI:4557773NKDPLNETVVGLYQK 2 Pept_E (Sonar search): 2.00E-03
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069NLDKEYLPIGGLAEFCK 3 Pept_E (Sonar search): 4.80E-02
A5635GOT1, GIG18Aspartate aminotransferase, cytoplasmicGI:4504067NLDYVATSIHEAVTK 2 Pept_E (Sonar search): 3.00E-04
A5635GOT1, GIG18Aspartate aminotransferase, cytoplasmicGI:4504067NLDYVATSIHEAVTK 2 
A7489PPM1K, PP2CM, UG0882E07Protein phosphatase 1K, mitochondrial precursorGI:22902184NLETLLTLAFLEIDK 2 
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525NLGLEELGIELDPR 3 
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559NLIPFDQM*TIEDLNEAFPETK 3 Pept_E (Sonar search): 1.00E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559NLIPFDQMTIEDLNEAFPETK 3 Pept_E (Sonar search): 3.30E-02
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559NLIPFDQMTIEDLNEAFPETK 2 
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorGI:14327942NLLHVTDTGVGMTR 2 Pept_E (Sonar search): 5.00E-04
A2004HSP90B1, GRP94, TRA1Endoplasmin precursorGI:14327942NLLHVTDTGVGMTR 2 
A6103COX7CCytochrome c oxidase polypeptide VIIc, mitochondrial precursorGI:4502993NLPFSVENK 2 Pept_E (Sonar search): 4.50E-03
A3202MYH7, MYHCBMyosin-7GI:4557773NLQEEISDLTEQLGSSGK 2 Pept_E (Sonar search): 5.40E-09
A3202MYH7, MYHCBMyosin-7GI:12053672NLQEEISDLTEQLGSSGK 3 Pept_E (Sonar search): 2.40E-03
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:20178326NLQHHDYSTYTFLDLNLELSK 3 Pept_E (Sonar search): 2.00E-03
A884BCLTCL1, CLH22, CLTCLClathrin heavy chain 2GI:9257202NLQNLLILTAIK 2 
A1466FN1, FNFibronectinGI:31397NLQPASEYTVSLVAIK 2 Pept_E (Sonar search): 8.50E-05
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312NLSIYDGPEQR 2 Pept_E (Sonar search): 3.90E-02
A335DHES1, KNPIES1 protein homolog, mitochondrial precursorGI:2250700NLSTFAVDGK 2 Pept_E (Sonar search): 1.60E-01
A3202MYH7, MYHCBMyosin-7GI:12053672NLTEEMAGLDEIIAK 2 Pept_E (Sonar search): 2.20E-01
A310CRAB14Ras-related protein Rab-14GI:16758368NLTNPNTVIILIGNK 2 
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261NLVEKTPALVNAAVTYSKPR 3 Pept_E (Sonar search): 2.70E-02
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:6166556NLVHIITHGEEK 2 Pept_E (Sonar search): 1.30E-06
A118CMYL2Myosin regulatory light chain 2, ventricular/cardiac muscle isoformGI:6166556NLVHIITHGEEK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069NM*GLYGER 2 Pept_E (Sonar search): 3.00E-01
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201NNFAVGYR 2 Pept_E (Sonar search): 3.40E-02
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356NNGAGYFLEHLAFK 2 Pept_E (Sonar search): 4.60E-01
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356NNGAGYFLEHLAFK 3 Pept_E (Sonar search): 3.20E-03
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841NNGAGYFLEHLAFK 3 
A3202MYH7, MYHCBMyosin-7GI:12053672NNLLQAELEELR 2 Pept_E (Sonar search): 2.20E-01
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570NNTVGLIQLNRPK 3 Pept_E (Sonar search): 3.80E-02
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228NPFGNAGLLLGEAGK 2 Pept_E (Sonar search): 1.60E-03
A3913GBAS, NIPSNAP2Protein NIPSNAP homolog 2GI:4503937NQLLLEFSFWNEPVPR 2 
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionGI:21757093NQVSLTCLVK 2 MS2 score: 41
A8269IGHG2Ig gamma-2GI:243169NQVSLTCLVK 2 MS2 score: 46
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127NRLEEVSPNLVR 3 Pept_E (Sonar search): 1.50E-04
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025NSDSILEAIQK 2 Pept_E (Sonar search): 8.20E-04
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025NSDSILEAIQKK 2 Pept_E (Sonar search): 2.70E-01
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025NSDSILEAIQKK 3 Pept_E (Sonar search): 3.00E-03
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:2119276NSSYFVEWIPNNVK 2 
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657NTFWDVDGSM*VPPEWHR 3 Pept_E (Sonar search): 4.00E-01
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657NTFWDVDGSMVPPEWHR 3 Pept_E (Sonar search): 1.20E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867NTIVTSYNR 2 Pept_E (Sonar search): 3.80E-01
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252NTNAGAPPGTAYQSPLPLSR 3 Pept_E (Sonar search): 2.00E-02
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080NTVVATGGYGR 2 Pept_E (Sonar search): 3.30E-04
A3942STOML2, SLP2, HSPC108Membrane associated protein SLP-2GI:7513076NTVVLFVPQQEAWVVER 2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589NVEAMNFADIER 2 Pept_E (Sonar search): 1.60E-03
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainGI:1805280NVEDIELWLYEVEGHLASDDYGK 3 Pept_E (Sonar search): 7.20E-03
A3793PHBProhibitinGI:4505773NVPVITGSK 2 Pept_E (Sonar search): 8.00E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810NVQAEEM*VEFSSGLK 2 Pept_E (Sonar search): 3.50E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810NVQAEEMVEFSSGLK 2 Pept_E (Sonar search): 7.60E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810NVQAEEMVEFSSGLK 3 Pept_E (Sonar search): 2.80E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110NVQAEEMVEFSSGLK 2 
A3675DBT, BCATE2Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor E2GI:4503265NVQICSIFDIATELNR 2 Pept_E (Sonar search): 1.60E-07
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327NVVVVDGVR 2 Pept_E (Sonar search): 3.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844NYDGDVQSDILAQGFGSLGLMTSVLVCPDGK 3 Pept_E (Sonar search): 4.50E-05
A903BCOX6CCytochrome c oxidase polypeptide VIc precursorGI:4758040NYDVMKDFEEMR 3 Pept_E (Sonar search): 3.90E-02
A3201MYH6, MYHCA, alpha-MHCMyosin-6GI:20542063NYHIFYQILSNK 2 
A3201MYH6, MYHCA, alpha-MHCMyosin-6GI:27764861NYHIFYQILSNK 2 Pept_E (Sonar search): 9.20E-03
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorGI:27436901NYIQGINLVQAK 2 Pept_E (Sonar search): 1.20E-03
A9587MRPL12, RPML12, 5C560S ribosomal protein L12, mitochondrial precursorGI:27436901NYIQGINLVQAK 2 
A5932BLVRB, FLRFlavin reductaseGI:4502419PAHVVVGDVLQAADVDK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001PAINVGLSVSR 2 
A4286COX17Cytochrome c oxidase copper chaperoneGI:7512358PGLVDSNPAPPESQEK 2 MS2 score: 33
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:21361103PIWLQIAESAYR 3 
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:14603309PLVIIAEDVDGEALSTLVLNR 2 
A1816PDIA3, ERP57, ERP60Protein disulfide isomerase A3 precursorGI:1085373PSHLTNKFEDKTVAYTEPK 2 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687PVGHCLEAAAVLSK 3 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2564245PVIPPVSTPGQPNAVGTFTEIPASNIR 2 
A6228COX6A2, COX6A, COX6AHCytochrome c oxidase polypeptide VIa-heart, mitochondrial precursorGI:4885149PYQHLR 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570QAASSLQQASLK 2 Pept_E (Sonar search): 1.30E-03
A5856ATP5EP2ATP synthase subunit esilon-like protein, mitochondrialGI:27482565QAGLSYIR 2 MS2 score: 41
A3951SFXN1Sideroflexin 1GI:18561987QAITQVVVSR 2 Pept_E (Sonar search): 6.00E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618QASIQHIQNAIDTEK 2 Pept_E (Sonar search): 4.00E-03
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618QASIQHIQNAIDTEK 3 Pept_E (Sonar search): 1.40E-02
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359QATSTASTFVKPIFSR 3 Pept_E (Sonar search): 7.00E-03
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728QAVLGAGLPISTPCTTINK 3 Pept_E (Sonar search): 4.20E-03
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570QAVTNPNNTFYATK 2 Pept_E (Sonar search): 1.00E-01
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:2134870QCQAVIESSYQVAK 2 Pept_E (Sonar search): 8.10E-03
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918QDM*PPPGGYGPIDYK 2 Pept_E (Sonar search): 1.60E-02
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918QDM*PPPGGYGPIDYK 3 Pept_E (Sonar search): 6.20E-03
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918QDMPPPGGYGPIDYK 2 Pept_E (Sonar search): 1.70E-01
A3604MCCC1, MCCAMethylcrotonyl-CoA carboxylase alpha chain, mitochondrial precursorGI:13518228QEGIIFIGPPPSAIR 2 Pept_E (Sonar search): 1.40E-02
A4212PSAP, GLBA, SAP1Proactivator polypeptide precursorGI:337765QEILAALEK 2 Pept_E (Sonar search): 6.30E-03
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883QEYDEAGPSIVHR 3 Pept_E (Sonar search): 4.50E-04
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202QFNYTHICAGASAFGK 2 Pept_E (Sonar search): 3.30E-03
A205CNDUFB2NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 mitochondrial precursorGI:4758778QFPQLTR 2 Pept_E (Sonar search): 1.10E-01
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325QFTPCQLLADHANSPNK 3 Pept_E (Sonar search): 1.40E-01
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325QFTPCQLLADHANSPNKK 3 Pept_E (Sonar search): 1.10E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325QFTPCQLLADHANSPNKK 4 Pept_E (Sonar search): 9.00E-02
A5742AFG3L2AFG3-like protein 2GI:5802970QGDMVLEKPYSEATAR 3 Pept_E (Sonar search): 2.10E-04
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728QGEYGLASICNGGGGASAM*LIQK 3 Pept_E (Sonar search): 1.30E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536QGFNVVVESGAGEASK 2 Pept_E (Sonar search): 1.40E-03
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536QGFNVVVESGAGEASK 3 Pept_E (Sonar search): 1.80E-06
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867QGLLPLTFADPADYNK 2 Pept_E (Sonar search): 2.40E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867QGLLPLTFADPADYNK 3 Pept_E (Sonar search): 4.30E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810QGQYSPMAIEEQVAVIYAGVR 3 Pept_E (Sonar search): 1.00E-01
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001QGQYSPMAIEEQVAVIYAGVR 2 Pept_E (Sonar search): 2.10E-06
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001QGQYSPMAIEEQVAVIYAGVR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110QGQYSPMAIEEQVAVIYAGVR 2 Pept_E (Sonar search): 2.10E-06
A3697SUCLG1Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursorGI:11321581QGTFHSQQALEYGTK 3 Pept_E (Sonar search): 3.10E-02
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687QGTHITVVSHSR 2 
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorGI:13661132QGTIFLAGPPLVK 2 MS2 score: 37
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550QHPQPYIFPDSPGGTSYER 3 Pept_E (Sonar search): 2.30E-06
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816QIEGHTICALGDGAAWPVQGLIR 3 Pept_E (Sonar search): 1.60E-01
A5742AFG3L2AFG3-like protein 2GI:5802970QIFIGPPDIK 2 Pept_E (Sonar search): 1.30E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611QIGVEHVVVYVNK 2 Pept_E (Sonar search): 1.10E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611QIGVEHVVVYVNK 3 Pept_E (Sonar search): 1.50E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384QIGVEHVVVYVNK 2 Pept_E (Sonar search): 4.40E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384QIGVEHVVVYVNK 3 
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2GI:438069QITVNDLPVGR 2 MS2 score: 33
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792QKEVNENFAIDLIAEQPVSEVETR 3 Pept_E (Sonar search): 7.00E-04
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558QLFLGGVDR 2 Pept_E (Sonar search): 6.40E-03
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040QLITVTMSSDSR 2 Pept_E (Sonar search): 1.10E-03
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040QLPFIDISVAVATDK 2 Pept_E (Sonar search): 8.00E-02
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550QLQEETPPGGPLTEALPPAR 3 Pept_E (Sonar search): 2.40E-05
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550QLQEETPPGGPLTEALPPARK 3 Pept_E (Sonar search): 6.00E-02
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999QLSAFGEYVAEILPK 2 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLGI:17461670QLVKPEQLPIYTAPPLQSK 3 Pept_E (Sonar search): 2.70E-02
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QM*FGNADM*NTFPTFK 2 Pept_E (Sonar search): 7.50E-01
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199QM*IGYNLATK 2 Pept_E (Sonar search): 1.60E-01
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QMFGNADM*NTFPTFK 2 Pept_E (Sonar search): 9.50E-01
