PADB-logoLSSR - PepMap molecular information by study

Study ID 15020595
Species rat
Disease healthy
Tissue / Source brain
Compartment PSD (forebrain)

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A9552RPL2460S ribosomal protein L24RL24_HUMAN-.M#KVELCSFSGYK.I    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain -.M#REIVHIQAGQCGNQIGAK.F    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSE-.M#REIVHIQAGQCGNQIGAK.F    
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALFA_RAT-.PHPYPALTPEQK.K    
A3776SLC25A3, PHCSolute carrier family 25 member 3 A.AVEEYSCEFGSM#K.Y    
A3776SLC25A3, PHCSolute carrier family 25 member 3 A.AVEEYSCEFGSMK.Y    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANA.FSLFDKDGDGTITTK.E    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANA.PEEHPVLLTEAPLNPK.A    
A4552ACTG1, ACTGActin, cytoplasmic 2 A.PEEHPVLLTEAPLNPK.A    
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseCN37_RATC.AADVQPVQTGLDLLEILQQVK.G    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMAND.GNGTIDFPEFLTM#M#AR.K    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATD.PGLTSFEPEALGNLVEGM#DFHK.F    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATD.PGLTSFEPEALGNLVEGM#DFHR.F    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATD.PGM#TAFEPEALGNLVEGLDFHR.F    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATD.PGMTAFEPEALGNLVEGLDFHR.F    
A0757CNTN1Contactin-1 precursor D.PPYHFPDDLSYR.W    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATF.HGGSFTLPLDTVK.D    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEF.HSFGGGTGSGFTSLLM#ER.L    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANF.HSFGGGTGSGFTSLLM#ER.L    
A0285BSN, ZNF231Bassoon protein F.IAVAGTEGPGQAR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain F.LLNEDLGDSLDSVEALLK.K    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATF.LSPSGDHEANGPGETSLNPPGFVTATAEK.E    
A0568PCLO, ACZProtein piccolo F.SGM#APSVVESVGTKPERPQADTISTDLPISEK.D    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATF.SIAGGTDNPHIGDDPSIFITK.I    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATF.SIAGGVGNQHIPGDNSIYVTK.I    
A0014DLG2Disks large homolog 2SP93_RATF.SIAGGVGNQHIPGDNSIYVTK.I    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANF.SLFDKDGDGTITTK.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain F.VANVEEEEAWINEK.M    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor G.WGYYGCNEELVGPLYAR.S    
A5190TUBB2BTubulin beta-2B chainTBB1_RATH.SLGGGTGSGM#GTLLISK.I    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain H.SLGGGTGSGM#GTLLISK.I    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain H.SLGGGTGSGM#GTLLISK.I    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEH.SLGGGTGSGM#GTLLISK.I    
A3479VDAC3Voltage-dependent anion-selective channel protein 3 H.THVNDGTEFGGSIYQR.V    
A3519SEPT6, SEP2Septin 6 K.AAAELLQSQGSQAGGSQTLK.R    
A487BITM2C, BRI3, hucep-14Integral membrane protein 2C K.AAASGPASASAPAAEILLTPAR.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.AAEIDCQDIEER.L    
A3525SEPT8, SEPT8Septin-8 K.AAMEALQSQALHATSQQPLR.K    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATK.AAVSHWQQQSYLDSGIHSGATTTAPSLSGK.G    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.ADLNKPLYIDTK.M    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.ADQGLDVAAK.K    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.ADVVESWIGEK.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.ADVVESWIGEK.E    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATK.AEAVPEEEASSSVATLER.G    
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATK.AEDKEWIPVTK.L    
A0276CIT, CRIK, STK21Citron protein K.AEILALQQALK.E    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.AELFTQSCADLDK.W    
A0117NSFVesicle-fusing ATPase K.AENSSLNLIGK.A    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.AEQFLSGVDAWCK.M    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.AESEELEIQKPQVK.L    
A3869PPFIA3Liprin-alpha 3 K.AETLPEIEAQLAQR.V    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.AEVQMEFIQLPK.E    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.AFHNELLTQLEQK.V    
A8662ANKS1B, EB-1Cajalin 2 K.AFLINGYTSM#DLLK.K    
A8662ANKS1B, EB-1Cajalin 2 K.AFLINGYTSM#DLLK.K    
A5282CALML5, CLSPCalmodulin-like protein 5CLSP_HUMANK.AFSAVDTDGNGTINAQELGAALK.A    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.AGAGGPLYGDGYGFR.L    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.AGAYDFPSPEWDTVTPEAK.D    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.AGAYDFPSPEWDTVTPEAK.D    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATK.AGAYDFPSPEWDTVTPEAK.D    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATK.AGAYDFPSPEWDTVTPEAK.D    
A3990CASKIN1Cask-interacting protein 1 K.AGDIITVLEQHPDGR.W    
A3990CASKIN1Cask-interacting protein 1 K.AGDIITVLEQHPDGR.W    
A0568PCLO, ACZProtein piccolo K.AGEEEQQPDSRPEALPGATPLTLPK.A    
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A    
A9548RPL22, RPL22L260S ribosomal protein L22RL22_RATK.AGNLGGGVVTIER.S    
A3376MAP6Microtubule-associated protein 6 K.AGPAWMVTR.T    
A0007ACTN2Alpha-actinin 2AAC2_MOUSEK.AGTQIENIEEDFR.D    
A2341ACTN1Alpha-actinin 1AAC1_RATK.AGTQIENIEEDFR.D    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AGYVGLVTVPVATLAGR.H    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AGYVGLVTVPVATLAGR.H    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.AHFPGLQSK.M    
A0568PCLO, ACZProtein piccolo K.AHVQIPEEEPTGK.V    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AIEEYMR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AIEEYMR.L    
A562CSTX11Syntaxin 11STXB_MOUSEK.AIEQSIEQEEGLNR.S    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.AIFSHAAGDNSTLLSFK.E    
A3516SEPT3, SEP3Neuronal-specific septin-3 K.AIGHVIEEGGVK.M    
A0104HOMER1, SYN47Homer protein homolog 1 K.AIINSTITPNM#TFTK.T    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.AILEQQVLAEELTTK.K    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.AILSELLQR.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AKDFLSDM#AM#SEVDR.F    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.AKDFLSDM#AM#SEVDR.F    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATK.ALAAELNQLR.A    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.ALAGVTFAAK.G    
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like protein K.ALAVGGLGSIIR.V    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 K.ALDPASPLGLALAAR.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.ALEDLAQELEK.E    
A0038LPHN1, LEC2Latrophilin-1 K.ALEEPLLLPR.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.ALINADELANDVAGAEALLDR.H    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.ALIPLQTEAHPETK.Q    
A3580CYFIP2, PIR121P53 inducible protein K.AM#AGSVLLDK.R    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.ANDKLDTVLEK.S    
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_RATK.ANIPIM#DTGENPEVPFPR.D    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.ANMLRT*FS*S*IPVSRMCK.S   modifications: phosphorylated
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.ANVISELNSILQQM#NR.G    
A0814DDX5, G17P1, HELRProbable RNA-dependent helicase p68DDX5_MOUSEK.APILIATDVASR.G    
A3521SEPT9, MSF, SEP9MLL septin-like fusion protein MSF-A K.APVDFGYVGIDSILEQM#R.R    
A0374NEFH, NFHNeurofilament heavy polypeptide K.AQALQEECGYLR.R    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATK.AQLEQSVEENK.E    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 K.AQTPIEEFTPTPAFPALQYLESVDEGGVAWR.A    
A1941PLEC1, PLECPlectinPLEC_RATK.AQVEQELTTLR.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.ASAFNSWFENAEEDLTDPVR.C    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 K.ASIISELSSK.L    
A3873ANK2Ankyrin 2ANK2_HUMANK.ASSDVM#LNGFGGDAPTLR.L    
A0109SORBS2, ARGBP2, ARGBP2ASorbin and SH3 domain-containing protein 2 K.ASVVEALDSALK.D    
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1HXK1_RATK.ATDCEGHDVASLLR.D    
A3873ANK2Ankyrin 2ANK2_HUMANK.ATFSPIVTLEPR.R    
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseCN37_RATK.ATGAEEYAQQDVVR.R    
A3961MYH10, SmembMyosin-10MYHA_RATK.ATISALEAK.I    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSEK.ATLNPVWNETFVFNLKPGDVER.R    
A3873ANK2Ankyrin 2ANK2_HUMANK.ATSPLIEETPIGSIK.D    
A0143AKAP5, AKAP79A-kinase anchor protein 5AK15_RATK.ATVGQAEEPIVGQAEETVLR.H    
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein K.AVDEAADALLK.A    
A0757CNTN1Contactin-1 precursor K.AVDLIPWMEYEFR.V    
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor K.AVTEGAQAVEEPSIC.-    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform K.AVVQVFEGTSGIDAK.K    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.AYHEQLSVAEITNACFEPANQM#VK.C    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.AYHEQLSVAEITNACFEPANQM#VK.C    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.AYHEQLSVAEITNACFEPANQMVK.C    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.AYHEQLSVAEITNACFEPANQMVK.C    
A2624PTPRS, PTPsigma, BPTP-2Receptor-type protein-tyrosine phosphatase S precursor K.AYIATQGPLAETTEDFWR.A    
A0001hNMDAR1-4b, hNMDAR1-3b, GRIN1Glutamate [NMDA] receptor subunit zeta 1 precursorNMZ1_RATK.CDLVTTGELFFR.S    
A3891NRXN3Neurexin 3-alpha precursor K.CENVATLDPINFETPEAYISLPK.W    
A0130NRXN1Neurexin 1-alpha precursor K.CENVATLDPITFETPESFISLPK.W    
A1324AP3D1, PRO0039Adapter-related protein complex 3 delta 1 subunit K.CSDATLLSSLLEEM#K.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.CTASSLAEHQANLR.M    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.CTASSLAEHQANLR.M    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.CTELNQAWTSLGK.R    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.CVGVGESDGSIWNPDGIDPK.E    
A3961MYH10, SmembMyosin-10MYHA_RATK.DAAGLESQLQDTQELLQEETR.Q    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.DAGTIAGLNVLR.I    
A3879ERC2, CAST1, CASTERC protein 2 K.DANIALLELSASK.K    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATK.DDFHHLSVVPR.V    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSEK.DDFLQQNGYTPYDR.F    
A2341ACTN1Alpha-actinin 1AAC1_RATK.DDPLTNLNTAFDVAER.Y    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATK.DEAVLILSEAR.S    
A1218THY1Thy-1 membrane glycoprotein precursorTHY1_RATK.DEGDYMCELR.V    
A3816RPS340S ribosomal protein S3RS3_MOUSEK.DEILPTTPISEQK.G    
A0757CNTN1Contactin-1 precursor K.DETMTPSTAFQVK.V    
A0418CAPZBCapping protein (actin filament) muscle Z-line, betaCAPB_MOUSEK.DETVSDCSPHIANIGR.L    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSEK.DFEELKAEEIDVAK.D    
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1ADT1_RATK.DFLAGGIAAAVSK.T    
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_RATK.DFLAGGVAAAISK.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.DFLSDM#AM#SEVDR.F    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.DFLSDM#AM#SEVDR.F    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.DFQEPLPQK.G    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.DFSALESQLQDTQELLQEENR.Q    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 K.DFVSEAYLITLGK.F    
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor K.DFYM#TDSISR.A    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANK.DGNGYISAAELR.H    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRK.DGSASGTTLLEALDCILPPTRPTDKPLR.L    
A0469CTNND2, NPRAPCatenin delta-2 K.DIEDELTTGLELVDSCIR.S    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.DIVHSGLAYTM#ER.S    
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseCN37_RATK.DKPELQFPFLQDEDTVATLHECK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.DLASVNNLLK.K    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA K.DLDIAGFTQK.V    
A3961MYH10, SmembMyosin-10MYHA_RATK.DLEAQIEAANK.A    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.DLELDIIPASLSDR.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.DLFYVSRPPLAR.S    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.DLFYVSRPPLAR.S    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.DLGQDLAGVIAIQR.K    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATK.DLINKM#LTINPAK.R    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATK.DLLGEEDIPR.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.DLQDAENFFQFQGDADDLK.A    
A1941PLEC1, PLECPlectinPLEC_RATK.DLSEVGSVR.T    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATK.DLSFTEEGYQVHPR.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.DLTNVQNLQK.K    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.DLYANTVLSGGTTM#YPGIADR.M    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.DNEGFGFVLR.G    
A0285BSN, ZNF231Bassoon protein K.DPGEPAVLEGPTLPCCYGR.G    
A1941PLEC1, PLECPlectinPLEC_RATK.DPYTGEQISLFQAMK.K    
A3376MAP6Microtubule-associated protein 6 K.DQDHMASELLK.N    
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alpha K.DQPYYDIPDAPYR.I    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.DRPLPPAPLSPAPAPPTPAPEPHTPVPF.S    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 K.DSEGFGFVLR.G    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATK.DSEGLGISIIGM#GAGADM#GLEK.L    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.DSGSSSVFAESPGGK.A    
A0637GPHRYN, GPHN, GPHGephyrinGEPH_HUMANK.DSGVASTEDSSSSHITAAAIAAK.I    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATK.DSIFGDNM#NELQTFVANR.H    
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunit K.DTDIVDEAIYYFK.A    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.DTRSLGEEPVGGLGSLLDPAK.K    
A5462SKTSickle tail protein homolog K.DVEDGAFLLR.Q    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSEK.DVIVQDDDVDCTLVEK.R    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.DVNAAIAAIK.T    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.DVNAAIATIK.T    
A9637RPS1940S ribosomal protein S19RS19_RATK.DVNQQEFVR.A    
A3518SEPT5, CDCrel-1, PNUTL1Septin 5 K.DVTCDVHYENYR.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.DVTGAEALLER.H    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.DWFIEM#PVESK.K    
A3990CASKIN1Cask-interacting protein 1 K.DYCNNYDLTSLNVK.A    
A3990CASKIN1Cask-interacting protein 1 K.DYCNNYDLTSLNVK.A    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.DYEEVGVDSVEGEGEEEGEE.Y    
A1941PLEC1, PLECPlectinPLEC_RATK.DYELQLITYK.A    
A0007ACTN2Alpha-actinin 2AAC2_MOUSEK.DYESASLTEVR.A    
A0418CAPZBCapping protein (actin filament) muscle Z-line, betaCAPB_MOUSEK.DYLLCDYNR.D    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATK.EAAEAIEAEGATAPLTELLHSR.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EAALTSEEVGADLEQVEVLQK.K    
