PADB-logoLSSR - PepMap molecular information by study

Study ID 15024025
Species rat
Disease healthy
Tissue / Source brain
Compartment Kir2.2 associated molecules

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A0015DLG1, SAP97Disks large homolog 1 AASHEQAAAALKNAGQAVTIVAQYRPEEYSR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 ALFDYDK    
A0015DLG1, SAP97Disks large homolog 1 ALFDYDK    
A0015DLG1, SAP97Disks large homolog 1 ALHLLEEYR    
A0015DLG1, SAP97Disks large homolog 1 ALHLLEEYR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 ANDDLLSEFPDK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK AQFEYDPAKDDLIPCKEAGIR    
A3577DTNA, DRP3Dystrobrevin alpha AQQNPTLLAELR    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A ARATAKATVAAFAASEGHSHPR    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A ATVAAFAASEGHSHPR    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C ATVAAFAASEGHSHPR    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C ATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISR    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C ATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRI    
A0014DLG2Disks large homolog 2 AVEALKEAGSIVR    
A0015DLG1, SAP97Disks large homolog 1 AVEALKEAGSIVR    
A0015DLG1, SAP97Disks large homolog 1 AVLGDDEITR    
A5134SNTB2, D16S2531E, SNT2B2Beta-2-syntrophin DAWASPCHSYPLVATR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK DDHNWWQGKLENSKNGTAGLIPSPELQEWR    
A0016DLG3Discs, large homolog 3 DFPGLSDDYYGAK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK DLDFLHSVFQDQHLHTLLDLYDK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK DLDFLHSVFQDQHLHTLLDLYDKINTK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 DLLGEEDIPR    
A0014DLG2Disks large homolog 2 DNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSLLETHDSVASK    
A0015DLG1, SAP97Disks large homolog 1 DSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKR    
A0014DLG2Disks large homolog 2 DSGLPSQGLSFKYGDILHVINASDDEWWQAR    
A0016DLG3Discs, large homolog 3 DVGPVPPKPVPGK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK DVKPHCVLLASK    
A0015DLG1, SAP97Disks large homolog 1 DYHFVTSR    
A0015DLG1, SAP97Disks large homolog 1 DYHFVTSR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 EDSVLSYETVTQMEVHYARPIIILGPTK    
A0014DLG2Disks large homolog 2 EGQGYSFVSR    
A3577DTNA, DRP3Dystrobrevin alpha EVLKLPTAVFEGPSFGYTEQSAR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 EVTHSAAVEALKEAGSIVR    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C EVYEHVYETVDISSSPEVR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK FAYPIPHTTRPPK    
A0015DLG1, SAP97Disks large homolog 1 FGDILHVINASDDEWWQAR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 FGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKR    
A0016DLG3Discs, large homolog 3 FIEAGQFNDNLYGTSIQSVR    
A0015DLG1, SAP97Disks large homolog 1 FIEAGQYNNHLYGTSVQSVR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 FIEAGQYNSHLYGTSVQSVR    
A0014DLG2Disks large homolog 2 GAGQTVTIIAQYQPEDYAR    
A0014DLG2Disks large homolog 2 GDQILSVNGIDLR    
A0015DLG1, SAP97Disks large homolog 1 GGQEEYVLSYEPVNQQEVNYTRPVIILGPMK    
A0015DLG1, SAP97Disks large homolog 1 GKHCILDVSGNAIKRLQIAQLYPISIFIKPK    
A5133SNTB1, SNT2B1Beta-1-syntrophin GLAADQTQALYVGDAILSVNGADLR    
A0016DLG3Discs, large homolog 3 GLGFSIAGGIGNQHIPGDNSIYITK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 GLGFSIAGGVGNQHIPGDNSIYVTK    