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QMFGNADM*NTFPTFK 3 Pept_E (Sonar search): 8.00E-02
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QMFGNADMNTFPTFK 2 Pept_E (Sonar search): 9.90E-04
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199QMIGYNLATK 2 Pept_E (Sonar search): 6.00E-02
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040QMPDVNVSWDGEGPK 2 Pept_E (Sonar search): 2.00E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810QMSLLLR 2 Pept_E (Sonar search): 6.70E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590QNCELFEQLGEYK 2 Pept_E (Sonar search): 1.50E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590QNCELFEQLGEYK 3 Pept_E (Sonar search): 2.20E-01
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345QNCELFEQLGEYK 2 Pept_E (Sonar search): 2.40E-02
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025QNGWLPISAMNK 2 Pept_E (Sonar search): 7.00E-03
A5984CTSD, CPSDCathepsin D precursorGI:67677QPGITFIAAK 2 MS2 score: 36
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049QPVYVVDVSK 2 Pept_E (Sonar search): 4.90E-02
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650QQYLQSIEER 2 Pept_E (Sonar search): 1.90E-03
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734QSDVM*IVAGTLTNK 2 Pept_E (Sonar search): 4.60E-04
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734QSDVMIVAGTLTNK 2 Pept_E (Sonar search): 1.50E-02
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734QSDVMIVAGTLTNK 3 Pept_E (Sonar search): 6.20E-04
A565DISOC2Isochorismatase domain-containing protein 2 mitochondrialGI:16878298QSGAFLSTSEGLILQLVGDAVHPQFK 3 
A220CNDUFV3NADH-ubiquinone oxidoreductase 9 kDa subunit, mitochondrial precursorGI:10280538QSPPKKPAPVPAEPFDNTTYK 4 Pept_E (Sonar search): 6.00E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345QTALVELVK 2 Pept_E (Sonar search): 1.20E-01
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QTSGGPVDASSEYQQELER 2 Pept_E (Sonar search): 2.40E-04
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080QTSGGPVDASSEYQQELER 3 Pept_E (Sonar search): 5.60E-05
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083QVAELSECIGSALIQK 3 Pept_E (Sonar search): 1.50E-04
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827QVAEQFLNMR 2 Pept_E (Sonar search): 1.80E-02
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292QVAEVNLWGTVR 2 Pept_E (Sonar search): 7.20E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862QVASM*TKPTTIIEK 3 Pept_E (Sonar search): 4.30E-02
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862QVASMTKPTTIIEK 3 Pept_E (Sonar search): 5.00E-02
A3589PYGMGlycogen phosphorylase, muscle formGI:5032009QVIEQLSSGFFSPKQPDLFK 2 
A3793PHBProhibitinGI:4505773QVSDDLTER 2 Pept_E (Sonar search): 2.30E-02
A1504CD36, GP3B, GP4Platelet glycoprotein 4GI:4557419QVVLEEGTIAFK 2 Pept_E (Sonar search): 1.80E-02
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817QYLSGELEVELTPQGTLAER 3 Pept_E (Sonar search): 4.80E-02
A211CNDUFB8NADH-ubiquinone oxidoreductase ASHI subunit, mitochondrial precursorGI:4689104QYPYNNLYLER 2 Pept_E (Sonar search): 9.90E-04
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11GI:17455445QYWDIPDGTDCHR 3 Pept_E (Sonar search): 1.00E-02
A7298PARP16Poly (ADP-ribose) polymerase family, member 16GI:21411003RAWDLVSWILSSK 2 
A638DKRI1Protein KRI1 homologGI:14602715REAPLTGK 1 
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855REVENVAITALEGLK 3 Pept_E (Sonar search): 1.70E-05
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197REYYFAITMER 2 Pept_E (Sonar search): 9.40E-05
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238RFSMVVQDGIVK 2 Pept_E (Sonar search): 4.60E-04
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238RFSMVVQDGIVK 2 
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855RGTGGVDTAAVADVYDISNIDR 3 Pept_E (Sonar search): 2.60E-06
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521RGTGGVDTAAVADVYDISNIDR 3 Pept_E (Sonar search): 1.30E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521RGTGGVDTAAVADVYDISNIDR 2 
A3692CKM, CKMMCreatine kinase, M chainGI:21536288RGTGGVDTAAVGSVFDVSNADR 3 Pept_E (Sonar search): 3.70E-06
A3692CKM, CKMMCreatine kinase, M chainGI:21536288RGTGGVDTAAVGSVFDVSNADR 3 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618RHYLFDVQR 2 Pept_E (Sonar search): 3.90E-04
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777RIAEFAFEYAR 2 
A0535DES, CSM-7, CSM-6DesminGI:19698555RIESLNEEIAFLK 3 
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999RILTDYGFEGHPFR 2 
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356RIPLAEWESR 3 Pept_E (Sonar search): 1.50E-02
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841RIPLAEWESR 3 Pept_E (Sonar search): 2.70E-04
A6822AK1Adenylate kinase isoenzyme 1GI:4502011RLETYYK 2 
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392RLNDFASTVR 2 Pept_E (Sonar search): 4.50E-05
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392RLNDFASTVR 2 
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804RLPENLYNDR 3 Pept_E (Sonar search): 8.90E-03
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:5454152RLPENLYNDR 2 
A2003HSP90AB1, HSP90B, HSPC2Heat shock protein 90kDa alpha (cytosolic), class B member 1GI:20149594RLSELLRYHTSQSGDEMTSLSEYVSR 3 
A216CNDUFC2, HLC1NADH dehydrogenase [ubiquinone] 1 subunit C2GI:4886457RNPEPLR 2 MS2 score: 50
A1581ALB, GIG20, GIG42Serum albumin precursorGI:7959791RPCFSALEVDETYVPK 2 Pept_E (Sonar search): 6.50E-05
A3195MYH4Myosin heavy chain, skeletal muscle, fetalGI:11024712RQAEEAEEQSNVNLAKFRK 2 
A0391ATP5J, ATP5A, ATPMATP synthase coupling factor 6, mitochondrial precursorGI:14780080RQTSGGPVDASSEYQQELER 3 Pept_E (Sonar search): 2.30E-02
A3202MYH7, MYHCBMyosin-7GI:4557773RSEAPPHIFSISDNAYQYMLTDR 3 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001RTGAIVDVPVGEELLGR 2 Pept_E (Sonar search): 7.90E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001RTGAIVDVPVGEELLGR 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110RTGAIVDVPVGEELLGR 2 Pept_E (Sonar search): 2.60E-04
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774RTPVQPNPIVYMMK 3 Pept_E (Sonar search): 1.30E-01
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827RWEVADLQPQLK 3 Pept_E (Sonar search): 5.90E-03
A3949MTCH2, MIMP, HSPC032Mitochondrial carrier homolog 2GI:7657347SAATLITHPFHVITLR 2 Pept_E (Sonar search): 5.40E-05
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:12314197SALSGHLETVILGLLK 2 Pept_E (Sonar search): 6.30E-04
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:12314197SALSGHLETVILGLLK 2 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536SAPLLLPGR 2 Pept_E (Sonar search): 1.80E-03
A4940LDB3, ZASPLIM domain-binding protein 3GI:5441369SASYNLSLTLQK 2 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127SATYVNTEGR 2 Pept_E (Sonar search): 4.20E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325SAVLISSKPGCFIAGADINMLAACK 3 Pept_E (Sonar search): 1.10E-01
A1742HBB, beta-globinHemoglobin beta chainGI:1431650SAVTALWGK 2 Pept_E (Sonar search): 3.20E-02
A3202MYH7, MYHCBMyosin-7GI:4557773SAYLMGLNSADLLK 2 
A3202MYH7, MYHCBMyosin-7GI:12053672SAYLMGLNSADLLK 2 Pept_E (Sonar search): 9.90E-03
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559SCAEWVSLSK 2 Pept_E (Sonar search): 4.00E-04
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201SCSGVEFSTSGSSNTDTGK 2 Pept_E (Sonar search): 5.90E-03
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221SCSGVMEFSTSGHAYTDTGK 3 Pept_E (Sonar search): 1.50E-04
A9987MACROD1, LRP16O-acetyl-ADP-ribose deacetylase MACROD1GI:12653017SCYLSSLDLLLEHR 3 
A7646CRYZCrystallin zetaGI:585013SDIAVPIPK 2 MS2 score: 34
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570SDIGEVILVGGMTR 2 Pept_E (Sonar search): 3.10E-02
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688SDIGEVILVGGMTR 2 
A0970CASQ2Calsequestrin, cardiac muscle isoform precursorGI:23503043SDPDGYEFLEILK 2 
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011SDPIMLLK 2 Pept_E (Sonar search): 1.20E-01
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981SEDFSLPAYMDR 2 Pept_E (Sonar search): 9.60E-04
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981SEDFSLPAYMDRR 3 Pept_E (Sonar search): 3.90E-02
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768SEFEQNLSEK 2 Pept_E (Sonar search): 5.40E-03
A5672ACOT1, CTE1Acyl-coenzyme A thioesterase 1GI:17477171SEFYANEACK 2 Pept_E (Sonar search): 1.20E-03
A7900SUCLG2Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial precursorGI:3766199SENEPIENEAAK 2 Pept_E (Sonar search): 5.00E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427SENGLEFTSSGSANTETTK 2 Pept_E (Sonar search): 5.00E-06
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427SENGLEFTSSGSANTETTK 3 Pept_E (Sonar search): 1.40E-04
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875SEVATLTAAGK 2 Pept_E (Sonar search): 2.60E-04
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855SEVELVQIVIDGVNYLVDCEK 3 Pept_E (Sonar search): 5.10E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521SEVELVQIVIDGVNYLVDCEK 2 Pept_E (Sonar search): 4.70E-07
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325SEVSSDEDIQFR 2 Pept_E (Sonar search): 2.70E-03
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049SFAFVGPSR 2 Pept_E (Sonar search): 8.00E-03
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303SFLSQGQVLK 2 Pept_E (Sonar search): 7.00E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303SFLSQGQVLK 1 
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303SFLSQGQVLK 1 Pept_E (Sonar search): 3.80E-04
A3692CKM, CKMMCreatine kinase, M chainGI:21536288SFLVWVNEEDHLR 2 Pept_E (Sonar search): 1.00E-06
A3692CKM, CKMMCreatine kinase, M chainGI:21536288SFLVWVNEEDHLR 3 
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197SFQGPVLIGSSHGGVNIEDVAAETPEAIIK 3 Pept_E (Sonar search): 3.80E-06
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197SFQGPVLIGSSHGGVNIEDVAAETPEAIIK 3 
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorGI:27923741SFTDLYIQIIR 2 Pept_E (Sonar search): 5.00E-03
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062SFTGNFVIDENILK 2 Pept_E (Sonar search): 1.60E-03
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062SFTGNFVIDENILK 2 Pept_E (Sonar search): 9.40E-03
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062SFTGNFVIDENILK 3 
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062SGAVEETFR 2 Pept_E (Sonar search): 1.80E-03
A4230SSBP1, SSBPSingle-stranded DNA-binding protein, mitochondrial precursorGI:2624695SGDSEVYQLGDVSQK 2 MS2 score: 41
A7403PCMT1Protein-L-isoaspartate (D-aspartate) O-methyltransferaseGI:88512SGGASHSELIHNLR 3 Pept_E (Sonar search): 4.60E-06
A7403PCMT1Protein-L-isoaspartate (D-aspartate) O-methyltransferaseGI:88512SGGASHSELIHNLR 3 
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312SGILAAESIFNQLTSENLQSK 2 Pept_E (Sonar search): 2.30E-05
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312SGILAAESIFNQLTSENLQSK 3 Pept_E (Sonar search): 2.60E-02
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312SGILAAESIFNQLTSENLQSK 2 
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547SGLGELILPENEPGSSIM*PGK 3 Pept_E (Sonar search): 1.00E-01
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356SGMFWLR 2 Pept_E (Sonar search): 1.40E-01
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007SGNGEVTFENVK 2 Pept_E (Sonar search): 5.30E-01
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5042402SGPFAPVLSATSR 1 
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743SGPFAPVLSATSR 2 Pept_E (Sonar search): 9.00E-02
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743SGPFAPVLSATSR 3 Pept_E (Sonar search): 1.20E-02
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainGI:2119276SGPFGQIFRPDNFVFGQSGAGNNWAK 3 
A3913GBAS, NIPSNAP2Protein NIPSNAP homolog 2GI:2769254SGPNIYELR 2 Pept_E (Sonar search): 5.80E-03
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345SHCIAEVENDEMPADLPSLAADFVESK 3 Pept_E (Sonar search): 4.20E-03
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:3108055SHLSGYDYVGFTNSYFGN 2 Pept_E (Sonar search): 1.10E-03
A5150SPTA1, SPTASpectrin alpha chain, erythrocyteGI:3108055SHLSGYDYVGFTNSYFGN 2 