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alpha K.EADPLAASEASQPR.P    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.EAESCDCLQGFQLTHSLGGGTGSGM#GTLLISK.I    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.EAESCDCLQGFQLTHSLGGGTGSGM#GTLLISK.I    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATK.EAFQNAYLELGGLGER.V    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANK.EAFSLFDKDGDGTITTK.E    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.EAIVTLVELGDDWER.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EAIVTSEELGQDLEHVEVLQK.K    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.EALELTDTGLLSGSEER.V    
A0285BSN, ZNF231Bassoon protein K.EAPVAQAPAPPPGQK.P    
A4636CAPZA1F-actin capping protein alpha-1 subunitCAZ1_MOUSEK.EASDPQPEDVDGGLK.S    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.EASSVLQWLESK.E    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.EDFVELGVTR.V    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.EDKLECSEELGDLVK.S    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.EDLIDLGVTR.V    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.EDQKGQEQTIEALK.Q    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.EELHPTTSSQLAPSFSSSSSSSSGPR.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EEVASALVHILQSTGK.A    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EEVASALVHILQSTGK.A    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EFAEYVTNHYR.M    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EFAEYVTNHYR.M    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.EFGPVVIDYGK.V    
A3869PPFIA3Liprin-alpha 3 K.EFSNLISLGTDR.R    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.EGDLITLLVPEAR.D    
A3884NCAM1, NCAMNeural cell adhesion molecule 1, 120/140 kDa isoform precursorNCA1_RATK.EGEDAVIVCDVVSSLPPTIIWK.H    
A3874ANK3Ankyrin 3 K.EGHVEVVSELLQR.E    
A3873ANK2Ankyrin 2ANK2_HUMANK.EGHVGLVQELLGR.G    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.EGM#QLISEKPETEAVVK.E    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSEK.EGNASGVSLLEALDTILPPTRPTDK.P    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSEK.EGNASGVSLLEALDTILPPTRPTDKPLR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EGSIGGSGGSGGGGGGGLKPSITK.Q    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EGSIGGSGGSGGGGGGGLKPSITK.Q    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATK.EGYNVYGIESVK.I    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.EIEAEIHALR.Q    
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type CK6PP_RATK.EIGWGDVGGWTGQGGSILGTK.R    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.EIIDPVLDR.I    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.EILPTPPSAAAASPSPTLSDVFSLPSQSPAGDLFGLNPAGR.S    
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.EITALAPSTMK.I    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.EITALAPSTMK.I    
A4552ACTG1, ACTGActin, cytoplasmic 2 K.EITALAPSTMK.I    
A3531KTN1, CG1, PDIA6Kinectin K.EITDLCNELESLK.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EKEQLM#ASDDFGR.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EKEQLMASDDFGR.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EKLDILDQER.T    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.ELAALWLSDNQSK.A    
A0561DOC2ADouble C2-like domains, alpha K.ELEQAEQGPGLLEER.G    
A3873ANK2Ankyrin 2ANK2_HUMANK.ELGDDSLPSSQFLDGM#NYLR.Y    
A3873ANK2Ankyrin 2ANK2_HUMANK.ELGDDSLPSSQFLDGMNYLR.Y    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.ELGDVLFQM#AEVHR.Q    
A1074TNRTenascin-R K.ELIVDAEDTWIR.L    
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitAR34_HUMANK.ELQAHGADELLK.R    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.ELQYIDAISNK.Q    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.ELVLALYDYQEK.S    
A0161SYN1Synapsin ISYN1_RATK.EM#LSSTTYPVVVK.M    
A0161SYN1Synapsin ISYN1_RATK.EMLSSTTYPVVVK.M    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATK.ENIPTPALEPQTTVIHNPDGNK.E    
A3580CYFIP2, PIR121P53 inducible protein K.EPSM#M#EYVLYPLDLYNDSAYYALTK.F    
A3961MYH10, SmembMyosin-10MYHA_RATK.EQADFAVEALAK.A    
A0276CIT, CRIK, STK21Citron protein K.EQEYQAQVEEM#R.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.EQIYSSLDYGK.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.EQLM#ASDDFGR.D    
A3518SEPT5, CDCrel-1, PNUTL1Septin 5 K.ESAPFAVIGSNTVVEAK.G    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.ESESCDCLQGFQLTH.S    
A0999CFL1, CFLCofilin, non-muscle isoformCOF1_RATK.ESKKEDLVFIFWAPESAPLK.S    
A4745DBNL, CMAP, SH3P7Cervical SH3P7 K.ESSCFQDVGPQAPVGSVYQK.T    
A0568PCLO, ACZProtein piccolo K.ETGDGIILEVLDAYK.D    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.ETGTLESQLEANK.R    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.ETLEPLIQAAQLLQVK.K    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSEK.ETQPGEAYVIQK.E    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.ETS*PETSLIQDEVALK.L   modifications: phosphorylated
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.ETSPETSLIQDEVALK.L    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.EVDEQMLAIQSK.N    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.EVDEQMLNVQNK.N    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.EVDEQMLNVQNK.N    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.EVDEQMLSVQSK.N    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.EVLEDVCADSVDAVQELIK.Q    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EYEEEIHSLK.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.EYEEEIHSLK.E    
A096ARHOG, ARHGRho-related GTP-binding protein RhoGRHOG_HUMANK.EYIPTVFDNYSAQSAVDGR.T    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATK.FADLTDVASR.N    
A0107DLGAP1, DAP1, GKAPDisks large-associated protein 1 K.FDELHQLK.A    
A0447DLGAP2, DAP2Disks large-associated protein 2 K.FDELHQLK.A    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.FDVGDWLESIHLGEHR.D    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSEK.FEACNYPLELYER.V    
A3520SEPT7, CDC10Septin-7SEP7_RATK.FEDYLNAESR.V    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.FEEFQEELTAR.K    
A0109SORBS2, ARGBP2, ARGBP2ASorbin and SH3 domain-containing protein 2 K.FFGTFPGNYVK.R    
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitADAA_MOUSEK.FFQPTEM#AAQDFFQR.W    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.FFWEM#DEAESWIK.E    
A0014DLG2Disks large homolog 2SP93_RATK.FIEAGQYNDNLYGTSVQSVR.F    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATK.FIEAGQYNSHLYGTSVQSVR.E    
A3580CYFIP2, PIR121P53 inducible protein K.FINMFAVLDELK.N    
A0568PCLO, ACZProtein piccolo K.FKDSEEISSTYFPGSIIDYPEDISVSLDR.T    
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A K.FKGPFTDVVTTNLK.L    
A9577RPL9, RPL9P7, RPL9P860S ribosomal protein L9RL9_DROMEK.FLDGLYVSEK.T    
A0219CDH2, CDHN, NCADNeural-cadherin precursorCAD2_RATK.FLEAGIYEVPIVITDSGNPPK.S    
A912BCPNE6Copine-6CNE6_MOUSEK.FLVYDYDSSGK.H    
A9538RPL10, DXS648E, QM60S ribosomal protein L10RL10_MOUSEK.FNADEFEDM#VAEK.R    
A0568PCLO, ACZProtein piccolo K.FNPFDLISDSEASQEETTK.K    
A0130NRXN1Neurexin 1-alpha precursor K.FNVGTDDIAIEESNAIINDGK.Y    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.FPFISLASK.K    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.FPFISLASK.K    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.FPFTFDEK.R    
A3904syn2, SYN2Synapsin-2SYN2_RATK.FPLIEQTYYPNHR.E    
A3813RPL10A, NEDD660S ribosomal protein L10aR10A_RATK.FPSLLTHNENM#VAK.V    
A374ETANC2Protein TANC2 K.FPTQSSFDR.V    
A0440LGI1, EPT, UNQ775/PRO1569Leucine-rich glioma-inactivated protein 1 precursor K.FQELNVQAPR.S    
A3813RPL10A, NEDD660S ribosomal protein L10aR10A_RATK.FSVCVLGDQQHCDEAK.A    
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1 K.FTDFIDTCLIK.T    
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_RATK.FTHGFQNIVDAYGIGTYR.E    
A1525TNC, HXBTenascin precursor K.FTTDLDSPR.E    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.FWEVISDEHGIDPTGSYHGDSDLQLER.I    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.FWEVISDEHGIDPTGTYHGDSDLQLER.I    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATK.FYFENLLSK.N    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.GAILTTM#LATR.N    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.GAILTTM#LATR.N    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATK.GAILTTM#LATR.N    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.GAILTTMLATR.N    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.GAILTTMLATR.N    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATK.GAILTTMLATR.N    
A1222RPL5, MSTP03060S ribosomal protein L5RL5_RATK.GAVDGGLSIPHSTK.R    
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1ADT1_RATK.GAWSNVLR.G    
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_RATK.GAWSNVLR.G    
A0350MBPMyelin basic protein K.GAYDAQGTLSK.I    
A0587ADD2, ADDBBeta adducin K.GDADTKDELEETVPNPFSQLTDQELEEYKK.E    
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1HXK1_RATK.GDFIALDLGGSSFR.I    
A0757CNTN1Contactin-1 precursor K.GDGPYSLIAVINSAQDAPSEAPTEVGVK.V    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.GDILTLLNSTNK.D    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 K.GDLDYYWLDPATWH.S    
A1941PLEC1, PLECPlectinPLEC_RATK.GDQCQLVGPAQPFHWK.V    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.GEGLYADPYGLLHEGR.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.GEIDAHEDSFK.S    
A3531KTN1, CG1, PDIA6Kinectin K.GELSGLLHQLQEK.E    
A0454DSPDesmoplakin K.GFFDPNTEENLTYLQLK.E    
A1021CSRP1, CSRP, CYRPCysteine-rich protein 1CYSR_RATK.GFGFGQGAGALVHSE.-    
A0757CNTN1Contactin-1 precursor K.GFGPIFEEQPINTIYPEESLEGK.V    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATK.GFQQILAGDYDHLPEQAFYM#VGPIEEAVAK.A    
A3506DCAMKL1, DCLK1, DCDC3ASerine/threonine-protein kinase DCAMKL1 K.GGDLFDAITSTSK.Y    
A1941PLEC1, PLECPlectinPLEC_RATK.GGELVYTDTEAR.D    
A0560UNC13AProtein unc-13 homolog A K.GGPGGGLIIIDSMPDIR.K    
A3893HAPLN1, CRTL1Hyaluronan and proteoglycan link protein 1PLK_RATK.GGSDNDASLIITDLTLEDYGR.Y    
A3376MAP6Microtubule-associated protein 6 K.GHGSVFVAPVK.S    
A1914CTNNA2, CAPRCatenin alpha-2CTN2_MOUSEK.GHTGIGELAAALNEFDNK.I    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.GHYTEGAELVDSVLDVVR.K    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.GHYTEGAELVDSVLDVVR.K    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.GHYTEGAELVDSVLDVVR.K    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.GHYTEGAELVDSVLDVVRK.E    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.GHYTEGAELVDSVLDVVRK.E    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.GHYTEGAELVDSVLDVVRK.E    
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALFA_RATK.GILAADESTGSIAK.R    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 K.GIQYLIER.G    
A2341ACTN1Alpha-actinin 1AAC1_RATK.GISQEQMNEFR.A    
A0361YWHAZ14-3-3 protein zeta/delta143Z_MOUSEK.GIVDQSQQAYQEAFEISK.K    
A1941PLEC1, PLECPlectinPLEC_RATK.GIYQSLEGAVQAGQLK.I    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.GKEEVASALVH.I    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.GKEEVASALVH.I    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.GLADVQNLLR.K    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.GLDPNFHDPDSGECPLSLAAQLDNATDLLK.V    
A3884NCAM1, NCAMNeural cell adhesion molecule 1, 120/140 kDa isoform precursorNCA1_RATK.GLGEISAATEFK.T    
A0212RPH3ARabphilin-3ARP3A_RATK.GLKPMDSNGLADPYVK.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.GLQDALQGQELSLGEASK.L    
A0447DLGAP2, DAP2Disks large-associated protein 2 K.GLQFGSSFQR.H    
A0352PLP1, PLPMyelin proteolipid proteinMYPR_HUMANK.GLSATVTGGQK.G    
A9630RPS1340S ribosomal protein S13RS13_HUMANK.GLTPSQIGVILR.D    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATK.GM#SLNLEPDNVGVVVFGNDK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.GNAM#VEEGHFAAEDVK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.GNAMVEEGHFAAEDVK.A    
A0663NFASCNeurofascin precursor K.GPEPETVIGYSGEDYPR.A    
A0285BSN, ZNF231Bassoon protein K.GPQGPGQPSGSLPPK.A    
A0016DLG3Discs, large homolog 3SP02_RATK.GQEDAILSYEPVTR.Q    
A0052GNAZGuanine nucleotide-binding protein G(z), alpha subunitGBAZ_RATK.GQNTYEEAAVYIQR.Q    
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1 K.GQNVLLTENAEVK.L    
A8006TNIK, AD 2, AD2TRAF2 and NCK interacting protein kinase K.GQNVLLTENAEVK.L    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATK.GRSDPYHATTGPLSPSK.D    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.GSGFSLDVIDGPISQR.E    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 K.GSIPSASSPTSPALPR.S    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 K.GSLADVVGHLR.A    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.GSLPPAALEPQTTVIHNPVDGIK.E    
A9253BAI3Brain-specific angiogenesis inhibitor 3BAI3_HUMANK.GTNPEGLSYSTLPGNVISK.V    
A3555VCAN, CSPG2Versican core protein precursor K.GTVACGQPPVVENAK.T    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATK.GTVVYGEPITASLGTDGSHYWSK.N    
A0234ACTR3, ARP3Actin-like protein 3 K.GVDDLDFFIGDEAIEKPTYATK.W    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATK.GVGIISEGNETVEDIAAR.L    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATK.GVGIISEGNETVEDIAAR.L    
A1324AP3D1, PRO0039Adapter-related protein complex 3 delta 1 subunit K.GVPVAEEVSALFAGELNPVAPK.A    
A0587ADD2, ADDBBeta adducinADDL_RATK.GVSCSEVTASSLIK.V    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor K.GVTCHEPLYK.E    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.GVVTNGLDVS*PAEEK.K   modifications: phosphorylated
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.GVVTNGLDVSPAEEK.K    
A0007ACTN2Alpha-actinin 2AAC2_MOUSEK.GYEEWLLNEIR.R    
A2341ACTN1Alpha-actinin 1AAC1_RATK.GYEEWLLNEIR.R    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATK.GYHYIIANLGFTDGDLLK.I    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.GYQPCDPQVIQDR.V    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATK.HALIIYDDLSK.Q    
A0510PPP1R9ANeurabin-INEB1_RATK.HAVTEAEIQKLK.T    
A3937VAPA, VAP33Vesicle-associated membrane protein-associated protein A K.HEQILVLDPPSDLK.F    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSEK.HFTEFVPLR.T    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.HGGTIPVVPTAEFQDR.I    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATK.HGVVGGVPAPWEK.N    
A1222RPL5, MSTP03060S ribosomal protein L5RL5_RATK.HIM#GQNVADYM#R.Y    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.HLLEVEDLLQK.H    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.HLLGVEDLLQK.H    