A0014DLG2Disks large homolog 2 GLGFSIAGGVGNQHIPGDNSIYVTK    
A0015DLG1, SAP97Disks large homolog 1 GLGFSIAGGVGNQHIPGDNSIYVTK    
A0015DLG1, SAP97Disks large homolog 1 GLGFSIAGGVGNQHIPGDNSIYVTK    
A0015DLG1, SAP97Disks large homolog 1 GLGFSIAGGVGNQHIPGDNSIYVTK    
A0016DLG3Discs, large homolog 3 GNSGLGFSIAGGIDNPHVPDDPGIFITK    
A0014DLG2Disks large homolog 2 GNSGLGFSIAGGTDNPHIGDDPGIFITK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 GNSGLGFSIAGGTDNPHIGDDPSIFITK    
A0015DLG1, SAP97Disks large homolog 1 GNSGLGFSIAGGTDNPHIGDDSSIFITK    
A0015DLG1, SAP97Disks large homolog 1 GNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGR    
A0016DLG3Discs, large homolog 3 GQEDAILSYEPVTR    
A0015DLG1, SAP97Disks large homolog 1 GQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPK    
A0015DLG1, SAP97Disks large homolog 1 GQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPK    
A0015DLG1, SAP97Disks large homolog 1 GSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 GSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTI    
A0014DLG2Disks large homolog 2 GYGHYFDLSLVNSNLER    
A0015DLG1, SAP97Disks large homolog 1 HCILDVSGNAIK    
A0420ABLIM1, ABLIM, LIMAB1Actin-binding LIM protein 1 HFHVPDQGINIYR    
A0264SNTA1, SNT1Alpha-1-syntrophin HGVDTHLFSVESPQELAAWTR    
A5133SNTB1, SNT2B1Beta-1-syntrophin HLGWLAEKVPGESEK    
A0014DLG2Disks large homolog 2 HMLVEDDYTRPPEPVYSTVNK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 IAQYKPEEYSR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK IHEQGLIAILDVEPQALK    
A0015DLG1, SAP97Disks large homolog 1 IISVNSVDLR    
A0015DLG1, SAP97Disks large homolog 1 IISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSR    
A0016DLG3Discs, large homolog 3 ILAGGPADLSGELR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 ILAVNSVGLEDVMHEDAVAALK    
A0014DLG2Disks large homolog 2 ILPSYQEPHLPR    
A0014DLG2Disks large homolog 2 INDDLISEFPDK    
A0015DLG1, SAP97Disks large homolog 1 ISIFQSNLFQALIDIQEFYEVTLLDNPK    
A0015DLG1, SAP97Disks large homolog 1 ISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIK    
A0015DLG1, SAP97Disks large homolog 1 ISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK ITVYEALNHPWLK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK ITVYEALNHPWLK    
A0139APBA1, MINT1, X11Amyloid beta A4 precursor protein-binding family A member 1 IVHILSNAVGEIHMK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK KIHEQGLIAILDVEPQALK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK KIHEQGLIAILDVEPQALK    
A5134SNTB2, D16S2531E, SNT2B2Beta-2-syntrophin KPSLVSDLPWEGASPQSPSFSGSEDSGSPK    
A0014DLG2Disks large homolog 2 KTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIK    
A0014DLG2Disks large homolog 2 KTLVLIGAQGVGR    
A0793MPP6, VAM1MAGUK p55 subfamily member 6 KTLVLIGAQGVGR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK KTLVLLGAHGVGR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK LDFLHSVFQDQHLHTLLDLYDKINTK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK LEEAVELVCTAPQWVPVSWVY    
A0015DLG1, SAP97Disks large homolog 1 LEQEFTEHFTAIVQGDTLEDIYNQVK    
A0015DLG1, SAP97Disks large homolog 1 LEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK    
A0015DLG1, SAP97Disks large homolog 1 LEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK    
A0016DLG3Discs, large homolog 3 LLAVNNTNLQDVR    
A0015DLG1, SAP97Disks large homolog 1 LLAVNSVCLEEVTHEEAVTALK    
A0015DLG1, SAP97Disks large homolog 1 LLAVNSVCLEEVTHEEAVTALK    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A LQESGEVPVHK    