A304CUQCRHUbiquinol-cytochrome C reductase complex 11 kDa protein, mitochondrial precursorGI:5174745SHTEEDCTEELFDFLHAR 3 Pept_E (Sonar search): 1.30E-06
A304CUQCRHUbiquinol-cytochrome C reductase complex 11 kDa protein, mitochondrial precursorGI:5174745SHTEEDCTEELFDFLHAR 4 Pept_E (Sonar search): 1.30E-04
A5957CRAT, CAT1Carnitine O-acetyltransferaseGI:21618334SHVAGQMLHGGGSR 3 Pept_E (Sonar search): 9.80E-05
A6103COX7CCytochrome c oxidase polypeptide VIIc, mitochondrial precursorGI:4502993SHYEEGPGK 2 Pept_E (Sonar search): 1.00E-02
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:21756162SIARALNREYFR 2 
A9056SLAM, SLAMF1Signaling lymphocytic activation molecule precursorGI:15072538SIHIVVTMAK 2 Pept_E (Sonar search): 4.80E-03
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainGI:32015SIQFVDWCPTGFK 3 
A1390EHD4, HCA10, HCA11EH-domain containing protein 4GI:11066968SISVIDSPGILSGEK 2 Pept_E (Sonar search): 3.00E-03
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4406579SITIIGGGFLGSELACALGR 2 Pept_E (Sonar search): 4.90E-04
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862SIVTLDGGK 2 Pept_E (Sonar search): 1.30E-01
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4406579SIYFQPPSFYVSAQDLPHIENGGVAVLTGK 3 
A6408ECHS1Enoyl-CoA hydratase, mitochondrial precursorGI:12707570SLAMEMVLTGDR 2 Pept_E (Sonar search): 3.50E-03
A853BSDHC, CYB560, SDH3Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursorGI:4506863SLCLGPALIHTAK 3 Pept_E (Sonar search): 6.00E-02
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429SLDLDISK 2 Pept_E (Sonar search): 4.90E-02
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429SLDLDISK 2 Pept_E (Sonar search): 2.20E-01
A7156NFS1, NIFS, HUSSY-08Cysteine desulfurase, mitochondrial precursorGI:3646132SLEAEGFQVTYLPVQK 2 
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735SLEPLPSSGPDFGGLGEEAEFVEVEPEAK 3 Pept_E (Sonar search): 2.90E-02
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384SLERAEAGDNLGALVRGLK 2 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536SLGAEPLEVDLK 2 Pept_E (Sonar search): 4.70E-03
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862SLGVGFATR 2 Pept_E (Sonar search): 2.30E-01
A3540CCT2, 99D8.1, CCTBT-complex protein 1, beta subunitGI:5453603SLHDALCVLAQTVK 2 Pept_E (Sonar search): 3.80E-07
A3668IDH3BIsocitrate dehydrogenase [NAD] subunit beta, mitochondrial precursorGI:2737886SLPGYMTR 2 MS2 score: 34
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549SLQDIIAILGM*DELSEEDKLTVSR 3 Pept_E (Sonar search): 6.20E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295SLQDIIAILGMDELSEEDK 2 Pept_E (Sonar search): 4.00E-13
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295SLQDIIAILGMDELSEEDK 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549SLQDIIAILGMDELSEEDKLTVSR 3 Pept_E (Sonar search): 3.60E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549SLQDIIAILGMDELSEEDKLTVSR 4 Pept_E (Sonar search): 6.10E-04
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788SLVDLTAVDVPTR 2 Pept_E (Sonar search): 2.30E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788SLVDLTAVDVPTR 3 Pept_E (Sonar search): 9.20E-01
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999SLVDLTAVDVPTR 2 Pept_E (Sonar search): 4.50E-05
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999SLVDLTAVDVPTR 2 
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827SM*AASGNLGHTPFVDEL 2 Pept_E (Sonar search): 1.00E+00
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807SNIWVAGDAACFYDIK 2 Pept_E (Sonar search): 4.70E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127SNYLLNTTIAGVEEADVVLLVGTNPR 3 Pept_E (Sonar search): 4.60E-03
A3621SUCLA2Succinyl-CoA ligase [ADP-forming] beta-chain, mitochondrial precursorGI:3766197SPDEAYAIAK 2 Pept_E (Sonar search): 4.40E-04
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202SPDTFVR 2 Pept_E (Sonar search): 1.70E-01
A3202MYH7, MYHCBMyosin-7GI:12053672SPGVMDNPLVMHQLR 3 Pept_E (Sonar search): 9.50E-04
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007SPSVAVVQPK 2 Pept_E (Sonar search): 2.10E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541SQETECTYFSTPLLLGK 2 Pept_E (Sonar search): 5.00E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541SQETECTYFSTPLLLGK 3 Pept_E (Sonar search): 1.20E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867SQFTITPGSEQIR 2 Pept_E (Sonar search): 5.20E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867SQFTITPGSEQIR 3 Pept_E (Sonar search): 1.50E-01
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083SQIDDLYSTIK 2 Pept_E (Sonar search): 2.70E-03
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:13938297SQIHDIVLVGGSTR 2 Pept_E (Sonar search): 5.70E-07
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinGI:13938297SQIHDIVLVGGSTR 2 
A822BAPOO, FAM121B, My025Apolipoprotein O precursorGI:12001992SQLEESISQLR 2 Pept_E (Sonar search): 7.70E-04
A1504CD36, GP3B, GP4Platelet glycoprotein 4GI:115982SQVLQFFSSDICR 2 Pept_E (Sonar search): 2.20E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203SSGGFVWACK 2 Pept_E (Sonar search): 1.60E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844SSGGFVWACK 2 Pept_E (Sonar search): 4.20E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1362844SSGGFVWACK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575SSGGFVWACK 2 Pept_E (Sonar search): 2.60E-02
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252SSPYPTDVAR 2 Pept_E (Sonar search): 2.00E-02
A7783OXCT1, OXCT, SCOTSuccinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial precursorGI:4557817STGCDFAVSPK 2 Pept_E (Sonar search): 1.40E-02
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:11291397STGEALVQGLMGAAVTLK 2 
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:27500021STGEALVQGLMGAAVTLK 2 Pept_E (Sonar search): 2.00E-04
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorGI:4502037STGSIVGQQPFGGAR 2 Pept_E (Sonar search): 3.60E-02
A0742TTNTitinGI:17066105STHHVVSGLR 2 Pept_E (Sonar search): 9.20E-05
A0742TTNTitinGI:17066105STHHVVSGLR 2 
A3197MYH2, MYHSA2Myosin-2GI:8923940STHPHFVR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325STKPIVAAINGSCLGGGLEVAISCQYR 3 Pept_E (Sonar search): 1.90E-02
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialGI:4235226STLQTLPEIVAK 2 MS2 score: 50
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570STNGDTFLGGEDFDQALLR 2 Pept_E (Sonar search): 9.30E-03
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570STNGDTFLGGEDFDQALLR 3 Pept_E (Sonar search): 3.20E-02
A7121CYB5R3, DIA1, B5RDiaphoraseGI:352335STPAITLESPDIK 2 Pept_E (Sonar search): 1.00E-01
A7196ND3, NADH3, AD 1NADH-ubiquinone oxidoreductase chain 3GI:2245566STPYECGFDPMSPAR 2 MS2 score: 69
A645BTMEM143, UNQ5922/PRO19813, TVEL5922Transmembrane protein 143GI:16877328STSNNSELLSALALR 2 Pept_E (Sonar search): 4.90E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810STVAQLVK 2 Pept_E (Sonar search): 5.00E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001STVAQLVK 1 Pept_E (Sonar search): 3.10E-03
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040STVPHAYATADCDLGAVLK 3 Pept_E (Sonar search): 2.50E-03
A3602PCCBPropionyl-CoA carboxylase beta chain, mitochondrial precursorGI:1082723SVTNEDVTQEELGGAK 2 Pept_E (Sonar search): 2.40E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127SWLHNDLK 2 Pept_E (Sonar search): 1.40E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559SWNETLTSR 2 Pept_E (Sonar search): 1.00E-01
A7346PDK4, PDHK4Pyruvate dehydrogenase [lipoamide kinase] isozyme 4, mitochondrial precursorGI:4505693SWYIQSLMDLVEFHEK 2 Pept_E (Sonar search): 1.40E-05
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainGI:4502277SYEAYVLNIVR 2 Pept_E (Sonar search): 1.40E-03
A0344ATP1B1, ATP1BSodium/potassium-transporting ATPase beta-1 chainGI:4502277SYEAYVLNIVR 2 
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883SYELPDGQVITIGNER 2 Pept_E (Sonar search): 8.30E-03
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369SYGANFSWNK 2 Pept_E (Sonar search): 4.70E-02
A217CNDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrialGI:4505369SYGANFSWNKR 2 Pept_E (Sonar search): 4.00E-05
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080SYQYLVESIR 2 Pept_E (Sonar search): 2.30E-04
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080SYQYLVESIR 2 
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:27666102SYQYLVESIR 2 Pept_E (Sonar search): 4.40E-04
A8364IGL, IGLV3-22, V2-15Ig lambda chainGI:33700SYSCQVTHEGSTVEK 3 MS2 score: 37
A3681GLUD2, GLUDP1Glutamate dehydrogenase 2, mitochondrial precursorGI:6912392TAAYVNAIEK 2 Pept_E (Sonar search): 1.30E-02
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062TAIHTAAMDMLGGPGIESQCR 3 Pept_E (Sonar search): 1.50E-04
A3780IARS2Isoleucyl-tRNA synthetase, mitochondrial precursorGI:8922356TALAEAELEYNPEHVSR 3 Pept_E (Sonar search): 3.40E-03
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609TALAMGADR 2 Pept_E (Sonar search): 8.00E-02
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:14603309TALLDAAGVASLLTTAEVVVTEIPK 3 
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558TAVAPIER 2 Pept_E (Sonar search): 4.50E-01
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069TCGFDFTGAVEDISK 2 Pept_E (Sonar search): 7.70E-03
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590TCVADESAENCDK 2 Pept_E (Sonar search): 8.20E-03
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427TDEFQLHTNVNDGTEFGGSIYQK 3 Pept_E (Sonar search): 3.10E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303TDPSILGGM*IVR 2 Pept_E (Sonar search): 8.10E-01
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303TDPSILGGMIVR 2 Pept_E (Sonar search): 5.00E-02
A6910LONP1, PRSS15Lon protease homolog, mitochondrial precursorGI:414046TENPLILIDEVDK 2 Pept_E (Sonar search): 1.30E-02
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390TEQGPQVDETQFK 2 Pept_E (Sonar search): 1.50E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127TESIDVMDAVGSNIVVSTR 2 Pept_E (Sonar search): 7.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127TESIDVMDAVGSNIVVSTR 3 Pept_E (Sonar search): 5.40E-01
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialGI:6980693TFESLVDFSK 2 Pept_E (Sonar search): 1.80E-02
A0535DES, CSM-7, CSM-6DesminGI:19698555TFGGAPGFPLGSPLSSPVFPR 2 
A0254AP2M1, CLAPM1AP-2 complex subunit muGI:1244508TFITQQGIK 2 MS2 score: 38
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855TFLIWINEEDHTR 3 Pept_E (Sonar search): 6.60E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521TFLIWINEEDHTR 2 Pept_E (Sonar search): 7.90E-06
A3691CKMT2Creatine kinase S-type, mitochondrialGI:20810521TFLIWINEEDHTR 3 
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768TFLPEMSEK 2 Pept_E (Sonar search): 6.00E-02
A3603MCCC2, MCCBMethylcrotonyl-CoA carboxylase beta chain, mitochondrial precursorGI:13661132TFYNQAIMSSK 2 MS2 score: 43
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TGAIVDVPVGEELLGR 2 Pept_E (Sonar search): 5.60E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TGAIVDVPVGEELLGR 3 Pept_E (Sonar search): 4.90E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001TGAIVDVPVGEELLGR 2 Pept_E (Sonar search): 2.10E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110TGAIVDVPVGEELLGR 2 Pept_E (Sonar search): 2.10E-03
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201TGDFQLHTNVNDGTEFGGSIYQK 3 Pept_E (Sonar search): 4.10E-06
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:12652825TGDFQLHTNVNDGTEFGGSIYQK 3 Pept_E (Sonar search): 2.80E-03
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:12652825TGDFQLHTNVNDGTEFGGSIYQK 3 
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312TGEYPVPLIR 2 Pept_E (Sonar search): 8.50E-04
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807TGGLEIDSDFGGFR 2 Pept_E (Sonar search): 3.00E-03
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:30147527TGHSILHTLYGR 2 Pept_E (Sonar search): 4.40E-06
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:30147527TGHSILHTLYGR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TGIEQGSDAGYLCESQK 2 Pept_E (Sonar search): 3.70E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TGIEQGSDAGYLCESQK 3 Pept_E (Sonar search): 8.40E-03