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_RATK.HLTDAYFK.K    
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSEK.HM#M#AFIEQEANEK.A    
A9541RPL1260S ribosomal protein L12RL12_RATK.HNGNITFDEIVNIAR.Q    
A3690CKMT1B, CKMT1A, CKMTCreatine kinase U-type, mitochondrialKCRU_RATK.HNNCM#ASHLTPAVYAR.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.HQAFEAELHANADR.I    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.HQAFEAEVQANSGAIVK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.HQALQAEIAGHEPR.I    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.HQILEQAVEDYAETVHQLSK.T    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.HRPDLIDFDK.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.HRPDLIDFDK.L    
A0757CNTN1Contactin-1 precursor K.HSIEVPIPR.D    
A0285BSN, ZNF231Bassoon protein K.HSYSLGFADGR.Y    
A1218THY1Thy-1 membrane glycoprotein precursorTHY1_RATK.HVLSGTLGVPEHTYR.S    
A0104HOMER1, SYN47Homer protein homolog 1 K.HWEAELATLK.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.IAALQAFADQLIAVDHYAK.G    
A0117NSFVesicle-fusing ATPase K.IAEESNFPFIK.I    
A3879ERC2, CAST1, CASTERC protein 2 K.IAELESLTLR.H    
A1914CTNNA2, CAPRCatenin alpha-2CTN2_MOUSEK.IAEQVEIFHQEK.S    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.IAQLEEQLDNETK.E    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATK.ICDPGLTSFEPEALGNLVEGM#DFHK.F    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.ICDPGLTSFEPEALGNLVEGM#DFHR.F    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.ICDPGLTSFEPEALGNLVEGMDFHR.F    
A2341ACTN1Alpha-actinin 1AAC1_RATK.IDQLEGDHQLIQEALIFDNK.H    
A1353GRM3, GPRC1C, MGLUR3Metabotropic glutamate receptor 3 precursorMGR3_RATK.IEGDLVLGGLFPINEK.G    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.IEGSNGAATPSAPVCGSGSR.S    
A6235CYLD, CYLD1, HSPC057Probable Ubiquitin carboxyl-terminal hydrolase CYLD K.IFPSLELNITDLLEDTPR.Q    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.IGELEVGQM#ENISPGQIIDEPIRPVNIPR.K    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.IGELEVGQMENISPGQIIDEPIRPVNIPR.K    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRK.IGGIGTVPVGR.V    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSEK.IGGIGTVPVGR.V    
A9541RPL1260S ribosomal protein L12RL12_RATK.IGPLGLSPK.K    
A3961MYH10, SmembMyosin-10MYHA_RATK.IGQLEEQLEQEAK.E    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATK.IGYWSEVDK.M    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.IIAEGANGPTTPEADK.I    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATK.IIHEDGFSGEDVK.Q    
A3807RPLP060S acidic ribosomal protein P0RLA0_RATK.IIQLLDDYPK.C    
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_RATK.ILDSVGIEADDER.L    
A1941PLEC1, PLECPlectinPLEC_RATK.ILITIVEEVETQR.Q    
A9544RPL1860S ribosomal protein L18RL18_RATK.ILTFDQLALESPK.G    
A0757CNTN1Contactin-1 precursor K.ILYRPDGQHDGK.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.INAVVETGR.R    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.IPCFPIESK.E    
A8952PREX2, DEPDC2Phosphatidylinositol 3,4,5-trisphosphate-dependent RAC exchanger 2 protein K.IPDSADGLGFQIR.G    
A4011RAB11FIP2, Rab11-FIP2RAB11 family-interacting protein 2 K.IPDSNPFDATAGYR.S    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.IPSDYNLGNYGDK.T    
A5224TPM4Tropomyosin alpha 4 chain K.IQVLQQQADDAEER.A    
A3865EPB41L3, DAL1Band 4.1-like protein 3 K.IRPGEFEQFESTIGFK.L    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATK.ISELEGNLQTLR.N    
A4613CDH10Cadherin-10 precursorCADA_HUMANK.ISIEDVDEPPVFSR.S    
A0568PCLO, ACZProtein piccolo K.ISLPEPGLAQAPSSVTAPQIK.E    
A3823RPS840S ribosomal protein S8RS8_HUMANK.ISSLLEEQFQQGK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.ITALDEFATK.L    
A3496FLOT1Flotillin-1FLT1_RATK.ITLVSSGSGTMGAAK.V    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATK.ITSFPESESYSYETTTK.T    
A0568PCLO, ACZProtein piccolo K.IVDSGVQTDDEETADR.S    
A0757CNTN1Contactin-1 precursor K.IVESYQIR.Y    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATK.IVLEDGTLHVTEGSGR.Y    
A0001hNMDAR1-4b, hNMDAR1-3b, GRIN1Glutamate [NMDA] receptor subunit zeta 1 precursorNMZ1_RATK.IVNIGAVLSTR.K    
A0439PHB2, BAP, REAProhibitin 2 K.IVQAEGEAEAAK.M    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.IVSSNDVGHDEYSTQ.S    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.IVSSNDVGHDEYSTQSLVK.K    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.IWHHTFYNELR.V    
A4552ACTG1, ACTGActin, cytoplasmic 2 K.IWHHTFYNELR.V    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATK.IYAM#HWGTDSR.L    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATK.IYAMHWGTDSR.L    
A3520SEPT7, CDC10Septin-7SEP7_RATK.IYEFPETDDEEENK.L    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.IYIDSNNNPER.F    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.KAESEELEIQKPQVK.L    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.KDEWGLAAPISPGPLTPMR.E    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSEK.KDVIVQDDDVDCTLVEK.R    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.KEDIAINGEVEGK.E    
A3961MYH10, SmembMyosin-10MYHA_RATK.KEEELQGALAR.G    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.KFDQLLAEEK.T    
A3961MYH10, SmembMyosin-10MYHA_RATK.KFDQLLAEEK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.KFEEFQTDLAAHEER.V    
A0095DNM1, DNMDynamin-1DYN1_RATK.KFTDFEEVR.L    
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1 K.KFTDFIDTCLIK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.KGDILTLLNSTNK.D    
A9630RPS1340S ribosomal protein S13RS13_HUMANK.KGLTPSQIGVILR.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.KHEAFETDFTVHK.D    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.KHEAIETDIAAYEER.V    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.KHEALM#SDLSAYGSSIQALR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.KHEALMSDLSAYGSSIQALR.E    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.KHQILEQAVEDYAETVHQLSK.T    
A0285BSN, ZNF231Bassoon protein K.KKPDPLEIGYQAHLPPESLSQLVSR.Q    
A0161SYN1Synapsin ISYN1_RATK.KLGTEEFPLIDQTFYPNHK.E    
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1RACX_HUMANK.KLTPITYPQGLAM#AK.E    
A0194RAC1, TC25, MIG5Ras-related C3 botulinum toxin substrate 1RACX_HUMANK.KLTPITYPQGLAMAK.E    
A9551RPL23A60S ribosomal protein L23aRL2B_HUMANK.KLYDIDVAK.V    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.KNDVLTLLSSINK.D    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATK.KPLDIGLPSSK.H    
A3816RPS340S ribosomal protein S3RS3_MOUSEK.KPLPDHVSIVEPK.D    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.KQEDFM#TTM#DANEEK.I    
A3961MYH10, SmembMyosin-10MYHA_RATK.KQELEEILHDLESR.V    
A3961MYH10, SmembMyosin-10MYHA_RATK.KVDDDLGTIEGLEEAK.K    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.KVEAQLQELQVK.F    
A0292INA, NEF5Alpha-internexinAINX_RATK.KVESLLDELAFVR.Q    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.KVPLDM#SLFLK.L    
A3813RPL10A, NEDD660S ribosomal protein L10aR10A_RATK.KYDAFLASESLIK.Q    
A0276CIT, CRIK, STK21Citron protein K.LAANSSLFTQR.N    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 K.LADQIFAYYK.V    
A3580CYFIP2, PIR121P53 inducible protein K.LADQIFAYYK.V    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.LADVSAPSGGPPPPHSPY.S    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATK.LADVYQAELR.E    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATK.LALDIEIATYR.K    
A4870 Intermediate filament protein ON3ION3_CARAUK.LALDIEIATYR.K    
A3962MYH14, FP17425Myosin-14 K.LAQAEEQLEQESR.E    
A0148WASF1, SCAR1, WAVE1Wiskott-Aldrich syndrome protein family member 1 K.LAQGPELAEDDADLLHK.H    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.LATATETYIKPISK.L    
A0367RPL13, BBC160S ribosomal protein L13RL13_RATK.LATQLTGPVM#PIR.N    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.LAVNM#VPFPR.L    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.LAVNM#VPFPR.L    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.LAVNM#VPFPR.L    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.LAVNM#VPFPR.L    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.LAVNMVPFPR.L    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.LAVNMVPFPR.L    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.LAVNMVPFPR.L    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.LAVNMVPFPR.L    
A3479VDAC3Voltage-dependent anion-selective channel protein 3 K.LCQNNFALGYK.A    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATK.LDADAVSPTVSQLSAVFEK.A    
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CTOG_HUMANK.LDDIFEPVLIPEPK.I    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.LDEQGLNYQQK.V    
A3961MYH10, SmembMyosin-10MYHA_RATK.LDGETTDLQDQIAELQAQVDELK.V    
A0095DNM1, DNMDynamin-1DYN1_RATK.LDLMDEGTDAR.D    
A1927DNM2, DYN2Dynamin 2DYN2_RATK.LDLMDEGTDAR.D    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSEK.LDNVMLDAEGHIK.I    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.LECSEELGDLVK.S    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.LEDLEVIQHR.F    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.LEESYHYQVFR.R    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.LEFLPEEIGQM#QR.L    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.LEFLPEEIGQMQR.L    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.LEGAGSATVAEVEM#PFYEDK.S    
A8756DOCK9, zizimin1Dedicator of cytokinesis protein 9 K.LEGSGSGLDSYLPELAK.S    
A1941PLEC1, PLECPlectinPLEC_RATK.LEQLFQDEVAK.A    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.LESEHPDQAQAILSR.L    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.LETTPTTSPLPER.K    
A3874ANK3Ankyrin 3 K.LEVASLLLQK.S    
A0117NSFVesicle-fusing ATPase K.LFADAEEEQR.R    
A797DPHLDB1, LL5A, DLNB07Pleckstrin homology-like domain family B member 1 K.LFEDLEFQQLER.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LFGAAEVQR.F    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LGDSHDLQR.F    
A5420NRN1, NRNNeuritin precursor, a protein which promotes neurite outgrowth K.LGDSM#ANYPQGLDDK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LGESQTLQQFSR.D    
A0409ATP6V1H, CGI-11, MSTP042V-type proton ATPase subunit H K.LGESVQDLSSFDEYSSELK.S    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.LGILDLLDEECK.M    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.LGPAAEM#DHVIPLLSK.H    
A0161SYN1Synapsin ISYN1_RATK.LGTEEFPLIDQTFYPNHK.E    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.LHIIEVGTPPTGNQPFPK.K    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.LIDLESPTPESQK.N    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta K.LIDLESPTPESQK.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LIDVNHYAK.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LIQNNHYAM#EDVATR.R    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LIQNNHYAMEDVATR.R    
A0568PCLO, ACZProtein piccolo K.LLDADSAYEELM#R.R    
A0568PCLO, ACZProtein piccolo K.LLDADSAYEELMR.R    
A9635RPS17, RPS17L40S ribosomal protein S17RS17_RATK.LLDFGSLSNLQVTQPTVGM#NFK.T    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.LLDPEDISVDHPDEK.S    
A0560UNC13AProtein unc-13 homolog A K.LLDQLHNSLR.I    
A0560UNC13AProtein unc-13 homolog A K.LLDQLHNSLR.I    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.LLEAAEQLAQTGECDPEEIYK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LLEATELK.G    
A0292INA, NEF5Alpha-internexinAINX_RATK.LLEGEETR.F    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATK.LLEGEETR.F    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.LLEGEETR.F    
A9634RPS1640S ribosomal protein S16RS16_HUMANK.LLEPVLLLGK.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.LLEVLSGEM#LPR.P    
A0403ATP6V0D1, ATP6D, VPATPDVacuolar ATP synthase subunit D 1VATX_MOUSEK.LLFEGAGSNPGDK.T    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.LLIQLADSFVEK.G    
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATK.LLM#M#AGIDDCYTSAR.G    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATK.LLNDEDQVVVNK.A    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.LLVDSQLLQQLYQDSDDLK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LLVSSEDYGR.D    
A3865EPB41L3, DAL1Band 4.1-like protein 3 K.LM#DGSEILSLLESAR.K    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.LM#EADIAIQGDK.V    
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_HUMANK.LNISFPATGCQK.L    
A0568PCLO, ACZProtein piccolo K.LPAAVSLYSPTDEQSVM#QK.E    
A4010WDR7, TRAGWD-repeat protein 7 K.LPASCLPASDSFR.S    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.LPLWQQACADPNK.I    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.LPLWQQACADPNKIPDR.A    
A993BG3BP2Ras-GTPase-activating protein binding protein 2G3B2_MOUSEK.LPNFGFVVFDDSEPVQR.I    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.LPSSFAEPLDKEETEFK.M    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.LQAFLQDLDDFK.A    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.LQLQNQESVR.A    
A3961MYH10, SmembMyosin-10MYHA_RATK.LQNELDNVSTLLEEAEK.K    
A1941PLEC1, PLECPlectinPLEC_RATK.LQNVQIALDYLR.H    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.LQQQFNM#HVFK.L    
A177CMYO5C, HSPC089Unconventional myosin-VcMY5C_HUMANK.LQQQFNM#HVFK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.LSDDNTIGQEEIQQR.L    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.LSDSYSNTLPVR.K    
A3535DNAJA2, CPR3, HIRIP4DnaJ homolog subfamily A member 2DJA2_RATK.LSELEDLLPSRPEVPNVIGETEEVELQEFDSTR.G    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.LSGQYAAVFGAPGHTLPPGEPALGEVEER.C    
A0143AKAP5, AKAP79A-kinase anchor protein 5AK15_RATK.LSQAEEATVAQAK.E    
A0143AKAP5, AKAP79A-kinase anchor protein 5AK15_RATK.LSQIEEPAISQAK.K    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.LSVEIPCPPPVSEADSSIDEK.A    
A0104HOMER1, SYN47Homer protein homolog 1 K.LTAALLESTANVK.Q    
A0285BSN, ZNF231Bassoon protein K.LTEAVSAFGK.K    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.LTFDSSFSPNTGK.K    
A0426VDAC2Voltage-dependent anion-selective channel protein 2POR2_RATK.LTFDTTFSPNTGK.K    
A3557OLFM1, NOE1, NOEL1Noelin precursorNOMR_RATK.LTGISDPVTVK.T    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATK.LTGM#AFR.V    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.LTNLEGVYNSETEK.L    
A8753DOCK3, MOCADedicator of cytokinesis protein 3 K.LTQNVDLLALLK.W    
A9630RPS1340S ribosomal protein S13RS13_HUMANK.LTSDDVKEQIYK.L    
A0014DLG2Disks large homolog 2SP93_RATK.LVIEEQSGPFIWIPSK.E    