A0015DLG1, SAP97Disks large homolog 1 LQIAQLYPISIFIKPK    
A0016DLG3Discs, large homolog 3 LQQAQLYPIAIFIKPK    
A0014DLG2Disks large homolog 2 LQVAQLYPIAJFIKPK    
A0014DLG2Disks large homolog 2 LRTEPQWVPVSWVY    
A0016DLG3Discs, large homolog 3 LVVLIGSLGAHLHELK    
A0015DLG1, SAP97Disks large homolog 1 MEKDIQEHKFIEAGQYNNHLYGTSVQSVR    
A0015DLG1, SAP97Disks large homolog 1 MEKDIQEHKFIEAGQYNNHLYGTSVQSVR    
A0139APBA1, MINT1, X11Amyloid beta A4 precursor protein-binding family A member 1 MICHVFESEDAQLIAQSIGQAFSVAYQEFLR    
A0014DLG2Disks large homolog 2 NAEFDRHELLIYEEVAR    
A0015DLG1, SAP97Disks large homolog 1 NAGQAVTIVAQYRPEEYSR    
A0016DLG3Discs, large homolog 3 NFDPVLPPLPDNIDEDFEEESVK    
A0014DLG2Disks large homolog 2 NLSQIENVHGYVLQSHISPLK    
A0016DLG3Discs, large homolog 3 PVIILGPMK    
A0014DLG2Disks large homolog 2 QEINYTRPVIILGPMK    
A0016DLG3Discs, large homolog 3 QSPTPVLHSAMALAEOVMEELQAASVHSDERELLQLLSTPHLR    
A0016DLG3Discs, large homolog 3 QVLEVVSQDDPTWWQAK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK RADAGFVYSEAVASHYMR    
A0016DLG3Discs, large homolog 3 RDEHSGAVVVAR    
A0016DLG3Discs, large homolog 3 RDNEVDGQDYHFVVSR    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A RGDQLLSVNGVSVEGEHHEK    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A RGDQLLSVNGVSVEGEHHEK    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C RGDQLLSVNGVSVEGEHHEK    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C RGDQLLSVNGVSVEGEHHEK    
A3900LIN7C, MALS3, VELI3Protein LIN-7 homolog C RGDQLLSVNGVSVEGEHHEK    
A0015DLG1, SAP97Disks large homolog 1 RLQIAQLYPISIFIKPK    
A0016DLG3Discs, large homolog 3 RPDEISQILAQSQGSITLK    
A0014DLG2Disks large homolog 2 RPILETVVEIK    
A0462DMD, DAG1Dystrophin RPQLEELITAAQNLK    
A0016DLG3Discs, large homolog 3 RQPPPETIMEVNLLK    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 RVIEDLSGPYIVVVPAR    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95 SLENVLEINK    
A0462DMD, DAG1Dystrophin SPAQILISLESEER    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A TDEGLGFNVMGGK    
A0462DMD, DAG1Dystrophin TLEEVWACWHELLSYLEK    
A0016DLG3Discs, large homolog 3 TPEFKPYVIFVK    
A0015DLG1, SAP97Disks large homolog 1 TRGDKGEIPDDMGSK    
A0420ABLIM1, ABLIM, LIMAB1Actin-binding LIM protein 1 TSSESIYSRPGSSIPGSPGHTIYAK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK TYAHYFDLTIINNEIDETIR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK TYAHYFDLTINNEIDETIRHLEEAVELVCTAPQWVPVSWVY    
A0015DLG1, SAP97Disks large homolog 1 VDNHVSPSSYLGQTPASPAR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK VGDIIQIISK    
A0125CASK, LIN2Peripheral plasma membrane protein CASK VGTPHFMAPEVVK    
A0014DLG2Disks large homolog 2 VILDGDSEEMGVIPSK    
A0015DLG1, SAP97Disks large homolog 1 VISIFQSNLFQALIDIQEFYEVTLLDNPK    
A0141LIN7A, MALS1, VELI1Protein LIN-7 homolog A VLEEMEAR    
A0016DLG3Discs, large homolog 3 VNEVDVSEVVHSR    
A0015DLG1, SAP97Disks large homolog 1 VNODLISEFPDK    
A0016DLG3Discs, large homolog 3 VPTGAESQVLLTYEEVAR    
A0125CASK, LIN2Peripheral plasma membrane protein CASK VVFIAAPTITPGLNEDESLQR    
A0016DLG3Discs, large homolog 3 YGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKK    
A0014DLG2Disks large homolog 2 YLEHGEYEGNLYGTR    
A0015DLG1, SAP97Disks large homolog 1 YQDEEVLPSERISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIK    

Compile date 12-23-2014© PADB initiative