A931BCYCS, CYCCytochrome CGI:15929398TGPNLHGLFGR 2 Pept_E (Sonar search): 7.30E-06
A931BCYCS, CYCCytochrome CGI:15929398TGPNLHGLFGR 3 Pept_E (Sonar search): 3.00E-04
A931BCYCS, CYCCytochrome CGI:30584131TGPNLHGLFGR 2 
A931BCYCS, CYCCytochrome CGI:15929398TGQAPGYSYTAANK 3 Pept_E (Sonar search): 5.30E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TGTAEM*SSILEER 2 Pept_E (Sonar search): 4.10E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TGTAEMSSILEER 2 Pept_E (Sonar search): 7.30E-05
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792TGTCGYCGLQFR 2 Pept_E (Sonar search): 3.30E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792TGTCGYCGLQFR 2 Pept_E (Sonar search): 1.40E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792TGTCGYCGLQFR 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618TGVTGPYVLGTGLILYALSK 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618TGVTGPYVLGTGLILYALSK 2 Pept_E (Sonar search): 9.00E-02
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735THFFLNAGNLCNLNYGEGPK 3 Pept_E (Sonar search): 1.20E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064THINYGVK 2 
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493THLPGFVEQAEALK 3 Pept_E (Sonar search): 4.80E-04
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875THSDQFLVAFK 1 Pept_E (Sonar search): 3.10E-05
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875THSDQFLVAFK 3 Pept_E (Sonar search): 2.30E-04
A0379ATP5C1, ATP5C, ATP5CL1ATP synthase gamma chain, mitochondrial precursorGI:543875THSDQFLVAFK 2 
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547THTQDAVPLTLGQEFSGYVQQVK 3 Pept_E (Sonar search): 4.50E-05
A6534FHFumarate hydratase, mitochondrial precursorGI:19743875THTQDAVPLTLGQEFSGYVQQVK 3 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549TIAM*DGTEGLVR 2 Pept_E (Sonar search): 5.90E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549TIAMDGTEGLVR 2 Pept_E (Sonar search): 3.50E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827TIAQGNLSNTDVQAAK 2 Pept_E (Sonar search): 4.50E-03
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239TIDIGVVTAEEALNYGFSGVMLR 2 Pept_E (Sonar search): 4.90E-03
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239TIDIGVVTAEEALNYGFSGVMLR 2 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786TIDIGVVTAEEALNYGFSGVMLR 3 Pept_E (Sonar search): 4.70E-02
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559TIDWVAFAEIIPQNQK 2 Pept_E (Sonar search): 5.20E-04
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559TIDWVAFAEIIPQNQK 2 Pept_E (Sonar search): 3.40E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559TIDWVAFAEIIPQNQK 3 Pept_E (Sonar search): 3.60E-02
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559TIDWVAFAEIIPQNQK 2 
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203TIEAEAAHGTVTR 2 Pept_E (Sonar search): 2.80E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203TIEAEAAHGTVTR 3 Pept_E (Sonar search): 5.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575TIEAEAAHGTVTR 2 Pept_E (Sonar search): 2.30E-04
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575TIEAEAAHGTVTR 3 Pept_E (Sonar search): 9.00E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064TIEYLEEVAITFAK 3 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TIEYLEEVAITFAK 3 Pept_E (Sonar search): 8.00E-03
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:135397TIGGGDDSFNTFFSETGAGK 2 Pept_E (Sonar search): 2.10E-03
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312TIGLHVTEYEDNLK 2 Pept_E (Sonar search): 3.20E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611TIGTGLVTNTLAM*TEEEK 2 Pept_E (Sonar search): 3.30E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611TIGTGLVTNTLAMTEEEK 2 Pept_E (Sonar search): 5.80E-04
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611TIGTGLVTNTLAMTEEEK 3 Pept_E (Sonar search): 8.00E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541TIIPLISQCTPK 2 Pept_E (Sonar search): 3.90E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541TIIPLISQCTPK 3 Pept_E (Sonar search): 9.00E-02
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669TINVYPNFRPTPK 3 Pept_E (Sonar search): 4.00E-01
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390TIPIDGDFFSYTR 2 Pept_E (Sonar search): 1.60E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070TIRPMDMETIEASVMK 3 Pept_E (Sonar search): 3.20E-04
A7199ND5, MTND5, NADH5NADH-ubiquinone oxidoreductase chain 5GI:13273155TISQHQISTSIITSTQK 2 Pept_E (Sonar search): 1.30E-01
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:4503607TIVAINKDPEAPIFQVADYGIVADLFK 3 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202TIYAGNALCTVK 2 Pept_E (Sonar search): 2.40E-03
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735TKDDIIICEIGDVFK 3 Pept_E (Sonar search): 2.00E-03
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427TKSENGLEFTSSGSANTETTK 3 Pept_E (Sonar search): 8.20E-04
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327TLAKPNIR 2 Pept_E (Sonar search): 1.80E-01
A3957MTX2Metaxin 2GI:5729937TLDQVLEDVDQCCQALSQR 3 Pept_E (Sonar search): 9.80E-03
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371TLLWTELFR 2 Pept_E (Sonar search): 1.60E-05
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371TLLWTELFR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080TLNEADCATIPPAIR 2 Pept_E (Sonar search): 2.60E-03
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942953TLNQPDSQLQLTTGNGLFLSEGLK 3 Pept_E (Sonar search): 4.50E-03
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669TLPETLDPAEYNISPETR 2 Pept_E (Sonar search): 1.40E-02
A207CNDUFB4NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDaGI:6041669TLPETLDPAEYNISPETR 3 Pept_E (Sonar search): 8.10E-05
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:14741856TLPQAEALDR 2 Pept_E (Sonar search): 8.70E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TLQEVTQLSQEAQR 2 Pept_E (Sonar search): 1.00E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TLQEVTQLSQEAQR 3 Pept_E (Sonar search): 1.90E-03
A7344PDK2, PDHK2[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursorGI:19923736TLSQFTDALVTIR 2 Pept_E (Sonar search): 1.40E-06
A7344PDK2, PDHK2[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial precursorGI:19923736TLSQFTDALVTIR 3 
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialGI:20141424TLSTIATSTDAASVVHSTDLVVEAIVENLK 3 Pept_E (Sonar search): 2.60E-06
A6693HADH, HAD, HADHSCHydroxyacyl-coenzyme A dehydrogenase, mitochondrialGI:20141424TLSTIATSTDAASVVHSTDLVVEAIVENLK 3 
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363TM*AVLQIEAEKAELR 3 Pept_E (Sonar search): 1.60E-01
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363TMAVLQIEAEK 2 Pept_E (Sonar search): 6.10E-03
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363TMAVLQIEAEKAELR 2 Pept_E (Sonar search): 1.50E-02
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363TMAVLQIEAEKAELR 3 Pept_E (Sonar search): 2.50E-03
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322TMEWFTVLEHYR 2 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070TNHLVTVEGGWPQFGVGAEICAR 3 Pept_E (Sonar search): 1.60E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687TNHLVTVEGGWPQFGVGAEICAR 3 Pept_E (Sonar search): 3.20E-09
A0537ANXA2, ANX2, ANX2L4Annexin A2GI:113950TNQELQEINR 2 MS2 score: 39
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429TNVNGGAIALGHPLGGSGSR 3 Pept_E (Sonar search): 3.00E-02
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589TPAFAESVTEGDVR 2 Pept_E (Sonar search): 4.80E-04
A0390ATP5LATP synthase G chain, mitochondrialGI:29568101TPALVNAAVTYSK 2 
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261TPALVNAAVTYSKPR 3 Pept_E (Sonar search): 6.00E-07
A0647ANXA1, ANX1, LPC1Annexin A1GI:4502101TPAQFDADELR 2 Pept_E (Sonar search): 2.00E-03
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075TPDGTENGDFLALDLGGTNFR 3 Pept_E (Sonar search): 2.90E-02
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429TPFGAYGGLLK 2 Pept_E (Sonar search): 1.20E-04
A7979ACAA2Acetyl-CoA acyltransferase 2GI:12804931TPFGAYGGLLK 1 
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327TPFLLSGTSYK 2 Pept_E (Sonar search): 1.80E-04
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327TPFLLSGTSYK 1 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777TPIAAGHPSMNLLLR 3 Pept_E (Sonar search): 1.60E-02
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777TPIAAGHPSMNLLLR 2 Pept_E (Sonar search): 1.10E-03
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728TPIGSFLGSLSLLPATK 2 Pept_E (Sonar search): 2.60E-02
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728TPIGSFLGSLSLLPATK 3 Pept_E (Sonar search): 5.00E-02
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774TPVQPNPIVYMMK 2 Pept_E (Sonar search): 5.70E-03
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774TPVQPNPIVYMMK 3 Pept_E (Sonar search): 1.20E-01
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228TPVTDPATGAVK 2 Pept_E (Sonar search): 2.60E-04
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777TPYTDVNIVTIR 2 Pept_E (Sonar search): 1.70E-04
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777TPYTDVNIVTIR 2 
A3629IDH3AIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial precursorGI:5031777TPYTDVNIVTIR 2 Pept_E (Sonar search): 1.00E-05
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:30315658TQILAASYELHK 2 Pept_E (Sonar search): 5.40E-03
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1GI:30315658TQILAASYELHK 2 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069TQLVSNLK 2 Pept_E (Sonar search): 2.40E-01
A199CNDUFA7NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7GI:4826850TQPPPKLPVGPSHK 3 Pept_E (Sonar search): 4.40E-02
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239TQPYDVYDQVEFDVPVGSR 2 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786TQPYDVYDQVEFDVPVGSR 2 Pept_E (Sonar search): 3.60E-01
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:4758786TQPYDVYDQVEFDVPVGSR 3 Pept_E (Sonar search): 8.60E-03
A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursorGI:2392312TRPVVAAGAVGLAQR 3 Pept_E (Sonar search): 1.20E-04
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816TSFGSLKDEDR 2 Pept_E (Sonar search): 1.80E-03
A0742TTNTitinGI:17066105TSFHVTNLVPGNEYYFR 2 
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536TSGTLISFIYPAQNPELLNK 2 Pept_E (Sonar search): 4.10E-04
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536TSGTLISFIYPAQNPELLNK 3 Pept_E (Sonar search): 4.10E-03
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:21732286TSGTLISFIYPAQNPELLNK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TSIAIDTIINQK 2 Pept_E (Sonar search): 5.80E-03
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810TSIAIDTIINQK 3 Pept_E (Sonar search): 2.10E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001TSIAIDTIINQK 1 Pept_E (Sonar search): 5.70E-06
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001TSIAIDTIINQK 2 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:24660110TSIAIDTIINQK 1 Pept_E (Sonar search): 3.80E-07
A4502PKD1L3Polycystic kidney disease 1-like 3GI:30158844TSIAIDTIINQK 1 Pept_E (Sonar search): 1.80E-06
A3669IDH3GIsocitrate dehydrogenase 3 [NAD] subunit gamma, mitochondrial precursorGI:28178838TSLDLYANVIHCK 3 
A3562NDUFS2NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrialGI:3540239TSMESLIHHFK 2 
A6204CPT1B, CHKBCarnitine palmitoyltransferase 1BGI:13359213TSPDAFVQIALQLAHFR 2 
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768TSSAETPTIPLGSAVEAIK 2 Pept_E (Sonar search): 5.70E-03
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768TSSAETPTIPLGSAVEAIK 3 Pept_E (Sonar search): 1.20E-02
A4100COQ7Ubiquinone biosynthesis protein COQ7 homologGI:7706391TSVGPVIQK 2 Pept_E (Sonar search): 6.60E-03
A4996MYOM2Myomesin 2GI:4505315TSVVVQWDRPK 2 
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918TTEEALHASHGFMWYT 2 Pept_E (Sonar search): 1.20E-02
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918TTEEALHASHGFMWYT 3 Pept_E (Sonar search): 1.10E-01