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 K.LVNGCALNFFR.Q    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATK.LVVENVDVLTQM#R.T    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATK.LVVENVDVLTQMR.T    
A0451HSPA5, GRP78Heat shock 70kDa protein 5GR78_RATK.LYGSGGPPPTGEEDTSEKDEL.-    
A3509SBF1, MTMR5SET binding factor 1 K.M#AFDEEVGSDSAELFR.K    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.M#CDPGM#TAFEPEALGNLVEGLDFHR.F    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.M#CDPGMTAFEPEALGNLVEGLDFHR.F    
A3557OLFM1, NOE1, NOEL1Noelin precursorNOMR_RATK.M#DELRPLIPVLEEYK.A    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATK.M#DENQFVAVTSTNAAK.I    
A3605CRMP1, DPYSL1, ULIP3Dihydropyrimidinase related protein-1DPY1_RATK.M#DENQFVAVTSTNAAK.I    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.M#DVGGLSDPYVK.I    
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1ADB1_RATK.M#EPLNNLQVAVK.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.M#FSEADACELWIDEK.E    
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevican K.M#GLVSCGPPPQLPLAQIFGR.P    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANK.M#KDTDSEEEIR.E    
A2341ACTN1Alpha-actinin 1AAC1_RATK.M#LDAEDIVGTARPDEK.A    
A0007ACTN2Alpha-actinin 2AAC2_MOUSEK.M#LDAEDIVNTPKPDER.A    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.M#LPELFQDDEK.A    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.M#LTAQDM#SYDEAR.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.M#LTAQDMSYDEAR.N    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.M#LTINPSK.R    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATK.M#QVNAEEVVVGDLVEIK.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.M#TLVASEDYGDTLAAIQGLLK.K    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.M#WEVLESTTQTK.A    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 K.M#YFLPDR.S    
A3776SLC25A3, PHCSolute carrier family 25 member 3 K.M#YKEEGLNAFYK.G    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.MCDPGM#TAFEPEALGNLVEGLDFHR.F    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.MCDPGMTAFEPEALGNLVEGLDFHR.F    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATK.MDENQFVAVTSTNAAK.I    
A3605CRMP1, DPYSL1, ULIP3Dihydropyrimidinase related protein-1DPY1_RATK.MDENQFVAVTSTNAAK.I    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.MDVGGLSDPYVK.I    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.MLTAQDM#SYDEAR.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.MLTAQDMSYDEAR.N    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.MLTINPSK.R    
A3961MYH10, SmembMyosin-10MYHA_RATK.MQAHIQDLEEQLDEEEGAR.Q    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.MWEVLESTTQTK.A    
A3776SLC25A3, PHCSolute carrier family 25 member 3 K.MYKEEGLNAFYK.G    
A943BDYNLL2, DLC2, Dlc2Dynein light chain 2, cytoplasmic K.NADM#SEDMQQDAVDCATQAM#EK.Y    
A0514DNCL1, DYNLL1, DLC1Dynein light chain 1, cytoplasmicDYL1_HUMANK.NADMSEEMQQDSVECATQALEK.Y    
A0568PCLO, ACZProtein piccolo K.NAFDYSGGTGAAVDLTSGR.V    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATK.NAGQTVTIIAQYKPEEYSR.F    
A3879ERC2, CAST1, CASTERC protein 2 K.NAQLLEEVR.R    
A0083CTTN, EMS1CortactinSRC8_MOUSEK.NASTFEEVVQVPSAYQK.T    
A3873ANK2Ankyrin 2ANK2_HUMANK.NDETESTETSVLK.S    
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alpha K.NDTVTPAELNELR.S    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.NDVLTLLSSINK.D    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.NEIDNYEEDYQK.M    
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aRL7A_HUMANK.NFGIGQDIQPK.R    
A0117NSFVesicle-fusing ATPase K.NFSGAELEGLVR.A    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.NFSTCLELGESLLQR.Q    
A0420ABLIM1, ABLIM, LIMAB1Actin-binding LIM protein 1 K.NGDYLCTLDYQR.M    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.NGTVM#APDLPEM#LDLAGTR.S    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.NGVQEFPENIK.C    
A3961MYH10, SmembMyosin-10MYHA_RATK.NHEAQIQDMR.Q    
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_RATK.NIEDVIAQGVGK.L    
A8662ANKS1B, EB-1Cajalin 2 K.NIIAEHEIR.N    
A0999CFL1, CFLCofilin, non-muscle isoformCOF1_RATK.NIILEEGKEILVGDVGQTVDDPYTTFVK.M    
A3961MYH10, SmembMyosin-10MYHA_RATK.NILAEQLQAETELFAEAEEM#R.A    
A0234ACTR3, ARP3Actin-like protein 3 K.NIVLSGGSTM#FR.D    
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6MLES_RATK.NKDQGTYEDYVEGLR.V    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.NKDTVFEEQIK.V    
A4870 Intermediate filament protein ON3ION3_CARAUK.NKYEDEINKR.T    
A3520SEPT7, CDC10Septin-7SEP7_RATK.NLEGYVGFANLPNQVYR.K    
A4033DMXL2, RC3DmX-like protein 2 K.NLENWEQILQEK.M    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.NLILELKPR.G    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.NLINQM#LTINPAK.R    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATK.NLINQM#LTINPAK.R    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.NLPIYSEEIVDM#YK.G    
A3961MYH10, SmembMyosin-10MYHA_RATK.NLPIYSENIIEM#YR.G    
A0292INA, NEF5Alpha-internexinAINX_RATK.NLQSAEEWYK.S    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATK.NM#ANLSGVNGSPQSALDFIR.R    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.NM#LINIVDTAQQK.S    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATK.NM#QNAEEWFK.S    
A4013TENM4, ODZ4, TNM4Teneurin-4 K.NNNPISNSQDIK.C    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.NQALNTDNYGHDLASVQALQR.K    
A3376MAP6Microtubule-associated protein 6 K.NQDPVIPVPLK.G    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA K.NQLEESEFTCAAAVK.A    
A0451HSPA5, GRP78Heat shock 70kDa protein 5GR78_RATK.NQLTSNPENTVFDAK.R    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.NQTLQNEILGHAPR.V    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.NQVAM#NPTNTVFDAK.R    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.NQVAMNPTNTVFDAK.R    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.NSSYFVEWIPNNVK.T    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain K.NSSYFVEWIPNNVK.T    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.NSSYFVEWIPNNVK.T    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.NSSYFVEWIPNNVK.T    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.NTM#TDSTILLEDVQK.M    
A0403ATP6V0D1, ATP6D, VPATPDVacuolar ATP synthase subunit D 1VATX_MOUSEK.NVADYYPEYK.L    
A4042PPP1CCSerine/threonine protein phosphatase PP1-gamma catalytic subunitPP1G_MOUSEK.NVQLQENEIR.G    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.NYGADEEAAGALLK.K    
A3888NEGR1, IGLON4, UNQ2433/PRO4993Neuronal growth regulator 1KILO_RATK.PFENGQYLDIYGITR.D    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.PGEDFEHAALVPQPDTSK.T    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATK.QAADM#ILLDDNFASIVTGVEEGR.L    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATK.QAADM#ILLDDNFASIVTGVEEGR.L    
A0215GAP43, B-50/GAP43NeuromodulinNEUM_RATK.QADVPAAVTDAAATT*PAAEDAAK.A   modifications: phosphorylated
A0215GAP43, B-50/GAP43NeuromodulinNEUM_RATK.QADVPAAVTDAAATTPAAEDAAK.A    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.QAEAFLNNQEYVLAHTEM#PTTLEGAEAAIK.K    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.QAEAFLNNQEYVLAHTEMPTTLEGAEAAIK.K    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.QAEAILSNQEYTLAHLEPPDSLAAAEAGIR.K    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATK.QASEQNWANYSAEQNR.M    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.QASHAQLGDAYDQEIR.E    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.QDEVNAAWDR.L    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.QDSFPISLEQAVTDAAM#ATK.T    
A3961MYH10, SmembMyosin-10MYHA_RATK.QELEEILHDLESR.V    
A9029ROGDIProtein ROGDI homolog K.QENFILGSCGTDQVK.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.QETFDAGLQAFQQEGIANITALK.D    
A3961MYH10, SmembMyosin-10MYHA_RATK.QEVMISDLEER.L    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.QEYDESGPSIVHR.K    
A0285BSN, ZNF231Bassoon protein K.QFLNAESAYMDPM#K.Q    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.QGELENYVSDGYK.T    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.QGGSPM#IEGVDDAK.E    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.QGGSPMIEGVDDAK.E    
A269AGPIAP1, CAPRIN1, GPIP137Caprin-1P137_MOUSEK.QGLSGVPILSEEELSLLDEFYK.L    
A562CSTX11Syntaxin 11STXB_MOUSEK.QHSAILAAPNPDEK.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.QHSQTPSTLNPTMPASER.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.QHSQTPSTLNPTMPASER.T    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.QIASLTGLVQSALLR.G    
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_RATK.QIFLGGVDKR.T    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.QITEPSITVPSIGLSAEPLAPK.D    
A4010WDR7, TRAGWD-repeat protein 7 K.QLANITM#GLPLSPAADSAR.S    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.QLGETLTELK.A    
A0219CDH2, CDHN, NCADNeural-cadherin precursorCAD2_RATK.QLLIDPEDDVR.D    
A0252AP2A2, ADTAB, CLAPA2Adapter-related protein complex 2 alpha 2 subunitADAC_RATK.QLSNPQQEVQNIFK.A    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.QLWGLLIEETEK.R    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATK.QNADISAMQDTINK.L    
A0285BSN, ZNF231Bassoon protein K.QNGGPLTPGTSPTQLAAPVSFPTSTSSDSSGGR.V    
A0469CTNND2, NPRAPCatenin delta-2 K.QNQVSTQPVPQEPSR.K    
A0285BSN, ZNF231Bassoon protein K.QPVVYGDPFQSR.L    
A4033DMXL2, RC3DmX-like protein 2 K.QSEVEADLGYPGGK.A    
A3904syn2, SYN2Synapsin-2SYN2_RATK.QTAASAGLVDAPAPSAASR.K    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATK.QTEIAYGTLDSGSTK.E    
A0299GRIA3, GLUR3, GLURCGlutamate receptor 3 precursorGLR3_RATK.QTEIAYGTLDSGSTK.E    
A0161SYN1Synapsin ISYN1_RATK.QTTAAAAATFSEQVGGGSGGAGR.G    
A0467YWHAB14-3-3 protein beta/alpha143B_RATK.QTTVSNSQQAYQEAFEISK.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.QVEELYQSLLELGEK.R    
A0285BSN, ZNF231Bassoon protein K.QVEQAVQTAPYR.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.REELITNWEQIR.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.RLEAELAAHEPAIQGVLDTGK.K    
A1941PLEC1, PLECPlectinPLEC_RATK.RQELEAELAK.V    
A3873ANK2Ankyrin 2ANK2_HUMANK.SAALLLQNDHNADVQSK.M    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.SADESGQALLAAGH.Y    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.SADESGQALLAAGHYASDEVR.E    
A0130NRXN1Neurexin 1-alpha precursor K.SADYVNLALK.N    
A3891NRXN3Neurexin 3-alpha precursor K.SADYVNLALK.N    
A0587ADD2, ADDBBeta adducinADDL_RATK.SAGPQSQLLASVIAEK.S    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.SALPAQSAATLPAR.T    
A0083CTTN, EMS1CortactinSRC8_MOUSEK.SAVGFDYQGK.T    
A0426VDAC2Voltage-dependent anion-selective channel protein 2POR2_RATK.SCSGVEFSTSGSSNTDTGK.V    
A3479VDAC3Voltage-dependent anion-selective channel protein 3 K.SCSGVM#EFSTSGHAYTDTGK.A    
A3961MYH10, SmembMyosin-10MYHA_RATK.SDLLLEGFNNYR.F    
A3590OMG, OMGPOligodendrocyte-myelin glycoprotein precursorOMGP_MOUSEK.SDTAYQWNLK.Y    
A8449PHACTR1, RPEL, RPEL1Phosphatase and actin regulator 1 K.SDTPYLAEAR.I    
A0093PTPRZ1, HTPZP2, PTPRZReceptor-type protein-tyrosine phosphatase zeta precursorPTPZ_RATK.SDVLNTSLNPTSQQVAEFNPER.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SEDLSTGVPKPPAASILHSHSYSDEFGPSGTDFTR.R    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SEDLSTGVPKPPAASILHSHSYSDEFGPSGTDFTR.R    
A4658CEP170, FAM68A, KABCentrosomal protein of 170 kDa K.SEEPSVSLPFLQTALLR.S    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.SEM#EDALTVIAEELAASAK.E    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.SENGLEFTSSGSANTETTK.V    
A3690CKMT1B, CKMT1A, CKMTCreatine kinase U-type, mitochondrialKCRU_RATK.SFLIWVNEEDHTR.V    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.SFYPEEVSSM#VLTK.M    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.SFYPEEVSSMVLTK.M    
A8860PPFIA2Liprin-alpha2 K.SGAIM#SALSDTEIQR.E    
A3873ANK2Ankyrin 2ANK2_HUMANK.SGLTSLHLAAQEDK.V    
A3474CACNA2D1, CACNL2A, CCHL2AVoltage-dependent calcium channel subunit alpha-2/delta-1CIC2_RATK.SGPGAYESGIMVSK.A    
A3990CASKIN1Cask-interacting protein 1 K.SGTALHEAALCGK.T    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.SGTSTPTTPGSTAITPGTPPSYSSR.T    
A0001hNMDAR1-4b, hNMDAR1-3b, GRIN1Glutamate [NMDA] receptor subunit zeta 1 precursorNMZ1_RATK.SHENGFMEDLDK.T    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SIIGSPSLQADAGGGGAAPGPPR.H    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATK.SIVGM#TM#YNQATQEIAKPSELLTSVR.E    
A0014DLG2Disks large homolog 2SP93_RATK.SKDSGLPSQGLSFK.Y    
A9630RPS1340S ribosomal protein S13RS13_HUMANK.SKGLAPDLPEDLYHLIK.K    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 K.SLAESIDDALNCR.S    
A3961MYH10, SmembMyosin-10MYHA_RATK.SLEAEILQLQEELASSER.A    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATK.SLLPDHASDNPFLHTYGDDQR.L    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 K.SLLQGTILQYVK.T    
A3580CYFIP2, PIR121P53 inducible protein K.SLLQGTILQYVK.T    
A0568PCLO, ACZProtein piccolo K.SLNPEWNQTVIYK.S    
A3879ERC2, CAST1, CASTERC protein 2 K.SLQTDSSNTDTALATLEEALSEK.E    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATK.SLSDALISLQM#VYPR.R    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.SM#ILSVLDTSLQR.P    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.SM#TAELEELASIR.R    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.SM#TAELEELVDK.D    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.SNLVISDPIPGAK.P    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 K.SPAPSSDFADAITELEDAFSR.Q    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSEK.SPCDSGYSYETIEK.T    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATK.SPCDSGYSYETIEK.T    
A3520SEPT7, CDC10Septin-7SEP7_RATK.SPLAQMEEER.R    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 K.SPNTAILIK.D    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.SPPCEDFSVTGESEK.K    
A0568PCLO, ACZProtein piccolo K.SPQGLSDTGYSSDGISGSLGEIPSLIPSDEKDLLK.G    
A0285BSN, ZNF231Bassoon protein K.SPQVLYSPVSPLSPHR.L    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSEK.SPSLSPSPPS*PIEK.T   modifications: phosphorylated
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATK.SPYQEFTDHLVK.T    
A0469CTNND2, NPRAPCatenin delta-2 K.SQDQWDGVGPLPDCAEPPK.G    
A3474CACNA2D1, CACNL2A, CCHL2AVoltage-dependent calcium channel subunit alpha-2/delta-1CIC2_RATK.SQEPVTLDFLDAELENDIK.V    
A0568PCLO, ACZProtein piccolo K.SQESEELVVAGGGGLR.R    
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunit K.SQGEKEM#YTLGITNFPIPGEPGFPLNAIYAK.P    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.SQIHDIVLVGGSTR.I    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SQQLTVSAAQKPR.P    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SQQLTVSAAQKPR.P    