A4555ACTA1, ACTAActin, alpha skeletal muscleGI:4501881TTGIVLDSGDGVTHNVPIYEGYALPHAIMR 3 
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848TTGLVGLAVCNTPHER 3 Pept_E (Sonar search): 1.70E-03
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848TTGLVGLAVCNTPHER 2 Pept_E (Sonar search): 2.10E-09
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611TTLTAAITK 2 Pept_E (Sonar search): 2.10E-02
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570TTPSVVAFTADGER 2 Pept_E (Sonar search): 5.40E-01
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1GI:3319075TTVGVDGSLYK 2 Pept_E (Sonar search): 1.90E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536TVAELEAEK 2 Pept_E (Sonar search): 8.00E-02
A5932BLVRB, FLRFlavin reductaseGI:4502419TVAGQDAVIVLLGTR 2 Pept_E (Sonar search): 5.40E-07
A5932BLVRB, FLRFlavin reductaseGI:4502419TVAGQDAVIVLLGTR 2 
A5742AFG3L2AFG3-like protein 2GI:5802970TVAYHEAGHAVAGWYLEHADPLLK 3 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:14741856TVGIDDLTGEPLIQR 2 Pept_E (Sonar search): 1.90E-01
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855TVGMVAGDEESYEVFADLFDPVIK 3 Pept_E (Sonar search): 5.10E-04
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379TVIIEQSWGSPK 2 Pept_E (Sonar search): 3.60E-03
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:29743499TVIIEQSWGSPK 2 
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorGI:14043187TVIQAEIDAAAELIDFFR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064TVLGTPEVLLGALPGAGGTQR 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TVLGTPEVLLGALPGAGGTQR 2 Pept_E (Sonar search): 1.40E-03
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325TVLGTPEVLLGALPGAGGTQR 3 Pept_E (Sonar search): 2.00E-06
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549TVLIM*ELINNVAK 2 Pept_E (Sonar search): 4.50E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549TVLIMELINNVAK 2 Pept_E (Sonar search): 6.90E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549TVLIMELINNVAK 3 Pept_E (Sonar search): 7.50E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295TVLIMELINNVAK 2 Pept_E (Sonar search): 1.90E-07
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295TVLIMELINNVAK 2 
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4GI:223582TVTAMDVVYALK 3 Pept_E (Sonar search): 2.00E-02
A214CNDUFB11, UNQ111/PRO1064, P17.3NADH-ubiquinone oxidoreductase ESSS subunit, mitochondrial precursorGI:9506683TVVAPSAVAGK 2 Pept_E (Sonar search): 7.90E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611TVVTGIEMFHK 2 Pept_E (Sonar search): 1.90E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384TVVTGIEMFHK 2 Pept_E (Sonar search): 8.20E-05
A370ATUFMElongation factor Tu, mitochondrial precursorGI:7443384TVVTGIEMFHK 2 
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:13195586TYFPHFDLSHGSAQVK 2 
A216CNDUFC2, HLC1NADH dehydrogenase [ubiquinone] 1 subunit C2GI:4886457TYGEIFEK 2 MS2 score: 61
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788TYTDELTPIESAVSVFK 2 Pept_E (Sonar search): 2.00E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788TYTDELTPIESAVSVFK 3 Pept_E (Sonar search): 4.30E-04
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999TYTDELTPIESAVSVFK 2 Pept_E (Sonar search): 4.60E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:5138999TYTDELTPIESAVSVFK 2 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070TYYMSGGLQPVPIVFR 2 Pept_E (Sonar search): 1.60E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547VAALTGLPFVTAPNK 2 Pept_E (Sonar search): 1.00E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303VAASVLNPYVK 2 Pept_E (Sonar search): 1.50E-02
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303VAASVLNPYVK 1 
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390VAEELALEQAK 2 Pept_E (Sonar search): 8.80E-04
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390VAEELALEQAK 3 Pept_E (Sonar search): 1.10E-01
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390VAEELALEQAKK 2 Pept_E (Sonar search): 2.70E-03
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390VAEELALEQAKK 3 Pept_E (Sonar search): 4.70E-02
A4004LETM1Leucine zipper-EF-hand containing transmembrane protein 1, mitochondrialGI:4235226VAEVEGEQVDNK 2 MS2 score: 68
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025VAEVLQVPPMR 2 Pept_E (Sonar search): 2.20E-02
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301VAFITGGGTGLGK 2 Pept_E (Sonar search): 1.30E-03
A0384ATP5G3ATP synthase lipid-binding protein, mitochondrial precursorGI:4502301VAFLILFAM 2 
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390VAFTGSTEIGR 2 Pept_E (Sonar search): 3.90E-02
A3699DECR, DECR12,4-dienoyl-CoA reductase 1, mitochondrial precursorGI:4503301VAGHPNIVINNAAGNFISPTER 3 Pept_E (Sonar search): 3.30E-05
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VAGILTVK 2 Pept_E (Sonar search): 1.10E-01
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:16877874VAHALAEGLGVIACIGEK 2 Pept_E (Sonar search): 1.20E-07
A1504CD36, GP3B, GP4Platelet glycoprotein 4GI:4557419VAIIDTYK 2 Pept_E (Sonar search): 1.20E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575VAKPVVEM*DGDEM*TR 3 Pept_E (Sonar search): 1.30E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203VAKPVVEMDGDEMTR 3 Pept_E (Sonar search): 7.60E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575VAKPVVEMDGDEMTR 3 Pept_E (Sonar search): 8.80E-04
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826VALIGSPVDLTYTYDHLGDSPK 2 Pept_E (Sonar search): 9.00E-07
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VALIGSPVDLTYTYDHLGDSPK 3 Pept_E (Sonar search): 1.80E-04
A5721CABC1, ADCK3, PP265Chaperone-activity of bc1 complex-like, mitochondrial precursorGI:10441936VALLDFGATR 2 Pept_E (Sonar search): 1.10E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536VALSPAGVQNLVK 2 Pept_E (Sonar search): 2.20E-04
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:21732286VALSPAGVQNLVK 1 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALTGLTVAEYFR 2 Pept_E (Sonar search): 3.20E-04
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALTGLTVAEYFR 3 Pept_E (Sonar search): 1.50E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VALTGLTVAEYFR 2 Pept_E (Sonar search): 1.90E-08
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VALTGLTVAEYFR 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VALTGLTVAEYFRDQEGQDVLLFIDNIFR 3 Pept_E (Sonar search): 8.50E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALVYGQM*NEPPGAR 2 Pept_E (Sonar search): 1.10E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALVYGQM*NEPPGAR 3 Pept_E (Sonar search): 6.30E-01
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALVYGQMNEPPGAR 2 Pept_E (Sonar search): 4.10E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VALVYGQMNEPPGAR 3 Pept_E (Sonar search): 2.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VALVYGQMNQPPGAR 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VAM*QDATAQM*AM*LQFISSGLSK 3 Pept_E (Sonar search): 8.40E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VAMQDATAQMAMLQFISSGLSK 3 Pept_E (Sonar search): 6.80E-04
A5766ALDH4A1, ALDH4, P5CDHDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursorGI:4502037VANEPVLAFTQGSPER 2 Pept_E (Sonar search): 1.00E-01
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511VAPAPAAVVPPTGPGMAPVPTGVFTDIPISNIR 3 Pept_E (Sonar search): 6.30E-04
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883VAPEEHPTLLTEAPLNPK 3 Pept_E (Sonar search): 1.20E-02
A4555ACTA1, ACTAActin, alpha skeletal muscleGI:4501881VAPEEHPTLLTEAPLNPK 2 
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356VASEQSSQPTCTVGVWIDVGSR 3 Pept_E (Sonar search): 3.80E-04
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841VASEQSSQPTCTVGVWIDVGSR 2 Pept_E (Sonar search): 2.60E-07
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541VAVLGASGGIGQPLSLLLK 2 Pept_E (Sonar search): 2.50E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541VAVLGASGGIGQPLSLLLK 3 Pept_E (Sonar search): 1.10E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VAVPSTIHCDHLIEAQVGGEK 3 Pept_E (Sonar search): 5.40E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VAVTPPGLAR 2 Pept_E (Sonar search): 7.20E-03
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525VCHAHPTLSEAFR 3 Pept_E (Sonar search): 2.10E-03
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525VCHAHPTLSEAFR 3 
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221VCNYGLTFTQK 2 Pept_E (Sonar search): 9.30E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203VCVETVESGAM*TK 2 Pept_E (Sonar search): 2.80E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575VCVETVESGAM*TK 2 Pept_E (Sonar search): 6.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203VCVETVESGAMTK 2 Pept_E (Sonar search): 9.00E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575VCVETVESGAMTK 2 Pept_E (Sonar search): 4.30E-01
A822BAPOO, FAM121B, My025Apolipoprotein O precursorGI:12001992VDELSLYSVPEGQSK 2 Pept_E (Sonar search): 5.00E-02
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541VDFPQDQLTALTGR 2 Pept_E (Sonar search): 1.20E-06
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011VDGM*DILCVR 2 Pept_E (Sonar search): 6.50E-01
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011VDGMDILCVR 2 Pept_E (Sonar search): 1.20E-02
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609VDLVLLGK 2 Pept_E (Sonar search): 1.20E-01
A0341ATP1A2Sodium/potassium-transporting ATPase alpha-2 chain precursorGI:553194VDNSSLTGESEPQTR 2 Pept_E (Sonar search): 3.10E-03
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774VDQEIINIM*QDR 2 Pept_E (Sonar search): 1.10E-02
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774VDQEIINIMQDR 2 Pept_E (Sonar search): 1.20E-02
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774VDQEIINIMQDR 3 Pept_E (Sonar search): 2.60E-02
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312VDQSILTGESVSVIK 2 Pept_E (Sonar search): 1.60E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VDSDTLCTEEVFPTAGAGTDLR 3 Pept_E (Sonar search): 8.00E-02
A159CMBMyoglobinGI:230638VEADIPGHGQEVLIR 2 Pept_E (Sonar search): 1.40E-03
A159CMBMyoglobinGI:230638VEADIPGHGQEVLIR 3 Pept_E (Sonar search): 8.70E-03
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611VEAQVYILSK 2 Pept_E (Sonar search): 7.80E-03
A0631C1QBP, GC1QBP, HABP1Complement component 1, Q subcomponent binding protein, mitochondrial precursorGI:8699626VEEQEPELTSTPNFVVEVIK 2 
A3682DLST, DLTS, E2Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursorGI:643589VEGGTPLFTLR 2 Pept_E (Sonar search): 3.10E-02
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261VELVPPTPAEIPR 2 Pept_E (Sonar search): 9.90E-03
A0390ATP5LATP synthase G chain, mitochondrialGI:7513261VELVPPTPAEIPR 3 Pept_E (Sonar search): 2.50E-03
A6750HSDL2Hydroxysteroid dehydrogenase-like protein 2GI:14150062VESTGAVPEFK 2 Pept_E (Sonar search): 5.30E-01
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2GI:1220311VETGILRPGMVVTFAPVNITTEVK 3 Pept_E (Sonar search): 4.30E-02
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609VETTEDLVAK 2 Pept_E (Sonar search): 6.00E-02
A1422COL6A2Collagen alpha 2(VI) chain precursorGI:17402879VFAVVITDGR 2 
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049VFEISPFEPWITR 2 Pept_E (Sonar search): 5.00E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049VFEISPFEPWITR 3 Pept_E (Sonar search): 1.10E-01
A0261PFKM, PFKX6-phosphofructokinase, muscle typeGI:14043654VFFVHEGYQGLVDGGDHIK 2 Pept_E (Sonar search): 1.90E-03
A1060HIST1H4A, HIST1H4B, HIST1H4CHistone H4GI:223582VFLENVIR 2 Pept_E (Sonar search): 1.20E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070VFLLGEEVAQYDGAYK 2 Pept_E (Sonar search): 1.50E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070VFLLGEEVAQYDGAYK 3 Pept_E (Sonar search): 1.60E-03
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687VFLLGEEVAQYDGAYK 2 Pept_E (Sonar search): 4.40E-09
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:4505687VFLLGEEVAQYDGAYK 2 
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorGI:1942953VFSNGADLSGVTEEAPLK 2 Pept_E (Sonar search): 1.10E-02
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicGI:27479619VFYEEELDVPLVLFNEVLDHVLR 3 
A0423GOT2Aspartate aminotransferase, mitochondrial precursorGI:4504069VGAFTMVCK 2 Pept_E (Sonar search): 7.40E-03
A7119CYB5R1, NQO3A2, UNQ3049/PRO9865NADH-cytochrome b5 reductase 1GI:14735899VGDVVEFR 2 Pept_E (Sonar search): 1.00E-02
A3467ATP2A2, ATP2BSarcoplasmic/endoplasmic reticulum calcium ATPase 2GI:114312VGEATETALTCLVEK 2 Pept_E (Sonar search): 2.20E-04
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918VGESVFHTTR 2 Pept_E (Sonar search): 2.00E-05
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379VGEVIVTK 2 Pept_E (Sonar search): 1.60E-02
A1597APCS, PTX2Serum amyloid P-component precursorGI:337758VGEYSLYIGR 2 Pept_E (Sonar search): 1.20E-02
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379VGGTSDVEVNEK 2 Pept_E (Sonar search): 8.10E-04
A5178TUBA1A, TUBA3Tubulin alpha-1A chainGI:135397VGINYQPPTVVPGGDLAK 2 Pept_E (Sonar search): 1.30E-01
A3951SFXN1Sideroflexin 1GI:18561987VGIPVTDENGNR 2 Pept_E (Sonar search): 3.90E-02
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VGLIGSCTNSSYEDM*GR 2 Pept_E (Sonar search): 1.60E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VGLIGSCTNSSYEDM*GR 3 Pept_E (Sonar search): 4.30E-01
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VGLIGSCTNSSYEDMGR 2 Pept_E (Sonar search): 6.80E-03
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867VGLIGSCTNSSYEDMGR 3 Pept_E (Sonar search): 1.90E-02
A3684HADHB, MSTP029Trifunctional enzyme beta subunit, mitochondrial precursorGI:4504327VGLPPLEK 2 Pept_E (Sonar search): 1.40E-02
A3550HSPD1, HSP6060 kDa heat shock protein, mitochondrial precursorGI:129379VGLQVVAVK 2 Pept_E (Sonar search): 3.10E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VGMQIPR 2 Pept_E (Sonar search): 2.40E-01
A5742AFG3L2AFG3-like protein 2GI:5802970VGQISFDLPR 2 Pept_E (Sonar search): 3.00E-03
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080VGSVLQEGCGK 2 Pept_E (Sonar search): 1.80E-04
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657VGTLVGEDK 2 Pept_E (Sonar search): 4.20E-02
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657VGTLVGEDKYGNK 3 Pept_E (Sonar search): 1.60E-01
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492VGVNGFGR 2 Pept_E (Sonar search): 7.30E-04
A0007ACTN2Alpha-actinin 2GI:4501893VGWELLLTTIAR 2 Pept_E (Sonar search): 2.20E-04
A590AEIF5A2Eukaryotic translation initiation factor 5AIIGI:9966867VHLVGIDIFTGK 1 Pept_E (Sonar search): 1.80E-07
A590AEIF5A2Eukaryotic translation initiation factor 5AIIGI:9966867VHLVGIDIFTGK 2 
A1609CALR, CRTCCalreticulin precursorGI:4757900VHVIFNYK 1 Pept_E (Sonar search): 2.70E-04
A1609CALR, CRTCCalreticulin precursorGI:4757900VHVIFNYK 1 
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VIACDGGGGALGHPK 2 Pept_E (Sonar search): 5.80E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VIACDGGGGALGHPK 3 Pept_E (Sonar search): 4.20E-03
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688VIAVYDLGGGTFDISILEIQK 2 Pept_E (Sonar search): 2.40E-04
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:24234688VIAVYDLGGGTFDISILEIQK 2 
A962BETFB, FP585Electron transfer flavoprotein beta-subunitGI:4503609VIDYAVK 2 Pept_E (Sonar search): 4.30E-02
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536VIFPAPTPK 2 Pept_E (Sonar search): 1.20E-02
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:543064VIGMHYFSPVDK 2 
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325VIGMHYFSPVDK 2 Pept_E (Sonar search): 1.70E-04
A3683HADHA, HADHTrifunctional enzyme alpha subunit, mitochondrial precursorGI:4504325VIGMHYFSPVDK 3 Pept_E (Sonar search): 1.60E-02
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007VIGNQSLVNELAFTAR 2 Pept_E (Sonar search): 4.10E-04
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007VIGNQSLVNELAFTAR 3 Pept_E (Sonar search): 6.00E-02
A0369LDHBL-lactate dehydrogenase B chainGI:1200083VIGSGCNLDSAR 2 MS2 score: 33
A6887LDHC, LDH3, LDHXL-lactate dehydrogenase C chainGI:187074VIGSGCNLDSAR 2 MS2 score: 56
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053VIHDNFGIVEGLMTTVHAITATQK 2 Pept_E (Sonar search): 3.00E-05
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053VIHDNFGIVEGLMTTVHAITATQK 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:30584593VIHDNFGIVEGLMTTVHAITATQK 3 Pept_E (Sonar search): 2.70E-09
A318DECHDC3, PP1494, PP8332Enoyl coenzyme A hydratase domain containing 3GI:10880787VIIISAEGPVFSSGHDLK 2 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492VIISAPSADAPMFVMGVNHEK 3 Pept_E (Sonar search): 5.80E-01
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570VINEPTAAALAYGLDK 2 Pept_E (Sonar search): 8.00E-02
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570VINEPTAAALAYGLDK 3 Pept_E (Sonar search): 5.40E-04
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492VIPELNGK 2 Pept_E (Sonar search): 1.70E-01
A4372PPIF, CYP3Peptidyl-prolyl cis-trans isomerase FGI:5031987VIPSFMCQAGDFTNHNGTGGK 3 MS2 score: 34
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390VIQVAAGSSNLK 2 Pept_E (Sonar search): 2.50E-03
A3598ALDH2, ALDMAldehyde dehydrogenase, mitochondrial precursorGI:178390VIQVAAGSSNLKR 3 Pept_E (Sonar search): 6.00E-02
A3202MYH7, MYHCBMyosin-7GI:4557773VIQYFAVIAAIGDR 3 
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768VITVDGNICTGK 2 Pept_E (Sonar search): 6.00E-02
A208CNDUFB5NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5 mitochondrial precursorGI:4505363VKELEVR 2 Pept_E (Sonar search): 5.20E-01
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918VKQDMPPPGGYGPIDYK 3 Pept_E (Sonar search): 2.70E-02
A3195MYH4Myosin heavy chain, skeletal muscle, fetalGI:11024712VKVGNEFVTKGQTVQQVYNAVGALAKAIYEK 3 
A1742HBB, beta-globinHemoglobin beta chainGI:18418633VLAHHFGK 2 XCorr (Sequest): 2.80E-05
A1742HBB, beta-globinHemoglobin beta chainGI:18418633VLAHHFGK 2 
A5603TNNT2, HNTN1Troponin T, cardiac muscle isoformsGI:587432VLAIDHLNEDQLR 3 Pept_E (Sonar search): 1.20E-03
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VLDSGAPIK 2 Pept_E (Sonar search): 4.00E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VLDSGAPIKIPVGPETLGR 3 Pept_E (Sonar search): 9.60E-03
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826VLFLLGADGGCITR 2 Pept_E (Sonar search): 2.30E-06
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826VLFLLGADGGCITR 3 
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VLFLLGADGGCITR 2 Pept_E (Sonar search): 6.80E-03
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850VLGAFSDGLAHLDNLK 2 Pept_E (Sonar search): 5.90E-04
A1742HBB, beta-globinHemoglobin beta chainGI:229149VLGAFSDGLAHLDNLK 3 Pept_E (Sonar search): 1.80E-03
A1742HBB, beta-globinHemoglobin beta chainGI:1431650VLGAFSDGLAHLDNLK 3 Pept_E (Sonar search): 2.00E-03
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525VLGAHILGPGAGEMVNEAALALEYGASCEDIAR 3 Pept_E (Sonar search): 6.70E-06
A3674DLD, GCSL, LADDihydrolipoyl dehydrogenase, mitochondrial precursorGI:4557525VLGAHILGPGAGEMVNEAALALEYGASCEDIAR 3 
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768VLHQFR 2 Pept_E (Sonar search): 6.50E-01
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807VLIVSEDPELPYMRPPLSK 3 Pept_E (Sonar search): 1.90E-01
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialGI:4008131VLLPEYGGTK 2 Pept_E (Sonar search): 3.00E-01
A3793PHBProhibitinGI:4505773VLPSITTEILK 2 Pept_E (Sonar search): 1.10E-02
A0439PHB2, BAP, REAProhibitin 2GI:1673514VLPSIVNEVLK 1 
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialGI:4008131VLQATVVAVGSGSK 2 Pept_E (Sonar search): 6.80E-04
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialGI:4028622VLQATVVAVGSGSK 2 Pept_E (Sonar search): 9.10E-06
A4280EPFP1, HSPE110 kDa heat shock protein, mitochondrialGI:4028622VLQATVVAVGSGSK 2 
A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1GI:11276083VLQPTVFPVVPR 2 Pept_E (Sonar search): 1.20E-02
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810VLSIGDGIAR 2 Pept_E (Sonar search): 3.30E-02
A0439PHB2, BAP, REAProhibitin 2GI:6005854VLSRPNAQELPSMYQR 3 Pept_E (Sonar search): 3.00E-03
A4576ANXA5, ANX5, ENX2Annexin A5GI:999926VLTEIIASR 2 MS2 score: 46
A4576ANXA5, ANX5, ENX2Annexin A5GI:4502107VLTEIIASR 2 
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202VLVAQHDVYK 2 Pept_E (Sonar search): 7.20E-03
A0261PFKM, PFKX6-phosphofructokinase, muscle typeGI:14043654VLVVHDGFEGLAK 2 
A3776SLC25A3, PHCSolute carrier family 25 member 3GI:4505775VLYSNMLGEENTYLWR 2 Pept_E (Sonar search): 7.30E-01
A791BNDUFAB1Acyl carrier protein, mitochondrial precursorGI:7513178VLYVLK 1 
A3781PDCD8, AIFM1, AIFProgrammed cell death protein 8, mitochondrial precursorGI:4678807VM*PNAIVQSVGVSSGK 2 Pept_E (Sonar search): 1.20E-01
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:128826VMNILHR 2 
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:3252827VNDAMNMGHTAK 3 Pept_E (Sonar search): 6.50E-06
A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursorGI:86728VNINGGAVSLGHPIGMSGAR 3 Pept_E (Sonar search): 5.00E-02
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6166493VNLAELFK 2 Pept_E (Sonar search): 4.50E-02
A7503PRDX5, ACR1, SBBI10Peroxiredoxin-5, mitochondrialGI:6912238VNLAELFK 1 Pept_E (Sonar search): 1.70E-03
A5767ALDH7A1, ATQ1Aldehyde dehydrogenase family 7 member A1GI:797410VNLLSFTGSTQVGK 2 MS2 score: 40
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221VNNASLIGLGYTQTLRPGVK 3 Pept_E (Sonar search): 3.40E-03
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427VNNSSLIGLGYTQTLKPGIK 3 Pept_E (Sonar search): 3.60E-01
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:17436513VNNSSLIGLGYTQTLQPGIK 3 Pept_E (Sonar search): 4.20E-01
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201VNNSSLIGVGYTQTLRPGVK 3 Pept_E (Sonar search): 5.00E-04
A1923ALDOA, ALDAFructose-bisphosphate aldolase AGI:4557305VNPCIGGVILFHETLYQK 2 Pept_E (Sonar search): 1.00E-05
A6100COX4I1, COX4Cytochrome c oxidase subunit IV isoform 1, mitochondrial precursorGI:4502981VNPIQGLASK 2 Pept_E (Sonar search): 7.60E-04
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850VNVDEVGGEALGR 2 Pept_E (Sonar search): 1.10E-01
A1742HBB, beta-globinHemoglobin beta chainGI:229149VNVDEVGGEALGR 2 Pept_E (Sonar search): 1.20E-01
A1742HBB, beta-globinHemoglobin beta chainGI:1431650VNVDEVGGEALGR 2 Pept_E (Sonar search): 4.80E-03
A3696MDH2Malate dehydrogenase, mitochondrial precursorGI:5174541VNVPVIGGHAGK 2 Pept_E (Sonar search): 2.10E-02
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:223374VPADTEVVCAPPTAYIDFAR 3 Pept_E (Sonar search): 4.70E-03
A8144UQCRFS1Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial precursorGI:5174743VPDFSEYR 2 Pept_E (Sonar search): 4.10E-02
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511VPEANSSWMDTVIR 2 Pept_E (Sonar search): 4.00E-06
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550VPEWCLDDWHPSEK 3 Pept_E (Sonar search): 1.20E-02
A3957MTX2Metaxin 2GI:5729937VPFIHVGNQVVSELGPIVQFVK 3 Pept_E (Sonar search): 2.30E-06
A3957MTX2Metaxin 2GI:5729937VPFIHVGNQVVSELGPIVQFVK 3 
A679E Hypothetical protein XP_070049GI:17451530VPGKAQLGR 2 Pept_E (Sonar search): 2.40E-02
A7369PTGES2, PGES2Prostaglandin E synthase 2GI:13376617VPILVAQEGESSQQLNDSSVIISALK 3 Pept_E (Sonar search): 6.00E-02
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291VPLGSVIK 2 Pept_E (Sonar search): 1.60E-01
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511VPLPSLSPTM*QAGTIAR 3 Pept_E (Sonar search): 1.00E-01
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511VPLPSLSPTMQAGTIAR 3 Pept_E (Sonar search): 3.50E-02
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855VPPPLPQFGK 2 Pept_E (Sonar search): 6.30E-03
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345VPQVSTPTLVEVSR 2 Pept_E (Sonar search): 7.40E-03
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228VPSENVLGEVGSGFK 2 Pept_E (Sonar search): 4.40E-05
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053VPTANVSVVDLTCR 2 Pept_E (Sonar search): 4.30E-07
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:35053VPTANVSVVDLTCR 3 
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:7669492VPTANVSVVDLTCR 2 Pept_E (Sonar search): 2.20E-05