A0350MBPMyelin basic protein K.SQRTQDENPVVHFFK.N    
A3904syn2, SYN2Synapsin-2SYN2_RATK.SQSLTNAFSFSESSFFR.S    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 K.SSDSDVSDVSAISR.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.SSEEIESAFR.A    
A3290ARPC5L, ARC16-2Actin-related protein 2/3 complex subunit 5-like protein K.SSEIEQAVQSLDR.N    
A016ANOMO1, PM5Nodal modulator 1PM5P_HUMANK.SSIDSEPALVLGPLK.S    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.SSLLLDTVTSIPSSR.T    
A0568PCLO, ACZProtein piccolo K.SSM#M#PGFFSDVNPLSAVSSVVNK.F    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 K.SSSLSIPHEPK.E    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 K.SSSPASPENYVHPLTGR.L    
A3519SEPT6, SEP2Septin 6 K.STLM#DTLFNTK.F    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.STQYQDLLQDLSEK.V    
A0238STXBP1, UNC18A, stxbp1Syntaxin binding protein 1STB1_RATK.SVHSLISDFKDPPTAK.Y    
A3531KTN1, CG1, PDIA6Kinectin K.SVLAETEGILQK.L    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.SVNESLNNLFITEEDYQALR.T    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.SVPSEAVVAESSTGLPPVADDSQPVKPDSQLEDM#GYCVFNK.Y    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SVSM#LDLQGDGPGGR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SVSM#LDLQGDGPGGR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SVSMLDLQGDGPGGR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.SVSMLDLQGDGPGGR.L    
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.SYELPDGQVITIGNER.F    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.SYELPDGQVITIGNER.F    
A4552ACTG1, ACTGActin, cytoplasmic 2 K.SYELPDGQVITIGNER.F    
A3506DCAMKL1, DCLK1, DCDC3ASerine/threonine-protein kinase DCAMKL1 K.TAHSFEQVLTDITDAIK.L    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.TALINADELPTDVASGEALLAR.H    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.TATDEAYKDPSNLQGK.V    
A0757CNTN1Contactin-1 precursor K.TDGAAPNVAPSDVGGGGGTNR.E    
A3693CKB, CKBBCreatine kinase B-typeKCRB_RATK.TDLNPDNLQGGDDLDPNYVLSSR.V    
A3580CYFIP2, PIR121P53 inducible protein K.TDVFQSLR.E    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.TELEDTLDSTAAQQELR.S    
A3961MYH10, SmembMyosin-10MYHA_RATK.TELEDTLDTTAAQQELR.T    
A0276CIT, CRIK, STK21Citron protein K.TELEETTAEAEEEIQALTAHR.D    
A0104HOMER1, SYN47Homer protein homolog 1 K.TELSQTVQELEETLK.V    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.TENTGVELDDVWELQK.K    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.TEQSVALLEQK.W    
A1941PLEC1, PLECPlectinPLEC_RATK.TEVVETTQVYTEEETR.R    
A9632RPS15, RIG40S ribosomal protein S15RS15_HUMANK.TFNQVEIKPEM#IGHYLGEFSITYKPVK.H    
A0560UNC13AProtein unc-13 homolog A K.TGSSDPYVTVQVGK.T    
A5224TPM4Tropomyosin alpha 4 chain K.TIDDLEDKLK.C    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.TIGGGDDSFNTFFSETGAGK.H    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.TIGGGDDSFTTFFCETGAGK.H    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 K.TIMEQFNPSLR.N    
A0560UNC13AProtein unc-13 homolog A K.TISNVLLQYADIVSK.D    
A1256UBBPolyubiquitin-B K.TITLEVEPSDTIENVK.A    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.TKSENGLEFTSSGSANTETTK.V    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 K.TLDPLYQQSLVFDESPQGK.V    
A3874ANK3Ankyrin 3 K.TLEQQENFEEVAR.S    
A0212RPH3ARabphilin-3ARP3A_RATK.TLNPEFNEEFFYDIK.H    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.TLNPVFNEQFTFK.V    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.TLVM#AVYDFDR.F    
A3531KTN1, CG1, PDIA6Kinectin K.TM#M#FSEDEALCVVDLLK.E    
A0161SYN1Synapsin ISYN1_RATK.TNTGSAM#LEQIAM#SDR.Y    
A3904syn2, SYN2Synapsin-2SYN2_RATK.TNTGSAM#LEQIAM#SDR.Y    
A0161SYN1Synapsin ISYN1_RATK.TNTGSAM#LEQIAMSDR.Y    
A3904syn2, SYN2Synapsin-2SYN2_RATK.TNTGSAM#LEQIAMSDR.Y    
A0161SYN1Synapsin ISYN1_RATK.TNTGSAMLEQIAM#SDR.Y    
A3904syn2, SYN2Synapsin-2SYN2_RATK.TNTGSAMLEQIAM#SDR.Y    
A0161SYN1Synapsin ISYN1_RATK.TNTGSAMLEQIAMSDR.Y    
A3904syn2, SYN2Synapsin-2SYN2_RATK.TNTGSAMLEQIAMSDR.Y    
A0101MLLT4, AF6AF-6 protein K.TPAAVLPTPVAVSQPIR.T    
A3896ASTN1, ASTNAstrotactin 1ACN1_MOUSEK.TPCPVVDDVK.A    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATK.TPEDGGYSCEITEK.T    
A3990CASKIN1Cask-interacting protein 1 K.TPLDLACEFGR.V    
A0285BSN, ZNF231Bassoon protein K.TPPSNLSPIEDAS*PTEELR.Q   modifications: phosphorylated
A0285BSN, ZNF231Bassoon protein K.TPPSNLSPIEDASPTEELR.Q    
A0568PCLO, ACZProtein piccolo K.TPPSNLSPIEDASPTEELR.Q    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.TQLEELEDELQATEDAK.L    
A3961MYH10, SmembMyosin-10MYHA_RATK.TQLEELEDELQATEDAK.L    
A0352PLP1, PLPMyelin proteolipid proteinMYPR_HUMANK.TSASIGSLCADAR.M    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform K.TSCEFTGDILR.T    
A243DCTTNBP2, CORTBP2Cortactin-binding protein 2 K.TSELEDQLSAEK.Q    
A0214KALRN, DUET, DUOKalirinHAPP_RATK.TSEQVCSVLESLEQEYR.R    
A3807RPLP060S acidic ribosomal protein P0RLA0_RATK.TSFFQALGITTK.I    
A0095DNM1, DNMDynamin-1DYN1_RATK.TSGNQDEILVIR.K    
A0447DLGAP2, DAP2Disks large-associated protein 2 K.TSPTVALRPEPLLK.S    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.TTATSGESAQAPSAFK.Q    
A0276CIT, CRIK, STK21Citron protein K.TTCTM#LEEQVM#DLEALNDELLEK.E    
A3817RPS3A, FTE1, MFTL40S ribosomal protein S3ARS3A_RATK.TTDGYLLR.L    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.TTEQLIEAVNNGDFEAYAK.I    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATK.TTGIVETHFTFK.N    
A3961MYH10, SmembMyosin-10MYHA_RATK.TTLQVDTLNTELAAER.S    
A4010WDR7, TRAGWD-repeat protein 7 K.TTTCISLQDAFDK.L    
A4370PPIB, CYPBPeptidyl-prolyl cis-trans isomerase B precursorCYPB_RATK.TVDNFVALATGEK.G    
A3690CKMT1B, CKMT1A, CKMTCreatine kinase U-type, mitochondrialKCRU_RATK.TVGM#VAGDEETYEVFAELFDPVIQER.H    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSEK.TVTNAVVTVPAYFNDSQR.Q    
A0161SYN1Synapsin ISYN1_RATK.TYATAEPFIDAK.Y    
A3904syn2, SYN2Synapsin-2SYN2_RATK.TYATAEPFIDAK.Y    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.TYHDLCDGSANQLQQLQSELAQQTEQK.T    
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATK.TYSYLTPDLWK.E    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANK.TYVVTGNM#GSNDKVGDFVATDLDTGRPSTTVR.Y    
A0438DBN1, D0S117EDrebrinDREB_RATK.VAAAPQVWAGCAEEPPR.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.VAEDLESEGLM#AEEVQAVQQQEVYGM#M#PR.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.VAEDLESEGLMAEEVQAVQQQEVYGM#M#PR.D    
A1941PLEC1, PLECPlectinPLEC_RATK.VALEEVER.L    
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor K.VALIGSPVDLTYR.Y    
A3874ANK3Ankyrin 3 K.VALLLLDQGASPHAAAK.N    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATK.VAQTDGVNVEM#HLK.Q    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.VAVVEQDLIIHQK.D    
A3961MYH10, SmembMyosin-10MYHA_RATK.VDDDLGTIEGLEEAK.K    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.VDDLLIIEEK.I    
A0083CTTN, EMS1CortactinSRC8_MOUSEK.VDKSAVGFEYQGK.T    
A0161SYN1Synapsin ISYN1_RATK.VDNQHDFQDIASVVALTK.T    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATK.VDNSSLTGESEPQTR.S    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATK.VDNSSLTGESEPQTR.S    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte K.VEADDHQGFVPAVYVR.K    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.VEAQLQELQVK.F    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.VEDEKSEM#EDALTVIAEELAASAK.E    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.VEPAVIEAQNAVK.S    
A0161SYN1Synapsin ISYN1_RATK.VEQAEFSDLNLVAH.A    
A0161SYN1Synapsin ISYN1_RATK.VEQAEFSDLNLVAHANGGF.S    
A177CMYO5C, HSPC089Unconventional myosin-VcMY5C_HUMANK.VEYKCEGFLEK.N    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATK.VFASTGYGIAIQK.D    
A0510PPP1R9ANeurabin-INEB1_RATK.VFNTYSNEDYDR.R    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.VFVGYNSTGAELR.H    
A0292INA, NEF5Alpha-internexinAINX_RATK.VGESFEETLEETVVSTK.K    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.VGINYQPPTVVPGGDLAK.V    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.VGINYQPPTVVPGGDLAK.V    
A0285BSN, ZNF231Bassoon protein K.VGSSM#RPSLEAQAVAPSGEWSKPPSGSAVEDQK.R    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.VGYTPDWIFLLR.N    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.VHYLEQQNK.E    
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitTCPD_MOUSEK.VIDPATATSVDLR.D    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.VIEGQTDPDYQLLGQR.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.VIESTQDLGNDLAGVM#ALQR.K    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.VIESTQDLGNDLAGVMALQR.K    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATK.VIQCFAETGQVQK.I    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.VIQNLANFSK.F    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.VIQNLANFSK.F    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.VIQYLAHVASSHK.S    
A3961MYH10, SmembMyosin-10MYHA_RATK.VIQYLAHVASSHK.S    
A3865EPB41L3, DAL1Band 4.1-like protein 3 K.VISQTNLITTVTPEK.K    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.VKDLLGWVSTLAR.N    
A0161SYN1Synapsin ISYN1_RATK.VKVDNQHDFQDIASVVALTK.T    
A1941PLEC1, PLECPlectinPLEC_RATK.VLALPEPSPAAPTLR.S    
A2341ACTN1Alpha-actinin 1AAC1_RATK.VLAVNQENEQLM#EDYEK.L    
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6MLES_RATK.VLDFEHFLPM#LQTVAK.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.VLDNAIETEK.M    
A0757CNTN1Contactin-1 precursor K.VLEPM#PTTAEISTSGAVLK.I    
A0757CNTN1Contactin-1 precursor K.VLEPMPTTAEISTSGAVLK.I    
A9540RPL1160S ribosomal protein L11RL11_HUMANK.VLEQLTGQTPVFSK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.VLETAEDIQER.R    
A3551PDE2AcGMP-dependent 3',5'-cyclic phosphodiesteraseCN2A_RATK.VLGEEVSFPLTMGR.L    
A3883PALMParalemmin-1 K.VLGLQDTIK.A    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 K.VLIIFNAPSLQDR.L    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 K.VLINFNAPNPQDR.K    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.VLLLHLEEGK.D    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.VLLLSQDYGK.H    
A3904syn2, SYN2Synapsin-2SYN2_RATK.VLLVVDEPHTDWAK.C    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATK.VLNLYTPVNEFEER.V    
A1094AGER, RAGEAdvanced glycosylation end product-specific receptor precursorRAGE_RATK.VLSPQGDPWDSVAR.I    
A0568PCLO, ACZProtein piccolo K.VLYSPISPLSPGNALEPAFVPYEKPLPDDISPQK.V    
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CTOG_HUMANK.VNDFLAEIFK.K    
A3876ADD1, ADDAAlpha adducinADDA_RATK.VNLQGDIVDR.G    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.VNNSSLIGLGYTQTLKPGIK.L    
A0426VDAC2Voltage-dependent anion-selective channel protein 2POR2_RATK.VNNSSLIGVGYTQTLRPGVK.L    
A3873ANK2Ankyrin 2ANK2_HUMANK.VNVADILTK.H    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATK.VPEAGESLATR.D    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSEK.VPEGGEGISATEVDSR.W    
A5337FXR1Fragile X mental retardation syndrome related protein 1 K.VPGVTAIELDEDTGTFR.I    
A0039SYT1, SVP65, SYTSynaptotagmin ISYT1_RATK.VPM#NTVDFGHVTEEWR.D    
A0095DNM1, DNMDynamin-1DYN1_RATK.VPVGDQPPDIEFQIR.D    
A0560UNC13AProtein unc-13 homolog A K.VQELQSPPR.A    
A0560UNC13AProtein unc-13 homolog A K.VQELQSPPR.A    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATK.VQGLTVEQAEAVAR.L    
A1941PLEC1, PLECPlectinPLEC_RATK.VQSGSESVIQEYVDLR.T    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATK.VQSLQDEVAFLR.S    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.VSDFGQM#ASGM#SVDAGK.T    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.VSDFGQMASGM#SVDAGK.T    
A5190TUBB2BTubulin beta-2B chainTBB1_RATK.VSDTVVEPYNATLSVHQLVEN.T    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain K.VSDTVVEPYNATLSVHQLVEN.T    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSEK.VSDTVVEPYNATLSVHQLVEN.T    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.VSEEAESQQWDTSK.G    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATK.VSHLLGINVTDFTR.G    
A0568PCLO, ACZProtein piccolo K.VSLQQSPLVM#SSVVEK.G    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.VTEQLIEAISNGDFESYTK.M    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.VTGGQTTQVETSSESPFPAK.E    
A3871SYNPOSynaptopodin K.VTPNPDLLDLVQTADEK.R    
A0757CNTN1Contactin-1 precursor K.VTVTNPDTGR.Y    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.VVNSHCVFPR.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP K.VVNSHCVFPR.E    
A3961MYH10, SmembMyosin-10MYHA_RATK.VVSSVLQFGNISFK.K    
A0662hANK1, ANK1, ANKAnkyrin 1ANK1_MOUSEK.VVTDETSVVLVSDK.H    
A3873ANK2Ankyrin 2ANK2_HUMANK.VVTEEVTTTTTTITEK.H    
A0235ACTR2, ARP2Actin-like protein 2ARP2_HUMANK.VVVCDNGTGFVK.C    
A1074TNRTenascin-R K.VVYSTLAGEQYHEVLVPK.G    
A9546RPL1960S ribosomal protein L19RL19_HUMANK.VWLDPNETNEIANANSR.Q    
A3463LPHN3, LEC3Latrophilin-3 precursor K.VYLADPVVFTVK.H    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.VYNEAGVTFT.-    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 K.VYQFDQSFNPQGAVEVK.A    
A0560UNC13AProtein unc-13 homolog A K.VYYDETAQEIVDEFAM#R.Y    
A0560UNC13AProtein unc-13 homolog A K.VYYDETAQEIVDEFAM#R.Y    
A6296DGKB, DAGK2Diacylglycerol kinase, betaKDGB_RATK.WAHLSPSEFSQLQK.Y    
A0426VDAC2Voltage-dependent anion-selective channel protein 2POR2_RATK.WCEYGLTFTEK.W    
A1914CTNNA2, CAPRCatenin alpha-2CTN2_MOUSEK.WDDSGNDIIVLAK.Q    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATK.WGDAGAEYVVESTGVFTTM#EK.A    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATK.WGDAGAEYVVESTGVFTTMEK.A    
A0440LGI1, EPT, UNQ775/PRO1569Leucine-rich glioma-inactivated protein 1 precursor K.WGGSSFQDIQR.M    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.WLDQM#DIPNTLEDLEVVQHR.F    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATK.WLNVHYHCSGAPAAPLQ.-    
A0560UNC13AProtein unc-13 homolog A K.WLYNEYVAELPTFK.D    
A3479VDAC3Voltage-dependent anion-selective channel protein 3 K.WNTDNTLGTEISWENK.L    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.WNTDNTLGTEITVEDQLAR.G    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATK.WQIVHFHR.S    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATK.WQNVHFHCSGAPVAPLQ.-    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSEK.WVNSHLAR.V    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSEK.WVNSHLAR.V    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 K.YAPLHLVPLIER.L    
A3580CYFIP2, PIR121P53 inducible protein K.YAPLHLVPLIER.L    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATK.YAYFNGCSSPTAPLSPM#SPPGYK.L    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATK.YAYFNGCSSPTAPLSPMSPPGYK.L    
A0120SYNJ1Synaptojanin 1SYJ1_RATK.YDLFSEDYDTSEK.C    
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitAR34_HUMANK.YFQFQEEGK.E    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 K.YGGSFLSR.R    
A0285BSN, ZNF231Bassoon protein K.YGLALDPVPGR.Q    
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunitPP1A_HUMANK.YGQFSGLNPGGR.P    
A1948MGST3Microsomal glutathione S-transferase 3 K.YKVEYPVM#YSTD.P    
A0350MBPMyelin basic protein K.YLATASTM#DHAR.H    
A0350MBPMyelin basic protein K.YLATASTMDHAR.H    
A075ARAC2, GOXRas-related C3 botulinum toxin substrate 2 precursorRAC2_BOVINK.YLECSALTQR.G    
A0285BSN, ZNF231Bassoon protein K.YLELGITQR.K    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSEK.YM#ACCLLYR.G    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANK.YM#ACCLLYR.G    
A943BDYNLL2, DLC2, Dlc2Dynein light chain 2, cytoplasmic K.YNIEKDIAAYIK.K    
A943BDYNLL2, DLC2, Dlc2Dynein light chain 2, cytoplasmic K.YNIEKDIAAYIKK.E    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATK.YNLGLDLR.T    
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.YPIEHGIITNWDDMEK.I    
A3474CACNA2D1, CACNL2A, CCHL2AVoltage-dependent calcium channel subunit alpha-2/delta-1CIC2_RATK.YQDLYTVEPNNAR.Q    
A3580CYFIP2, PIR121P53 inducible protein K.YQILNNEVFAILNK.Y    
A0426VDAC2Voltage-dependent anion-selective channel protein 2POR2_RATK.YQLDPTASISAK.V    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 K.YQVDPDACFSAK.V    
A5216TMOD1, D9S57E, TMODTropomodulin 1 K.YRDLDEDEILGALTEEELR.T    
A3376MAP6Microtubule-associated protein 6 K.YSEATEHPGAPPQPPAPPQPGLAPPSR.A    
A3557OLFM1, NOE1, NOEL1Noelin precursorNOMR_RATK.YSHISMLDYNPK.D    
A3463LPHN3, LEC3Latrophilin-3 precursor K.YSLDFGPLDSR.S    
A3965TPM1, TMSATropomyosin 1 alpha chainTPMY_RATK.YSQKEDKYEEEIK.V    
A5224TPM4Tropomyosin alpha 4 chain K.YSQKEDKYEEEIK.V    
A9636RPS18, D6S218E40S ribosomal protein S18RS18_HUMANK.YSQVLANGLDNK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain K.YTEHSTVGLAQQWDQLDQLGM#R.M    
A0299GRIA3, GLUR3, GLURCGlutamate receptor 3 precursorGLR3_RATK.YTSALTHDAILVIAEAFR.Y    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATK.YTSALTYDAVQVMTEAFR.N    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATK.YTVPLPSPVQDSENLSGESGSFYEGTDDK.V    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSEK.YYITIIDAPGHR.D    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRK.YYVTIIDAPGHR.D    
A200CNDUFA8NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 M.PGIVELPTLEELKVEEVK.V    
A3825KRT24, KA24Keratin, type I cytoskeletal 24 M.QGSSGGDVTVEM#NAAPGVDLTKLLNDMR.A    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATN.SVGLEDVMHEDAVAALK.N    
A1941PLEC1, PLECPlectinPLEC_RATN.THENLTYLQLLER.C    
A4552ACTG1, ACTGActin, cytoplasmic 2 N.TVLSGGTTM#YPGLADR.M    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 P.APSSDFADAITELEDAFSR.Q    
A0350MBPMyelin basic protein Q.DENPVVHFFK.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain Q.QYFADANEAESWM#R.E    
A179CMYO7BMyosin VIIB Q.VLEANPILEAFGNAK.T    
A0285BSN, ZNF231Bassoon protein R.AACPLCQAELNVGSR.G    
A0238STXBP1, UNC18A, stxbp1Syntaxin binding protein 1STB1_RATR.AAHVFFTDSCPDALFNELVK.S    
A1074TNRTenascin-R R.AAIENYVLTYK.S    
A3879ERC2, CAST1, CASTERC protein 2 R.AAILQTEVDALR.L    
A1941PLEC1, PLECPlectinPLEC_RATR.AALAHSEEIATSQAAATK.A    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.AALAVGSPGPVGGSFAR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.AALLELWELR.R    
A9642RPS2540S ribosomal protein S25RS25_HUMANR.AALQELLSK.G    
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_RATR.AAYFGIYDTAK.G    
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1ADT1_RATR.AAYFGVYDTAK.G    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 R.ACLDDSYASGEGLK.R    
A9655RPSA, LAMBR, LAMR140S ribosomal protein SARSP4_RATR.ADHQPLTEASYVNLPTIALCNTDSPLR.Y    
A1941PLEC1, PLECPlectinPLEC_RATR.AEM#EVLLASK.A    
A3339ACTR3B, ARP4, ARP3BETAActin-related protein 3B R.AEPEDHYFLM#TEPPLNTPENR.E    
A3339ACTR3B, ARP4, ARP3BETAActin-related protein 3B R.AEPEDHYFLMTEPPLNTPENR.E    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.AFEDEMSGR.S    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.AFPAYYTSHVQEEQSEVEETIEATK.A    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.AFVHWYVGEGM#EEGEFSEAR.E    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.AFVHWYVGEGM#EEGEFSEAR.E    
A3807RPLP060S acidic ribosomal protein P0RLA0_RATR.AGAIAPCEVTVPAQNTGLGPEK.T    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.AGDEVLEWNGKPLPGATNEEVYNIILESK.S    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.AGQVAYLEK.L    
A177CMYO5C, HSPC089Unconventional myosin-VcMY5C_HUMANR.AGQVAYLEK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.AGTFQAFEQFGQQLLAHGHYASPEIK.E    
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GBB2_RATR.AGVLAGHDNR.V    
A3961MYH10, SmembMyosin-10MYHA_RATR.AGVLAHLEEER.D    
A3811RPL7A, SURF-3, SURF360S ribosomal protein L7aRL7A_HUMANR.AGVNTVTTLVENK.K    
A0147PPP1CA, PPP1ASerine/threonine protein phosphatase PP1-alpha 1 catalytic subunitPP1A_HUMANR.AHQVVEDGYEFFAK.R    
A4042PPP1CCSerine/threonine protein phosphatase PP1-gamma catalytic subunitPP1G_MOUSER.AHQVVEDGYEFFAK.R    
A0757CNTN1Contactin-1 precursor R.AHSDGGDGVVSQVK.I    
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseCN37_RATR.AHVTLGCAADVQPVQTGLDLLEILQQVK.G    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.AIAELGIYPAVDPLDSTSR.I    
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1 R.AIGEDFVLLK.E    
A3514AGAP2, CENTG1ARF-GAP with GTPase, ANK repeat and PH domain-containing protein 2Y167_HUMANR.AISAFGPSASINGLVK.D    
A9552RPL2460S ribosomal protein L24RL24_HUMANR.AITGASLADIMAK.R    
A9655RPSA, LAMBR, LAMR140S ribosomal protein SARSP4_RATR.AIVAIENPADVSVISSR.N    
A1324AP3D1, PRO0039Adapter-related protein complex 3 delta 1 subunit R.ALDIDLDKPLADSEK.L    
A0292INA, NEF5Alpha-internexinAINX_RATR.ALEAELAALR.Q    
A3961MYH10, SmembMyosin-10MYHA_RATR.ALEEALEAK.E    
A3961MYH10, SmembMyosin-10MYHA_RATR.ALELDPNLYR.I    
A3961MYH10, SmembMyosin-10MYHA_RATR.ALEQQVEEMR.T    
A5462SKTSickle tail protein homolog R.ALFVSAFPQQLTM#K.M    
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevican R.ALGAHLTSICTPEEQDFVNDR.Y    
A4049MYL6, MLC3nm, LC17AMyosin light polypeptide 6MLES_RATR.ALGQNPTNAEVLK.V    
A0454DSPDesmoplakin R.ALLQAILQTEDM#LK.V    
A1941PLEC1, PLECPlectinPLEC_RATR.ALQALDELK.L    
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor R.ALSEIAGITLPYDTLDQVR.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.ALSSEGKPYVTK.E    
A3514AGAP2, CENTG1ARF-GAP with GTPase, ANK repeat and PH domain-containing protein 2Y167_HUMANR.ALSTDCTPSGDLSPLSR.E    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.ALTVPELTQQM#FDAK.N    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.ALTVPELTQQM#FDAK.N    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.ALTVPELTQQVFDAK.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.ALVADSHPESER.I    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.ALYESEENCEVDPIK.C    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.ALYESEENCEVDPIK.C    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATR.AM#DTLGVEYGDK.E    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATR.AMDTLGVEYGDKER.K    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.ANDDLLSEFPDK.F    
A0568PCLO, ACZProtein piccolo R.APFQYSEGFTTK.G    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.APSPVVSPTELSK.E    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.APSTTLTLR.S    
A1525TNC, HXBTenascin precursor R.APTAQVESFR.I    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.AQLADSFHLQQFFR.D    
A0374NEFH, NFHNeurofilament heavy polypeptide R.AQLEGHTVQSTLQSEEWFR.V    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.AQSLLSAGHPEGEQIIR.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.AQTLPTSVVTITSESSPGK.R    
A3873ANK2Ankyrin 2ANK2_HUMANR.AREEQTPLHIASR.L    
A3990CASKIN1Cask-interacting protein 1 R.ASDLAGSVDTGSAGSVK.S    
A3892NCAN, CSPG3, NEURNeurocan core protein precursorPGCN_RATR.ASDSGLYR.C    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta R.ASLLDQALPNDVLFSSTYPSLPK.S    
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_RATR.ASLYPCPETPQER.K    
A0285BSN, ZNF231Bassoon protein R.ASQPAADGTPAGLGATVYEEILQTSQSIAR.M    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATR.ASSLNENVDHSALLK.L    
A0161SYN1Synapsin ISYN1_RATR.ASTAAPVASPAAPSPGSSGGGGFFSSLSNAVK.Q    
A0285BSN, ZNF231Bassoon protein R.ATAEFSTQTPSLTPSSDIPR.S    
A4431CACNB1, CACNLB1Dihydropyridine-sensitive L-type, calcium channel beta-1 subunitCCBA_RATR.ATGEHASVHEYPGELGQPPGLYPSNHPPGR.A    
A0757CNTN1Contactin-1 precursor R.ATSVALTWSR.G    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.ATVSPSTDETPAGTLPGGSFSHSALSVDR.K    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.AVATQGAFNSWDWVTR.Y    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.AVCM#LSNTTAIAEAWAR.L    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.AVCM#LSNTTAIAEAWAR.L    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA R.AVEELLESLDLEK.S    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATR.AVFQANQENLPILK.R    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.AVFVDLEPTVIDEVR.T    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 R.AVGPSSTQLYMVR.T    
A3580CYFIP2, PIR121P53 inducible protein R.AVGPSSTQLYMVR.T    
A3812RPL860S ribosomal protein L8RL8_HUMANR.AVVGVVAGGGR.I    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.AWESLEEAEYQR.E    
A0052GNAZGuanine nucleotide-binding protein G(z), alpha subunitGBAZ_RATR.AYDAVQLFALTGPAESK.G    
A0568PCLO, ACZProtein piccolo R.AYLQGVAEDR.D    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.CACGLDQSCIDPALHCNCDADQPQWR.T    
A3893HAPLN1, CRTL1Hyaluronan and proteoglycan link protein 1PLK_RATR.CDAGWLADGSVR.Y    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.CFPAASDVNSVYER.Q    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSER.CHEFVTFECPGAGK.G    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATR.CNGVLEGIR.I    
A3961MYH10, SmembMyosin-10MYHA_RATR.CNGVLEGIR.I    
A1074TNRTenascin-R R.CPT*DCS*S*RGLCVDGECVCEEPYTGEDCR.E   modifications: phosphorylated
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.CYQSWDDFICYCELTGYK.G    
A0285BSN, ZNF231Bassoon protein R.DACEPESGPDPSTVR.R    
A1941PLEC1, PLECPlectinPLEC_RATR.DALDGPSM#EAEPEYTFEGLR.Q    
A1941PLEC1, PLECPlectinPLEC_RATR.DALDGPSMEAEPEYTFEGLR.Q    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.DASVAEAWLIAQEPYLASR.D    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.DASVAEAWLLGQEPYLSSR.E    
A0233ARPC2, ARC34, PRO2446ARP2/3 complex 34 kDa subunitAR34_HUMANR.DDETM#YVESK.K    
A1074TNRTenascin-R R.DEEEEM#M#EVLLDATK.R    
A3961MYH10, SmembMyosin-10MYHA_RATR.DELADEIANSASGK.S    
A0560UNC13AProtein unc-13 homolog A R.DFLHGALER.D    
A0560UNC13AProtein unc-13 homolog A R.DFLHGALER.D    
A0016DLG3Discs, large homolog 3SP02_RATR.DFPGLSDDYYGAK.N    
A3882LASP1, MLN50LIM and SH3 domain protein 1 R.DGDYIVNVQPIDDGWM#YGTVQR.T    
A0757CNTN1Contactin-1 precursor R.DGEYVVEVR.A    
A9704DLGAP4, DAP4, SAPAP4Disks large-associated protein 4 R.DGFSTLQFPR.G    
A1074TNRTenascin-R R.DGQEAVFAYYDK.F    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.DHEGFGFVLR.G    
A0161SYN1Synapsin ISYN1_RATR.DHIIEVVGSSM#PLIGDHQDEDK.Q    
A0161SYN1Synapsin ISYN1_RATR.DHIIEVVGSSMPLIGDHQDEDK.Q    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.DHPAM#AEPLPEPK.K    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.DHPAMAEPLPEPK.K    
A3506DCAMKL1, DCLK1, DCDC3ASerine/threonine-protein kinase DCAMKL1 R.DIKPENLLVYEHQDGSK.S    
A9642RPS2540S ribosomal protein S25RS25_HUMANR.DKLNNLVLFDK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DLASVQALLR.K    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.DLATDLSLIEVK.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.DLDDFQSWLSR.T    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.DLEDETLWVEER.L    
A0663NFASCNeurofascin precursor R.DLELTDLAER.S    
A296DDIP2BDISCO-interacting protein 2 homolog B R.DLGQIEENDLVR.K    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.DLKPENLLLASK.L    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.DLKPENLLLASK.L    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATR.DLKPENLLLASK.L    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATR.DLKPENLLLASK.L    
A3879ERC2, CAST1, CASTERC protein 2 R.DLNHLLQQESGNR.G    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.DLNSSIDLQSFM#AR.G    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.DLNSSIDLQSFM#AR.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DLSSVQTLLTK.Q    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DLTGVQNLR.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DLTSWVTEM#K.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DLTSWVTEMK.A    
A1074TNRTenascin-R R.DNDVAVTNCAMSYK.G    
A3463LPHN3, LEC3Latrophilin-3 precursor R.DNLLYVWNNYHVVK.Y    
A0568PCLO, ACZProtein piccolo R.DNNGYSDPFVK.V    
A0285BSN, ZNF231Bassoon protein R.DPEPPEPLTFR.A    
A1941PLEC1, PLECPlectinPLEC_RATR.DPYSGQSVSLFQALK.K    
A1941PLEC1, PLECPlectinPLEC_RATR.DPYTEQPISLFQAM#K.K    
A3888NEGR1, IGLON4, UNQ2433/PRO4993Neuronal growth regulator 1KILO_RATR.DQAGEYECSAENDVSFPDVK.K    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.DQNLPQILEESR.S    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.DQNTVETLQR.M    
A3886OPCML, IGLON1, OBCAMOpioid binding protein/cell adhesion molecule precursorOPCM_RATR.DQSGEYECSALNDVAAPDVR.K    
A0285BSN, ZNF231Bassoon protein R.DSAVDLSSLK.H    
A595D Leucine-rich repeat and WD repeat-containing protein KIAA1239 R.DSPITVSDSSESNEATPSK.K    
A1941PLEC1, PLECPlectinPLEC_RATR.DSQDAGGFGPEDR.L    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.DTDLQQTQATEPR.D    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DTEQVDNWM#SK.Q    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DTEQVDNWMSK.Q    
A0350MBPMyelin basic protein R.DTGILDSIGR.F    
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorNUHM_RATR.DTPENNPDTPFDFTPENYER.I    
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_RATR.DTTSLNQAALYR.L    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATR.DVAGDASESALLK.C    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DVDEIEAWISEK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DVDETIGWIK.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.DVEDEETWIR.E    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte R.DVNEAIQWMEEK.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.DVSSVELLLK.Y    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.DVSSVELLM#NNHQGIK.A    