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseGI:30584593VPTANVSVVDLTCR 2 Pept_E (Sonar search): 4.30E-07
A3202MYH7, MYHCBMyosin-7GI:4557773VQLLHSQNTSLINQK 2 Pept_E (Sonar search): 3.20E-03
A3202MYH7, MYHCBMyosin-7GI:4557773VQLLHSQNTSLINQK 2 
A2010HSPA9, GRP75, HSPA9BStress-70 protein, mitochondrial precursorGI:4758570VQQTVQDLFGR 2 Pept_E (Sonar search): 1.40E-03
A4815FLNC, ABPL, FLN2Filamin CGI:4557597VRASGPGLERGK 2 
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007VSALNVLR 2 Pept_E (Sonar search): 1.70E-02
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:4759080VSDSISAQYPVVDHEFDAVVVGAGGAGLR 3 Pept_E (Sonar search): 7.50E-03
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:26996830VSDSISAQYPVVDHEFDAVVVGAGGAGLR 3 
A4369PPIA, CYPAPeptidyl-prolyl cis-trans isomerase AGI:118102VSFELFADK 2 MS2 score: 45
A3166MYH9Myosin heavy chain 9, non-muscleGI:12667788VSHLLGINVTDFTR 2 Pept_E (Sonar search): 1.20E-06
A4856HSPB1, HSP27, HSP28Heat shock protein beta-1GI:123571VSLDVNHFAPDELTVK 3 Pept_E (Sonar search): 1.20E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:5174429VSPETVDSVIMGNVLQSSSDAIYLAR 3 Pept_E (Sonar search): 9.00E-01
A7979ACAA2Acetyl-CoA acyltransferase 2GI:12804931VSPETVDSVIMGNVLQSSSDAIYLAR 2 
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040VSVNDFIIK 2 Pept_E (Sonar search): 6.30E-01
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292VSVVEPGNFIAATSLYSPESIQAIAK 3 Pept_E (Sonar search): 1.90E-03
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390VTFEADENENITVVK 2 Pept_E (Sonar search): 1.40E-02
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735VTFQFSYGTK 2 Pept_E (Sonar search): 1.90E-01
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070VTGADVPMPYAK 2 Pept_E (Sonar search): 3.70E-02
A0742TTNTitinGI:17066105VTGLTEGLEYEFR 2 
A594BSAMM50, SAM50, CGI-51Sorting and assembly machinery component 50 homologGI:15079735VTGQFPWSSLR 2 Pept_E (Sonar search): 2.60E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427VTGSLETK 2 Pept_E (Sonar search): 8.00E-02
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201VTGTLETK 2 Pept_E (Sonar search): 7.00E-02
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VTHTGQVYDDKDYR 3 Pept_E (Sonar search): 3.60E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VTHTGQVYDDKDYR 4 Pept_E (Sonar search): 1.60E-02
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1GI:4504239VTIAQGGVLPNIQAVLLPK 3 Pept_E (Sonar search): 7.90E-04
A7166NNTNAD(P) transhydrogenase, mitochondrial precursorGI:6912536VTIAQGYDALSSMANIAGYK 3 Pept_E (Sonar search): 9.50E-05
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312VTIFAEGCHGHLAK 2 Pept_E (Sonar search): 4.20E-06
A3779ETFDHElectron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrialGI:4758312VTIFAEGCHGHLAK 3 
A201CNDUFA11NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11GI:17455445VTLNPPGTFLEGVAK 2 Pept_E (Sonar search): 8.60E-03
A3691CKMT2Creatine kinase S-type, mitochondrialGI:4502855VTPNGYTLDQCIQTGVDNPGHPFIK 3 Pept_E (Sonar search): 9.70E-03
A5742AFG3L2AFG3-like protein 2GI:5802970VTQSAYAQIVQFGMNEK 3 Pept_E (Sonar search): 4.50E-04
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427VTQSNFAVGYK 2 Pept_E (Sonar search): 8.80E-04
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827VTSEELHYFVQNHFTSAR 3 Pept_E (Sonar search): 1.90E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827VTSEELHYFVQNHFTSAR 4 Pept_E (Sonar search): 8.10E-01
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482VTSEELHYFVQNHFTSAR 3 Pept_E (Sonar search): 1.40E-09
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:21903482VTSEELHYFVQNHFTSAR 3 
A4815FLNC, ABPL, FLN2Filamin CGI:4557597VTVLFAGQNIER 2 Pept_E (Sonar search): 3.90E-04
A4815FLNC, ABPL, FLN2Filamin CGI:4557597VTVLFAGQNIER 2 
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:14150080VTYESLTSGIVAIHSGFK 2 Pept_E (Sonar search): 2.80E-07
A6095COQ5Ubiquinone biosynthesis methyltransferase COQ5 mitochondrial precursorGI:27666102VTYESLTSGIVAIHSGFK 2 Pept_E (Sonar search): 2.20E-05
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VVAACAM*PVM*K 2 Pept_E (Sonar search): 9.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VVAACAMPVM*K 2 Pept_E (Sonar search): 7.00E-02
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursorGI:7770127VVAACAMPVMK 2 Pept_E (Sonar search): 1.40E-04
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788VVAEPVELAQEFR 2 Pept_E (Sonar search): 2.00E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788VVAEPVELAQEFR 3 Pept_E (Sonar search): 1.50E-03
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788VVAEPVELAQEFRK 2 Pept_E (Sonar search): 5.50E-01
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrialGI:4758788VVAEPVELAQEFRK 3 Pept_E (Sonar search): 2.80E-02
A1741HBA1, HBA2, HBZHemoglobin subunit alphaGI:493850VVAGVANALAHK 2 Pept_E (Sonar search): 7.20E-05
A1742HBB, beta-globinHemoglobin beta chainGI:1431650VVAGVANALAHK 2 Pept_E (Sonar search): 7.20E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810VVDALGNAIDGK 2 Pept_E (Sonar search): 6.30E-04
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001VVDALGNAIDGK 1 Pept_E (Sonar search): 3.50E-05
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:14125001VVDALGNAIDGK 1 
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorGI:4757810VVDALGNAIDGKGPIGSK 3 Pept_E (Sonar search): 4.10E-03
A9734PDHX, PDX1Pyruvate dehydrogenase protein X component, mitochondrial precursorGI:2316040VVDDELATR 2 Pept_E (Sonar search): 5.60E-03
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:66511VVDGAVGAQWLAEFR 2 Pept_E (Sonar search): 1.60E-02
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600VVDGAVGAQWLAEFR 2 Pept_E (Sonar search): 6.60E-06
A0605DLAT, DLTADihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrialGI:25058600VVDGAVGAQWLAEFR 2 
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:114549VVDLLAPYAK 2 Pept_E (Sonar search): 4.90E-02
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VVDLLAPYAK 1 Pept_E (Sonar search): 9.70E-05
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorGI:4502295VVDLLAPYAK 1 
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359VVDLLVIK 2 Pept_E (Sonar search): 9.40E-03
A198CNDUFA6, LYRM6, NADHB14NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6GI:4505359VVDLLVIK 1 Pept_E (Sonar search): 2.90E-03
A3202MYH7, MYHCBMyosin-7GI:12053672VVDSLQTSLDAETR 2 Pept_E (Sonar search): 6.40E-03
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768VVEDIEYLK 2 Pept_E (Sonar search): 3.00E-01
A0433TPI1, TPI, TIMTriosephosphate isomerase 1GI:223374VVLAYEPVWAIGTGK 2 Pept_E (Sonar search): 9.40E-03
A084ARAB11B, YPT3Ras-related protein Rab-11BGI:4758986VVLIGDSGVGK 2 Pept_E (Sonar search): 2.30E-03
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016VVLPIEAPIR 1 
A3778COX2, COII, MT-CO2Cytochrome c oxidase polypeptide IIGI:14016VVLPIEAPIR 2 Pept_E (Sonar search): 1.70E-04
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252VVNAPIFHVNSDDPEAVMYVCK 3 Pept_E (Sonar search): 2.30E-01
A3702BDH1, BDHD-beta-hydroxybutyrate dehydrogenase, mitochondrial precursorGI:17738292VVNISSMLGR 2 Pept_E (Sonar search): 6.00E-02
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202VVPEM*TEILK 2 Pept_E (Sonar search): 1.40E-01
A961BETFAElectron transfer flavoprotein alpha-subunit, mitochondrial precursorGI:2781202VVPEMTEILK 2 Pept_E (Sonar search): 4.90E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049VVQHSNVVINLIGR 3 Pept_E (Sonar search): 8.10E-04
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:13097156VVQHSNVVINLIGR 2 Pept_E (Sonar search): 4.80E-08
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:13097156VVQHSNVVINLIGR 3 
A3687PDHB, PHE1BPyruvate dehydrogenase E1 component beta subunit, mitochondrial precursorGI:129070VVSPWNSEDAK 2 Pept_E (Sonar search): 1.10E-02
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768VVSQYHELVVQAR 2 Pept_E (Sonar search): 5.50E-05
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768VVSQYHELVVQAR 3 Pept_E (Sonar search): 2.50E-05
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:27711720VVSQYHELVVQAR 2 Pept_E (Sonar search): 1.40E-08
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:27711720VVSQYHELVVQAR 2 
A6551GPIGlucose-6-phosphate isomeraseGI:189238VWYVSNIDGTHIAK 2 Pept_E (Sonar search): 3.10E-07
A6551GPIGlucose-6-phosphate isomeraseGI:189238VWYVSNIDGTHIAK 3 
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLGI:17461670VYATSQQIFGAVK 2 Pept_E (Sonar search): 1.20E-03
A807CAPOOL, FAM121A, UNQ8193/PRO23204Putative uncharacterized protein APOOLGI:17461670VYATSQQIFGAVK 2 
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734VYDQM*PEPR 2 Pept_E (Sonar search): 1.30E-02
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734VYDQMPEPR 2 Pept_E (Sonar search): 1.10E-01
A7156NFS1, NIFS, HUSSY-08Cysteine desulfurase, mitochondrial precursorGI:3646132VYFHTDAAQAVGK 2 Pept_E (Sonar search): 4.20E-04
A7156NFS1, NIFS, HUSSY-08Cysteine desulfurase, mitochondrial precursorGI:3646132VYFHTDAAQAVGK 2 
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VYINLDK 2 Pept_E (Sonar search): 7.00E-02
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VYINLDKETK 2 Pept_E (Sonar search): 7.70E-03
A219CNDUFS6NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursorGI:4758792VYINLDKETK 3 Pept_E (Sonar search): 6.50E-03
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322VYLFELHITDAQPAFTGSYR 2 Pept_E (Sonar search): 7.50E-05
A5001MYBPC3, MyBP-C, MYBP-CMyosin-binding protein C, cardiac-typeGI:2058322VYLFELHITDAQPAFTGSYR 2 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:14741856VYNIEFNPPK 2 Pept_E (Sonar search): 1.30E-01
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985VYQSLCPTSWVTDWDEQR 2 Pept_E (Sonar search): 9.30E-04
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:4502985VYQSLCPTSWVTDWDEQR 3 Pept_E (Sonar search): 1.30E-03
A926BCOX6B1, COX6BCytochrome c oxidase polypeptide VIbGI:30584127VYQSLCPTSWVTDWDEQR 2 Pept_E (Sonar search): 2.20E-10
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252VYYDLTR 2 Pept_E (Sonar search): 1.50E-01
A7195ND2, NADH2, MT-ND2NADH-ubiquinone oxidoreductase chain 2GI:229649WAIIEEFTK 2 Pept_E (Sonar search): 2.30E-03
A643CTF, PRO1400Serotransferrin precursorGI:4557871WCALSHHER 2 
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201WCEYGLTFTEK 2 Pept_E (Sonar search): 5.00E-02
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:12652825WCEYGLTFTEK 2 
A6411PECI, HCA64, ECI2Peroxisomal 3,2-trans-enoyl-CoA isomeraseGI:12803665WDAWNALGSLPK 2 Pept_E (Sonar search): 1.60E-02
A977BFABP3, FABP11, MDGIFatty acid binding protein 3, muscle and heartGI:458862WDGQETTLVR 2 Pept_E (Sonar search): 2.10E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827WEVADLQPQLK 2 Pept_E (Sonar search): 2.10E-03
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827WEVADLQPQLK 3 Pept_E (Sonar search): 4.70E-01
A0029ANXA6, ANX6Annexin A6GI:4502109WGTDEAQFIYILGNR 2 
A6319SDHA, SDH2, SDHFSuccinate dehydrogenase [ubiquinone flavoprotein subunit], mitochondrial precursorGI:30147527WHFYDTVK 2 
A8755DOCK8Dedicator of cytokinesis protein 8GI:27478724WIADLPSTQLNR 2 
A6824AK3, AK3L1, AK6GTP:AMP phosphotransferase mitochondrialGI:9963777WIHPASGR 1 
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657WLHSMTDDPPTTKPLTAR 4 Pept_E (Sonar search): 3.40E-04
A209CNDUFB6NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6GI:4505365WLKDQELSPR 2 Pept_E (Sonar search): 5.00E-03
A209CNDUFB6NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6GI:4505365WLKDQELSPR 3 Pept_E (Sonar search): 3.50E-02
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049WLSAEIEDVKPAK 2 Pept_E (Sonar search): 9.10E-03
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursorGI:189049WLSAEIEDVKPAK 3 Pept_E (Sonar search): 5.00E-04
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201WNTDNTLGTEIAIEDQICQGLK 3 Pept_E (Sonar search): 3.10E-02
A3479VDAC3Voltage-dependent anion-selective channel protein 3GI:5032221WNTDNTLGTEISWENK 2 Pept_E (Sonar search): 7.00E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427WNTDNTLGTEITVEDQLAR 2 Pept_E (Sonar search): 6.40E-04