A0014DLG2Disks large homolog 2SP93_RATR.DYHFVISR.E    
A0285BSN, ZNF231Bassoon protein R.DYLSDSELNQLR.L    
A8006TNIK, AD 2, AD2TRAF2 and NCK interacting protein kinase R.DYLVSLQHQR.Q    
A3530ARHGAP39Hypothetical protein R.DYSADGQLLHYR.T    
A4010WDR7, TRAGWD-repeat protein 7 R.EAAQALLLAELR.R    
A0447DLGAP2, DAP2Disks large-associated protein 2 R.EAEENDLSEEILGK.I    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.EAFLNTEDKGDSLDSVEALIK.K    
A0086TJP1, ZO1Tight junction protein ZO-1ZO1_MOUSER.EAGFLRPVTIFGPIADVAR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.EANELQQWINEK.E    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATR.EAYPGDVFYLHSR.L    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATR.EDITEPAICALR.H    
A0086TJP1, ZO1Tight junction protein ZO-1ZO1_MOUSER.EEAVLFLLDLPK.G    
A0001hNMDAR1-4b, hNMDAR1-3b, GRIN1Glutamate [NMDA] receptor subunit zeta 1 precursorNMZ1_RATR.EEGQLQLCSR.H    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.EELITNWEQIR.T    
A0285BSN, ZNF231Bassoon protein R.EEPLSTTAPPAVIK.E    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.EFDEIELAYR.R    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.EGEGGAGAPDSSSFSPK.V    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.EGNDLYHEMIESGVINLK.D    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRR.EHALLAYTLGVK.Q    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSER.EHALLAYTLGVK.Q    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.EIQGLFEEDIADK.S    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.EKDVLEDIPR.W    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.EKEPIVGSTDYGK.D    
A0510PPP1R9ANeurabin-INEB1_RATR.EKPGQVSEVAQLISQTLEQER.R    
A0285BSN, ZNF231Bassoon protein R.EKPLSGGDGEVGPPQPSR.G    
A3816RPS340S ribosomal protein S3RS3_MOUSER.ELAEDGYSGVEVR.V    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.ELAGHTGYLSCCR.F    
A3961MYH10, SmembMyosin-10MYHA_RATR.ELDDATEANEGLSR.E    
A3873ANK2Ankyrin 2ANK2_HUMANR.ELDFTEEQIHQIR.I    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATR.ELEDATETADAMNR.E    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.ELENHFLGGGEAGAQGEAGGPLSSTSK.A    
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_RATR.ELETQISELQEDLESER.A    
A3580CYFIP2, PIR121P53 inducible protein R.ELFDLALR.G    
A3892NCAN, CSPG3, NEURNeurocan core protein precursorPGCN_RATR.ELGGEVFYVGPAR.R    
A3619DDOST, OST48Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit precursor R.ELGSECGIEFDEEK.T    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.ELHLLGVQVQQFQDVATR.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.ELPTAFDYVEFTR.S    
A3961MYH10, SmembMyosin-10MYHA_RATR.ELQAQIAELQEDFESEK.A    
A0757CNTN1Contactin-1 precursor R.ELTITWAPLSR.E    
A8753DOCK3, MOCADedicator of cytokinesis protein 3 R.ELVEVSPLENAIQVVENK.N    
A3904syn2, SYN2Synapsin-2SYN2_RATR.EM#LTLPTFPVVVK.I    
A0333SNAP25, SNAPSynaptosomal-associated protein 25SN25_HUMANR.ENEM#DENLEQVSGIIGNLR.H    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.ENEVLEAWK.S    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSER.ENLEQAFEVAER.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.ENLLEEQGSIALR.Q    
A3463LPHN3, LEC3Latrophilin-3 precursor R.ENTDNIQLEVAR.L    
A3883PALMParalemmin-1 R.EPAPLNGSAAELPATK.E    
A0469CTNND2, NPRAPCatenin delta-2 R.EPFAPSLGSAFHLPDAPPAAAALYYSSSTLPAPPR.G    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.EQLM#NSSLGSGTASLR.S    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.EQLMNSSLGSGTASLR.S    
A0285BSN, ZNF231Bassoon protein R.EQQDTAESSDDFGSQLR.H    
A3887HNT, NTM, IGLON2Neurotrimin precursorNTRI_RATR.EQSGEYECSASNDVAAPVVR.R    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.EQWANLEQLSAIR.I    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATR.ESSPTYSPGFSDSTSGAK.E    
A2341ACTN1Alpha-actinin 1AAC1_RATR.ETADTDTADQVM#ASFK.I    
A0007ACTN2Alpha-actinin 2AAC2_MOUSER.ETADTDTAEQVIASFR.I    
A3965TPM1, TMSATropomyosin 1 alpha chainTPMY_RATR.ETAEADVASLNR.R    
A0232ARPC3, ARC21ARP2/3 complex 21 kDa subunit R.ETKDTDIVDEANYYFK.A    
A3538CCT4, CCTD, SRBT-complex protein 1, delta subunitTCPD_MOUSER.ETLLNSATTSLNSK.V    
A0273PPP1R9B, PPP1R6Neurabin-2NEB2_RATR.ETQAQYQALER.K    
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevican R.EVAGETGSPELSGVPR.E    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.EVDDLEQWIAER.E    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.EVFLFNDLLVVTK.I    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.EVVAGSHELGQDYEHVTM#LQER.F    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATR.EWTDGLFTHVLR.K    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.EYYSEADASHCIQQILEAVLHCHQMGVVHR.D    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.EYYSEADASHCIQQILEAVLHCHQMGVVHR.D    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.FAAPVQPEEER.R    
A0568PCLO, ACZProtein piccolo R.FAEELEWER.Q    
A0007ACTN2Alpha-actinin 2AAC2_MOUSER.FAIQDISVEETSAK.E    
A2341ACTN1Alpha-actinin 1AAC1_RATR.FAIQDISVEETSAK.E    
A2344ACTN4Alpha-actinin 4AAC4_RATR.FAIQDISVEETSAK.E    
A3561NDUFS1, PRO1304NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor R.FASEIAGVDDLGTTGR.G    
A4870 Intermediate filament protein ON3ION3_CARAUR.FASFIDKVR.F    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.FDGALNVDLTEFQTNLVPYPR.I    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.FDGALNVDLTEFQTNLVPYPR.I    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSER.FEELNADLFR.G    
A8449PHACTR1, RPEL, RPEL1Phosphatase and actin regulator 1 R.FFYSQGAQAR.R    
A0100SORBS1, CAP, SH3P12Sorbin and SH3 domain containing 1 R.FGDLLNIDDTAK.R    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.FGDVLHVIDAGDEEWWQAR.R    
A0022GRIK2, GLUR6Glutamate receptor, ionotropic kainate 2 precursorGLK2_RATR.FGGIFEYVESGPMGAEELAFR.F    
A7395PIP4K2B, PIP5K2BPhosphatidylinositol-4-phosphate 5-kinase type II beta R.FGIDDQDYQNSVTR.S    
A3528RAPGEF4, CGEF2, EPAC2RAP guanine nucleotide exchange factor 4 R.FLDDEHEDAPLPTEEEK.K    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.FLDLLEPLGR.R    
A3656DDX1ATP-dependent RNA helicase DDX1 R.FLVLDEADGLLSQGYSDFINR.M    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.FNNVAPLK.T    
A0212RPH3ARabphilin-3ARP3A_RATR.FPEQSTEAPPSDPGYPGAVAPAR.E    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.FPGQLNADLR.K    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.FPGQLNADLR.K    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.FPGQLNADLR.K    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.FPGQLNADLR.K    
A1222RPL5, MSTP03060S ribosomal protein L5RL5_RATR.FPGYDSESK.E    
A1941PLEC1, PLECPlectinPLEC_RATR.FPVTEAVNK.G    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.FQIQDISVETEDNK.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.FQIQDIVVQTQEGR.E    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATR.FQM#PDQGM#TSADDFFQGTK.A    
A0351MOGMyelin-oligodendrocyte glycoprotein precursorMOG_RATR.FSDEGGYTCFFR.D    
A8449PHACTR1, RPEL, RPEL1Phosphatase and actin regulator 1 R.FSDYVEVADAQDYDR.R    
A0587ADD2, ADDBBeta adducinADDL_RATR.FSEDDPEYLR.L    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.FSLDSEDVYSR.S    
A0568PCLO, ACZProtein piccolo R.FSLNLGGITDAPK.S    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.FSNVGLVHTSER.R    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATR.FSTFSGSITGPLYTHR.Q    
A0350MBPMyelin basic protein R.FSWGAEGQKPGFGYGGR.A    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATR.FTDDYQLFEELGK.G    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATR.FTDEYQLFEELGK.G    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.FTDEYQLYEDIGK.G    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.FTEEYQLFEELGK.G    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATR.FTQDTQPHYIYSPR.E    
A3970CLASP2CLIP-associating protein 2 R.FTVDQTQTPSLK.V    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.FTVLTESAAK.N    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.FVLNGDFER.L    
A0757CNTN1Contactin-1 precursor R.FVSQTNGNLYIANVESSDR.G    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.FYFENLLAK.N    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.FYFENLWSR.N    
A3879ERC2, CAST1, CASTERC protein 2 R.GAEHFTIELTEENFR.R    
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSER.GALFGANANR.K    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.GCIENVIYNR.I    
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATR.GCTATLGNFAK.A    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte R.GDSGDTLAATQSLLK.K    
A0285BSN, ZNF231Bassoon protein R.GEHSSTLPASTPSYTSGTSPTSLSSLEEDSDSSPSR.R    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.GFLSDTPVGVAHFILER.K    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 R.GFVPDTPVGVAHFLLQR.K    
A1941PLEC1, PLECPlectinPLEC_RATR.GGAEDELQALR.A    
A3514AGAP2, CENTG1ARF-GAP with GTPase, ANK repeat and PH domain-containing protein 2Y167_HUMANR.GGLALALVGTQDR.I    
A3893HAPLN1, CRTL1Hyaluronan and proteoglycan link protein 1PLK_RATR.GGLDWCNAGWLSDGSVQYPITK.P    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.GGLEGQSSVSM#TDPQFLK.R    
A1074TNRTenascin-R R.GHCQEGLCICEEGYQGPDCSAVTPPEDLR.V    
A3807RPLP060S acidic ribosomal protein P0RLA0_RATR.GHLENNPALEK.L    
A3973IMMT, HMP, PIG4Mitochondrial inner membrane protein R.GIEQAVQSHAVAEEEAR.K    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform R.GIVNGAAPELPVPTGGPM#AGAR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.GKDLIGVQNLLK.K    
A1074TNRTenascin-R R.GLCVDGECVCEEPYTGEDCR.E    
A1941PLEC1, PLECPlectinPLEC_RATR.GLFDEEM#NEILTDPSDDTK.G    
A3690CKMT1B, CKMT1A, CKMTCreatine kinase U-type, mitochondrialKCRU_RATR.GLSLPPACTR.A    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATR.GLSTLQAVLDSAAEK.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.GLVSSDELAK.D    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATR.GLYDGPVCEVSVTPK.T    
A0212RPH3ARabphilin-3ARP3A_RATR.GM#ALYEEEQVER.I    
A1547SERPINE2, PI7, PN1Glia derived Nexin precursorGDN_RATR.GM#IDNLLSPNLIDSALTK.L    
A3605CRMP1, DPYSL1, ULIP3Dihydropyrimidinase related protein-1DPY1_RATR.GM#YDGPVYEVPATPK.H    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.GNAQESLDTVSPK.N    
A9848CSNK2B, CK2N, G5ACasein kinase II beta chainKC2B_HUMANR.GNEFFCEVDEDYIQDK.F    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.GNSGLGFSIAGGTDNPHIGDDPSIFITK.I    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.GNTLTQCLGFQEFQK.D    
A3807RPLP060S acidic ribosomal protein P0RLA0_RATR.GNVGFVFTK.E    
A0219CDH2, CDHN, NCADNeural-cadherin precursorCAD2_RATR.GPFPQELVR.I    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.GPLASPAFSPR.S    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 R.GPPGAGLTVPPALLR.A    
A0014DLG2Disks large homolog 2SP93_RATR.GQEDLILSYEPVTR.Q    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATR.GQFSTDELVAEVEK.R    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.GQM#PENPYSEVGK.I    
A0568PCLO, ACZProtein piccolo R.GQYDEM#GESVADDPR.N    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSER.GSDELYAIK.I    
A3471CACNA1E, CACH6, CACNL1A6Voltage-dependent R-type calcium channel alpha-1E subunitCCAE_RATR.GSGLVGALDEAETPLVQPQPELEVGK.D    
A0161SYN1Synapsin ISYN1_RATR.GSHSQTPSPGALPLGR.Q    
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_RATR.GTEHSGSTVPSILNR.M    
A3815RPS2, rps2, RPS440S ribosomal protein S2RS2_RATR.GTGIVSAPVPK.K    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.GVDDALLSLK.T    
A3339ACTR3B, ARP4, ARP3BETAActin-related protein 3B R.GVDDLDFFIGDEAIDKPTYATK.W    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATR.GVEDALVSLK.T    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.GVIDM#GNSLIER.G    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.GVIDMGNSLIER.G    
A3773SLC25A22, GC1Mitochondrial glutamate carrier 1 R.GVNEDTYSGFLDCAR.K    
A3970CLASP2CLIP-associating protein 2 R.GVTEAIQNFSFR.S    
A0454DSPDesmoplakin R.GYFNEELSEILSDPSDDTK.G    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.GYSFTTTAER.E    
A4552ACTG1, ACTGActin, cytoplasmic 2 R.GYSFTTTAER.E    
A3970CLASP2CLIP-associating protein 2 R.HAAVLVETIK.K    
A3961MYH10, SmembMyosin-10MYHA_RATR.HATALEELSEQLEQAK.R    
A0285BSN, ZNF231Bassoon protein R.HDYVEDSSEGGLSPLPPQPPAR.A    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte R.HEVILADIASHEPR.I    
A0234ACTR3, ARP3Actin-like protein 3 R.HGIVEDWDLM#ER.F    
A1941PLEC1, PLECPlectinPLEC_RATR.HISDLYEDLR.D    
A0135MAPT, MAPTL, MTBT1Microtubule-associated protein tauTAU_RATR.HLSNVSSTGSIDM#VDSPQLATLADEVSASLAK.Q    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATR.HNHDLSSYQDTIQQLENELR.G    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.HNLEHAFDVAER.Q    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.HNLQDFINIK.L    
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_RATR.HQEGEIFDTEK.E    
A0350MBPMyelin basic protein R.HRDTGILDSIGR.F    
A0285BSN, ZNF231Bassoon protein R.HREEEQLLVQR.E    
A0292INA, NEF5Alpha-internexinAINX_RATR.HSAEVAGYQDSIGQLESDLR.N    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.HSDVALPHTEAAAAAPAEATAGK.R    
A0447DLGAP2, DAP2Disks large-associated protein 2 R.HSEPSTPTQYGALR.T    
A6308HSD17B4, EDH17B4Peroxisomal multifunctional enzyme type 2DHB4_RATR.HVLQQFADNDVSR.F    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.HYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGR.R    
A0285BSN, ZNF231Bassoon protein R.IADSSVQTDDEEGEGR.Y    
A3961MYH10, SmembMyosin-10MYHA_RATR.IAECSSQLAEEEEK.A    
A9897ELMO2, CED12AEngulfment and cell motility protein 2 R.IAFDAESDPSNAPGSGTEK.R    
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitADAA_MOUSER.IAGDYVSEEVWYR.V    
A0252AP2A2, ADTAB, CLAPA2Adapter-related protein complex 2 alpha 2 subunitADAC_RATR.IAGDYVSEEVWYR.V    
A1668RPS1040S ribosomal protein S10RS10_RATR.IAIYELLFK.E    
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7RL7_RATR.IALTDNSLVAR.S    
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1CMC1_HUMANR.IAPLAEGALPYNLAELQR.Q    
A3961MYH10, SmembMyosin-10MYHA_RATR.IAQLEEELEEEQSNMELLNDR.F    
A1914CTNNA2, CAPRCatenin alpha-2CTN2_MOUSER.IASSEFADDPCSSVK.R    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.IDGITIQAR.Q    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.IDSLM#DEIAFLK.K    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.IEASLQHEITR.L    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.IEELEGQLDQLTQENR.D    