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427WNTDNTLGTEITVEDQLAR 3 Pept_E (Sonar search): 2.30E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203WPLYMSTK 2 Pept_E (Sonar search): 3.50E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575WPLYMSTK 2 Pept_E (Sonar search): 1.30E-01
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427WTEYGLTFTEK 2 Pept_E (Sonar search): 5.40E-03
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:4507879WTEYGLTFTEK 2 
A203CNDUFA13, GRIM19, CGI-39NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13GI:12005918WVPPLIGELYGLR 2 Pept_E (Sonar search): 5.00E-02
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:4758038WVTYFNKPDIDAWELR 3 Pept_E (Sonar search): 4.20E-02
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392WVTYFNKPDIDAWELR 3 Pept_E (Sonar search): 1.60E-06
A6101COX5ACytochrome c oxidase polypeptide Va, mitochondrial precursorGI:18999392WVTYFNKPDIDAWELR 2 
A0429ACO2Aconitate hydratase, mitochondrial precursorGI:4501867WVVIGDENYGEGSSR 2 Pept_E (Sonar search): 5.20E-04
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657WVVYTTEM*NGK 2 Pept_E (Sonar search): 8.00E-02
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657WVVYTTEMNGK 2 Pept_E (Sonar search): 7.50E-03
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804WYYNAAGFNK 2 Pept_E (Sonar search): 1.60E-01
A5964CA2Carbonic anhydrase 2GI:4557395YAAELHLVHWNTK 3 
A3664OGDH2-oxoglutarate dehydrogenase E1 component, mitochondrial precursorGI:13627252YAELLVSQGVVNQPEYEEEISKYDK 3 Pept_E (Sonar search): 2.70E-01
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2GI:4505355YAFGQETNVPLNNFSADQVTR 2 Pept_E (Sonar search): 7.80E-06
A194CNDUFA2NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2GI:4505355YAFGQETNVPLNNFSADQVTR 3 Pept_E (Sonar search): 1.70E-06
A0394ATP5O, ATPOATP synthase subunit O, mitochondrial precursorGI:4502303YATALYSAASK 2 Pept_E (Sonar search): 1.10E-04
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007YCAQDAFFQVK 2 Pept_E (Sonar search): 1.90E-01
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371YDIDM*TK 2 Pept_E (Sonar search): 1.00E+00
A7139NDUFS8NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial precursorGI:4505371YDIDMTK 2 Pept_E (Sonar search): 1.30E-01
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827YEDFSNLGTTHLLR 2 Pept_E (Sonar search): 1.40E-02
A3677UQCRC2Cytochrome B-C1 complex subunit 2, mitochondrialGI:14775827YEDFSNLGTTHLLR 3 Pept_E (Sonar search): 9.20E-05
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804YEEENFYLEPYLK 2 Pept_E (Sonar search): 1.00E+00
A305CUQCRB, UQBPCytochrome B-C1 complex subunit 7GI:190804YEEENFYLEPYLK 3 Pept_E (Sonar search): 2.40E-01
A370ATUFMElongation factor Tu, mitochondrial precursorGI:1706611YEEIDNAPEER 2 Pept_E (Sonar search): 1.30E-02
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390YESHPVCADLQAK 3 Pept_E (Sonar search): 1.70E-01
A212CNDUFB9, LYRM3, UQOR22NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9GI:6274550YFACLMR 2 Pept_E (Sonar search): 2.60E-02
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:113455YFAGNLASGGAAGATSLCFVYPLDFAR 2 Pept_E (Sonar search): 1.00E-06
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:4502097YFAGNLASGGAAGATSLCFVYPLDFAR 2 Pept_E (Sonar search): 1.30E-05
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558YFAGNLASGGAAGATSLCFVYPLDFAR 3 Pept_E (Sonar search): 1.50E-03
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755YFAGNLASGGAAGATSLCFVYPLDFAR 3 Pept_E (Sonar search): 2.10E-04
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2GI:27764863YFAGNLASGGAAGATSLCFVYPLDFAR 2 Pept_E (Sonar search): 4.40E-03
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203YFDLGLPNR 2 Pept_E (Sonar search): 1.70E-01
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:4504575YFDLGLPNR 2 Pept_E (Sonar search): 7.00E-02
A3660IDH2, IDH, IDPIsocitrate dehydrogenase [NADP], mitochondrial precursorGI:1277203YFDLGLPNRDQTDDQVTIDSALATQK 3 Pept_E (Sonar search): 1.50E-02
A1292UBE2N, BLUUbiquitin-conjugating enzyme E2 NGI:4507793YFHVVIAGPQDSPFEGGTFK 2 Pept_E (Sonar search): 4.90E-05
A1292UBE2N, BLUUbiquitin-conjugating enzyme E2 NGI:4507793YFHVVIAGPQDSPFEGGTFK 2 
A743BUSMG5, HCVFTP2, PD04912Up-regulated during skeletal muscle growth protein 5GI:14249376YFNSYTLTGR 2 Pept_E (Sonar search): 2.50E-04
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1GI:13647558YFPTQALNFAFK 2 Pept_E (Sonar search): 5.00E-04
A0396SLC25A5, ANT2ADP/ATP translocase 2GI:86755YFPTQALNFAFK 2 Pept_E (Sonar search): 6.00E-02
A3742SLC25A6, ANT3ADP,ATP carrier protein, liver isoform T2GI:113463YFPTQALNFAFK 2 Pept_E (Sonar search): 4.10E-03
A371ETAGLN2, CDABP0035Transgelin 2GI:4507357YGINTTDIFQTVDLWEGK 2 
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618YGLIPEEFFQFLYPK 2 Pept_E (Sonar search): 1.60E-03
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011YGM*GTSVER 2 Pept_E (Sonar search): 2.40E-03
A3685PDHA1, PHE1A, PDHA1/LOC79064Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursorGI:387011YGMGTSVER 2 Pept_E (Sonar search): 1.60E-02
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618YGPFVADFADK 2 Pept_E (Sonar search): 3.20E-04
A0383ATP5F1ATP synthase B chain, mitochondrial precursorGI:13543618YGPFVADFADKLNEQK 3 Pept_E (Sonar search): 7.50E-04
A9867Em:AF200455.10, DEFA1, Em:AF200455.12Neutrophil defensin 1 precursorGI:228797YGTCIYQGR 2 Pept_E (Sonar search): 1.40E-02
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1GI:4758012YHEQLSTQSLIELFESFK 2 
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorGI:10835025YHIQVCTTTPCMLR 3 Pept_E (Sonar search): 3.80E-04
A209CNDUFB6NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6GI:4505365YHVSEKPYGIVEK 3 Pept_E (Sonar search): 4.70E-03
A1581ALB, GIG20, GIG42Serum albumin precursorGI:28590YICENQDSISSK 2 Pept_E (Sonar search): 3.10E-02
A1581ALB, GIG20, GIG42Serum albumin precursorGI:178345YICENQDSISSK 2 Pept_E (Sonar search): 1.20E-02
A0181MAPK1, ERK2, PRKM1Mitogen-activated protein kinase 1GI:20986529YIHSANVLHR 2 
A6206CPT2, CPT1Carnitine O-palmitoyltransferase II, mitochondrial precursorGI:4503023YILSDSSPAPEFPLAYLTSENR 3 Pept_E (Sonar search): 1.70E-03
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinGI:18959202YIPDAMNLILLLVTEK 2 Pept_E (Sonar search): 6.30E-05
A3999LRPPRC, LRP130Leucine-rich PPR-motif containing proteinGI:18959202YIPDAMNLILLLVTEK 2 
A0704ARHGDIA, GDIA1Rho GDP-dissociation inhibitor 1GI:36038YIQHTYR 2 
A5496TMEM11, PM1Transmembrane protein 11GI:18088748YIVIEPTR 2 MS2 score: 40
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:2117356YIYDQCPAVAGYGPIEQLPDYNR 3 Pept_E (Sonar search): 4.70E-05
A3676UQCRC1Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial precursorGI:4507841YIYDQCPAVAGYGPIEQLPDYNR 2 Pept_E (Sonar search): 4.00E-04
A159CMBMyoglobinGI:17389985YLEFISECIIQVLQSK 2 Pept_E (Sonar search): 9.70E-08
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007YLGLYNDPNSNPK 2 Pept_E (Sonar search): 4.80E-03
A6320SDHB, SDH, SDH1Succinate dehydrogenase [ubiquinone] iron-sulfur protein, mitochondrial precursorGI:88650YLGPAVLMQAYR 2 Pept_E (Sonar search): 1.20E-02
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816YLVVNADEGEPGTCK 2 Pept_E (Sonar search): 9.70E-03
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816YLVVNADEGEPGTCK 3 Pept_E (Sonar search): 6.50E-03
A7140NDUFV1, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1 mitochondrialGI:6005816YLVVNADEGEPGTCKDR 3 Pept_E (Sonar search): 2.20E-02
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007YM*TPEDFVQR 2 Pept_E (Sonar search): 1.10E-01
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1GI:4507007YMTPEDFVQR 2 Pept_E (Sonar search): 6.00E-02
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleGI:4501883YPIEHGIITNWDDMEK 3 Pept_E (Sonar search): 2.60E-01
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774YQDLGAYSSAR 2 Pept_E (Sonar search): 8.80E-04
A6406ECH1Delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursorGI:11433007YQETFNVIER 2 Pept_E (Sonar search): 1.50E-02
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1GI:238427YQIDPDACFSAK 2 Pept_E (Sonar search): 2.10E-03
A0426VDAC2Voltage-dependent anion-selective channel protein 2GI:190201YQLDPTASISAK 2 Pept_E (Sonar search): 1.70E-04
A5541CRYAB, CRYA2Alpha crystallin B chainGI:4503057YRIPADVDPLTITSSLSSDGVLTVNGPR 3 
A205CNDUFB2NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 mitochondrial precursorGI:4758778YRQFPQLTR 3 Pept_E (Sonar search): 1.90E-02
A5959CA1Carbonic anhydrase 1GI:4502517YSAELHVAHWNSAK 3 
A5959CA1Carbonic anhydrase 1GI:4502517YSAELHVAHWNSAK 2 Pept_E (Sonar search): 5.00E-10
A3558CHCHD3, MINOS3Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial precursorGI:8923390YSGAYGASVSDEELK 2 Pept_E (Sonar search): 1.10E-03
A867CMPC2, BRP44Mitochondrial pyruvate carrier 2GI:7661602YSLVIIPK 2 Pept_E (Sonar search): 3.70E-02
A3560NDUFA10NADH-ubiquinone oxidoreductase 42 kDa subunit, mitochondrial precursorGI:4758768YSPGYNTEVGDK 2 Pept_E (Sonar search): 1.10E-05
A3681GLUD2, GLUDP1Glutamate dehydrogenase 2, mitochondrial precursorGI:6912392YSTDVSVDEVK 2 Pept_E (Sonar search): 7.00E-02
A3973IMMT, HMP, PIG4Mitochondrial inner membrane proteinGI:516768YSTSGSSGLTTGK 2 Pept_E (Sonar search): 5.30E-03
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559YTAQVDAEEKEDVK 2 Pept_E (Sonar search): 1.30E-01
A0387ATP5H, My032ATP synthase D chain, mitochondrialGI:5453559YTAQVDAEEKEDVK 3 Pept_E (Sonar search): 3.80E-01
A4101COQ9, HSPC326Ubiquinone biosynthesis protein COQ9, mitochondrialGI:3252827YTDQGGEEEEDYESEEQLQHR 3 Pept_E (Sonar search): 2.30E-02
A197CNDUFA5NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5GI:4826848YTEQITNEK 2 Pept_E (Sonar search): 6.60E-04
A4502PKD1L3Polycystic kidney disease 1-like 3GI:30158844YTLIIYDDLSK 2 
A7452PNPT1, PNPASE, OLD35Polyribonucleotide nucleotidyltransferase 1, mitochondrial precursorGI:24943088YTQQIIQGIQQLVK 3 
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291YVDLGGSYVGPTQNR 2 Pept_E (Sonar search): 4.60E-02
A3673MAOBAmine oxidase [flavin-containing] BGI:18490291YVDLGGSYVGPTQNR 3 Pept_E (Sonar search): 3.10E-02
A9669MRPS22, RPMS22, GK002Mitochondrial 28S ribosomal protein S22GI:22761523YVFTDISYSIPHR 2 Pept_E (Sonar search): 5.40E-06
A9669MRPS22, RPMS22, GK002Mitochondrial 28S ribosomal protein S22GI:22761523YVFTDISYSIPHR 3 
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorGI:20070760YVGGQEHFAHLLILR 2 Pept_E (Sonar search): 4.30E-07
A5625ORM1, AGP1, ORM2Alpha-1-acid glycoprotein 1 precursorGI:20070760YVGGQEHFAHLLILR 2 
A9987MACROD1, LRP16O-acetyl-ADP-ribose deacetylase MACROD1GI:12653017YVIHTVGPIAYGEPSASQAAELR 3 Pept_E (Sonar search): 2.00E-05
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GI:10835002YVQHTYR 2 Pept_E (Sonar search): 9.90E-03
A0703ARHGDIB, GDIA2, GDID4Rho GDP-dissociation inhibitor 2GI:10835002YVQHTYR 2 
A7138NDUFS7, My017NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrialGI:3342734YVVSMGSCANGGGYYHYSYSVVR 3 Pept_E (Sonar search): 8.00E-02
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1GI:18543899YVWLVYEQDRPLK 2 Pept_E (Sonar search): 1.20E-05
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1GI:18543899YVWLVYEQDRPLK 3 
A3688CSCitrate synthase, mitochondrial precursorGI:14603295YWELIYEDSMDLIAK 2 
A202CNDUFA12, DAP13NADH-ubiquinone oxidoreductase subunit B17.2GI:10092657YYEDNKQFFGR 3 Pept_E (Sonar search): 1.10E-02
A6534FHFumarate hydratase, mitochondrial precursorGI:14740547YYGAQTVR 2 Pept_E (Sonar search): 1.80E-02
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2GI:4503475YYITIIDAPGHR 2 Pept_E (Sonar search): 1.50E-06
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2GI:4503475YYITIIDAPGHR 3 
A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursorGI:3273228YYTLNGSKLWISNGGLADIFTVFAK 3 
A366AEEF1A1P5, EEF1AL3Putative elongation factor 1-alpha-like 3GI:30149784YYVTIIDAPGHR 2 Pept_E (Sonar search): 1.00E-06
A213CNDUFB10NADH-ubiquinone oxidoreductase PDSW subunitGI:4758774YYYYHR 2 Pept_E (Sonar search): 3.00E-01

Compile date 12-23-2014© PADB initiative