A0095DNM1, DNMDynamin-1DYN1_RATR.IEGSGDQIDTYELSGGAR.I    
A1927DNM2, DYN2Dynamin 2DYN2_RATR.IEGSGDQVDTLELSGGAR.I    
A0148WASF1, SCAR1, WAVE1Wiskott-Aldrich syndrome protein family member 1 R.IENDVATILSR.R    
A562CSTX11Syntaxin 11STXB_MOUSER.IEYNVEHSVDYVER.A    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.IFLSGITEEER.Q    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATR.IGAADYQPTEQDILR.T    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.IGLVPPPEEFANGILLATPPPGPGPLPTTVPSPASGK.P    
A0285BSN, ZNF231Bassoon protein R.IGQLFQGPGR.D    
A3881ADAM23, MDC3ADAM 23 precursor R.IGQLQGEIIPTSFYHQGR.V    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.IHCLENVDK.A    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.IHCLENVDK.A    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.IHFPLATYAPVISAEK.A    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.IHFPLATYAPVISAEK.A    
A9638RPS2040S ribosomal protein S20RS20_DROMER.IIDLHSPSEIVK.K    
A2000GABBR2, GPR51, GPRC3BGamma-aminobutyric acid type B receptor, subunit 2 precursorGBR2_RATR.IILGQFDQNM#AAK.V    
A2000GABBR2, GPR51, GPRC3BGamma-aminobutyric acid type B receptor, subunit 2 precursorGBR2_RATR.IILGQFDQNMAAK.V    
A0103GRM1, GPRC1A, MGLUR1Metabotropic glutamate receptor 1MGR1_RATR.ILAGSKKK.I    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATR.ILGADTSVDLEETGR.V    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATR.ILLLGTAVESAWGDEQSAFR.C    
A3977EMC2, TTC35ER membrane protein complex subunit 2 R.ILQEDPTNTAAR.K    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.IM#NTFSVM#PSPK.V    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.IM#NTFSVMPSPK.V    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.IM#NTFSVVPSPK.V    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.IM#NTFSVVPSPK.V    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.IM#NTFSVVPSPK.V    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.IM#NVIGEPIDER.G    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.IMNTFSVM#PSPK.V    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.IMNTFSVMPSPK.V    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.IMNTFSVVPSPK.V    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.IMNTFSVVPSPK.V    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.IMNTFSVVPSPK.V    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.IMNVIGEPIDER.G    
A0014DLG2Disks large homolog 2SP93_RATR.INDDLISEFPDK.F    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.INIAEMAVQR.H    
A3518SEPT5, CDCrel-1, PNUTL1Septin 5 R.INQTVEILK.H    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.INVYYNEAAGNK.Y    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.INVYYNEATGGNYVPR.A    
A0447DLGAP2, DAP2Disks large-associated protein 2 R.IPANLLDQFEK.Q    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.IPLSFQNPLFH.M    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.IPLSFQNPLFH.M    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform R.IPQSTLSEFYPR.D    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.IPSAVGYQPTLATDM#GTM#QER.I    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.IPSAVGYQPTLATDMGTM#QER.I    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.IPSAVGYQPTLATDMGTMQER.I    
A0254AP2M1, CLAPM1AP-2 complex subunit mu R.IPTPLNTSGVQVICM#K.G    
A3965TPM1, TMSATropomyosin 1 alpha chainTPMY_RATR.IQLVEEELDR.A    
A5224TPM4Tropomyosin alpha 4 chain R.IQLVEEELDR.A    
A3776SLC25A3, PHCSolute carrier family 25 member 3 R.IQTQPGYANTLR.E    
A0510PPP1R9ANeurabin-INEB1_RATR.IRDLEAEVFR.L    
A3979IGSF21Immunoglobulin superfamily member 21 precursor R.ISDNGPYECHVGIYDR.A    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA R.ISELTSELTDER.N    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.ISEQFTAM#FR.R    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.ISEQFTAM#FR.R    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.ISEQFTAM#FR.R    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.ISEQFTAM#FR.R    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.ISEQFTAMFR.R    
A5192TUBB3, TUBB4Tubulin beta-3 chainTubulin beta-4 chain R.ISEQFTAMFR.R    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.ISEQFTAMFR.R    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.ISEQFTAMFR.R    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATR.ISGETIFVTAPHEATAGIIGVNR.K    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANR.ISGVGIDQPPYGIFVINQK.T    
A9550RPL2360S ribosomal protein L23/L17RL23_HUMANR.ISLGLPVGAVINCADNTGAK.N    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.ISVYYNEATGGK.Y    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.ITAHEALK.H    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.ITDLYTDLR.D    
A1074TNRTenascin-R R.ITFTPSSGISSEVTVPR.D    
A0451HSPA5, GRP78Heat shock 70kDa protein 5GR78_RATR.ITPSYVAFTPEGER.L    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.ITQYLDAGGIPR.T    
A0366RPL7, HUML7-1, RPL7P3260S ribosomal protein L7RL7_RATR.IVEPYIAWGYPNLK.S    
A3961MYH10, SmembMyosin-10MYHA_RATR.IVFQEFR.Q    
A3961MYH10, SmembMyosin-10MYHA_RATR.IVGLDQVTGM#TETAFGSAYK.T    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.IVGVPLELEQSTHR.H    
A0568PCLO, ACZProtein piccolo R.IVLSFSGM#APSVVESVGTKPERPQADTISTDLPISEK.D    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.KACADATLSQITNNIDPVGR.I    
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_RATR.KANIPIM#DTGENPEVPFPR.D    
A2341ACTN1Alpha-actinin 1AAC1_RATR.KDDPLTNLNTAFDVAER.Y    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.KDLYANTVLSGGTTM#YPGIADR.M    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.KDSPQLLMDAK.H    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.KEAESCDCLQGFQLTH.S    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.KEAESCDCLQGFQLTH.S    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSER.KEGNASGVSLLEALDTILPPTRPTDK.P    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.KESESCDCLQGFQLTH.S    
A3564NDUFS3NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial R.KFDLNSPWEAFPAYR.Q    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.KGDQILSVNGVDLR.N    
A8662ANKS1B, EB-1Cajalin 2 R.KGGHSSTLPESFENKPSKPIPK.P    
A9572RPL3860S ribosomal protein L38RL38_HUMANR.KIEEIKDFLLTAR.R    
A5224TPM4Tropomyosin alpha 4 chain R.KIQVLQQQADDAEER.A    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.KKDALLSALSIQNYHLECNETK.S    
A3808RPL4, RPL160S ribosomal protein L4RL4_RATR.KLDELYGTWR.K    
A3961MYH10, SmembMyosin-10MYHA_RATR.KLDGETTDLQDQIAELQAQVDELK.V    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.KLEEYER.R    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.KLEEYER.R    
A0418CAPZBCapping protein (actin filament) muscle Z-line, betaCAPB_MOUSER.KLEVEANNAFDQYR.D    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATR.KPFPDFVYK.R    
A0568PCLO, ACZProtein piccolo R.KPSSQAFPTIR.D    
A0231ARPC4, ARC20, ARPC4-TTLL3Actin-related protein 2/3 complex subunit 4 R.KPVEGYDISFLITNFHTEQM#YK.H    
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSER.KQDFPLVK.A    
A0285BSN, ZNF231Bassoon protein R.KQQEQLLQLER.E    
A9561RPL3160S ribosomal protein L31RL31_HUMANR.KRNEDEDSPNKLYTLVTYVPVTTFK.N    
A2142CORO1C, CRNN4, CRN2Coronin 1CCO1C_MOUSER.KSDLFQDDLYPDTAGPEAALEAEEWFEGK.N    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.KVEDLFLTFAK.K    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATR.KVESLEEEIQFLR.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LAALADQWQFLVQK.S    
A1941PLEC1, PLECPlectinPLEC_RATR.LAEDEAFQR.R    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LAEISDVWEEM#K.T    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LAEISDVWEEMK.T    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSER.LAEM#PADSGYPAYLGAR.L    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSER.LAEMPADSGYPAYLGAR.L    
A1941PLEC1, PLECPlectinPLEC_RATR.LAEVEAALEK.Q    
A1881TJP2, X104, ZO2Tight junction protein ZO-2 R.LAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILK.V    
A0086TJP1, ZO1Tight junction protein ZO-1ZO1_MOUSER.LAGGNDVGIFVAGVLEDSPAAK.E    
A2341ACTN1Alpha-actinin 1AAC1_RATR.LAILGIHNEVSK.I    
A9551RPL23A60S ribosomal protein L23aRL2B_HUMANR.LAPDYDALDVANK.I    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LAQFVEHWK.E    
A0663NFASCNeurofascin precursor R.LDCPFFGSPIPTLR.W    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.LDHKFDLM#YAK.R    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.LDHKFDLM#YAK.R    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.LDHKFDLMYAK.R    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.LDHKFDLMYAK.R    
A0404ATP6V1E1, ATP6E, ATP6E2Vacuolar ATP synthase subunit EVATE_MOUSER.LDLIAQQM#M#PEVR.G    
A0214KALRN, DUET, DUOKalirinHAPP_RATR.LDQCQQYVVFER.S    
A3823RPS840S ribosomal protein S8RS8_HUMANR.LDVGNFSWGSECCTR.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LEAELAAHEPAIQGVLDTGK.K    
A3879ERC2, CAST1, CASTERC protein 2 R.LEEIESFR.K    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LEESLEYQQFVANVEEEEAWINEK.M    
A1074TNRTenascin-R R.LEGLSENTDYTVLLQAAQEATR.S    
A1630CD59, MIC11, MIN1CD59 glycoprotein precursorCD59_RATR.LEIANVQYR.C    
A0438DBN1, D0S117EDrebrinDREB_RATR.LELLAAYEEVIR.E    
A0374NEFH, NFHNeurofilament heavy polypeptide R.LEQEHLLEDIAHVR.Q    
A3653DDX3X, DBX, DDX3ATP-dependent RNA helicase DDX3XDDX3_MOUSER.LEQELFSGGNTGINFEK.Y    
A3590OMG, OMGPOligodendrocyte-myelin glycoprotein precursorOMGP_MOUSER.LESLPAQLPR.S    
A3532GIT1ARF GTPase-activating protein GIT1 R.LFEELAM#DVYDEVDR.R    
A9654RPS940S ribosomal protein S9RS9_RATR.LFEGNALLR.R    
A3891NRXN3Neurexin 3-alpha precursor R.LFQGQLSGLYYDGLK.V    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.LFVSGACDASAK.L    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.LGAEEERPGTPELAPTPM#QAAAVAEPM#PSPR.A    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.LGAGAAGLYDSGTPLGPLPYPER.Q    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.LGGAPTSQGVSPSPSAILER.R    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.LGHLQSSWDTLR.E    
A0016DLG3Discs, large homolog 3SP02_RATR.LGVNDCVLR.V    
A3873ANK2Ankyrin 2ANK2_HUMANR.LGYISVVDTLK.V    
A3874ANK3Ankyrin 3 R.LGYISVVDTLK.V    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.LHFFM#PGFAPLTSR.G    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.LHFFM#PGFAPLTSR.G    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.LHFFM#PGFAPLTSR.G    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATR.LHYGLPVVVK.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.LIDAGHSEAATIAEWK.D    
A2428IQSEC1, ARFGEP100, BRAG2IQ motif and SEC7 domain-containing protein 1 R.LIEAFSQR.Y    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.LIEAFSQR.Y    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LKDLNSQADSLM#TSSAFDTSQVK.E    
A0438DBN1, D0S117EDrebrinDREB_RATR.LKDQSIFGDQR.D    
A0016DLG3Discs, large homolog 3SP02_RATR.LLAVNNTNLQDVR.H    
A1941PLEC1, PLECPlectinPLEC_RATR.LLDAQLATGGIVDPR.L    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.LLDPSSPLALALSAR.D    
A0285BSN, ZNF231Bassoon protein R.LLDTSFASSER.L    
A0117NSFVesicle-fusing ATPase R.LLDYVPIGPR.F    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.LLEETQAELLK.A    
A0285BSN, ZNF231Bassoon protein R.LLEGSLGEPAPLPLPTPQEPPAGVPQR.A    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.LLESQLQSQK.R    
A374ETANC2Protein TANC2 R.LLLEQGAAVAQPNR.R    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.LLNTAGGYPYSFWIGR.N    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LLSDISTALR.N    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LLSDISTALR.N    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.LLVSASQDGK.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LM#LVEEELR.R    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LMLVEEELR.R    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATR.LNIPVSQVNPR.E    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.LNNLSPASHLASSSPPPGLPSGLPSGLPSGSPSR.S    
A9704DLGAP4, DAP4, SAPAP4Disks large-associated protein 4 R.LPANLLDQFEK.Q    
A0292INA, NEF5Alpha-internexinAINX_RATR.LPASDGLDLSQAAAR.T    
A0130NRXN1Neurexin 1-alpha precursor R.LPDLISDALFCNGQIER.G    
A0285BSN, ZNF231Bassoon protein R.LPHNATTGYEELLSEEGPAEPTDGALQGGLR.R    
A3520SEPT7, CDC10Septin-7SEP7_RATR.LPLAVVGSNTIIEVNGK.R    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRR.LPLQDVYK.I    
A3801EEF1A2, EEF1AL, STNEukaryotic translation elongation factor 1 alpha 2EF12_MOUSER.LPLQDVYK.I    
A0568PCLO, ACZProtein piccolo R.LPSGSLPVSTHPSK.S    
A0161SYN1Synapsin ISYN1_RATR.LPSPTAAPQQSASQATPMTQGQGR.Q    
A0107DLGAP1, DAP1, GKAPDisks large-associated protein 1 R.LPTNLLDQFER.Q    
A1941PLEC1, PLECPlectinPLEC_RATR.LPVDVAYQR.G    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LQALDTGWNELHK.M    
A0095DNM1, DNMDynamin-1DYN1_RATR.LQDAFSAIGQNADLDLPQIAVVGGQSAGK.S    
A0568PCLO, ACZProtein piccolo R.LQEQIYDDPM#QK.I    
A3555VCAN, CSPG2Versican core protein precursor R.LQGAHLTSILSHEEQM#FVNR.V    
A3961MYH10, SmembMyosin-10MYHA_RATR.LQQELDDLTVDLDHQR.Q    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.LQQSHPLSANQIQVK.R    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATR.LRDDTEAAIR.A    
A3663HK1-tc, HK1-tb, HK1-taHexokinase 1HXK1_RATR.LSDEILIDILTR.F    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LSDGNEYLFQAK.D    
A0161SYN1Synapsin ISYN1_RATR.LSDSNFM#ANLPNGYM#TDLQRPQPPPPPPSAASPGATPGSAAASAER.A    
A0161SYN1Synapsin ISYN1_RATR.LSDSNFM#ANLPNGYMTDLQR.P    
A0161SYN1Synapsin ISYN1_RATR.LSDSNFMANLPNGYMTDLQR.P    
A0686AP1B1, ADTB1, BAM22AP-1 complex subunit beta-1ADB1_RATR.LSHANSAVVLSAVK.V    
A4010WDR7, TRAGWD-repeat protein 7 R.LSIWNIADIADK.Q    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.LSLAAAAGDPFAYPGAGGLYK.R    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LSQGSGSSITAAGM#R.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LSQGSGSSITAAGM#R.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LSQGSGSSITAAGMR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.LSQGSGSSITAAGMR.L    
A0438DBN1, D0S117EDrebrinDREB_RATR.LSSPVLHR.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.LSSSWESLLPEPAHPF.-    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSER.LSVEVWDWDR.T    
A0424GLUL, GLNS, PIG43Glutamine synthetaseGLNA_RATR.LTGFHETSNINDFSAGVANR.S    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.LTNENLDLM#EQLEK.Q    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.LTNENLDLMEQLEK.Q    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.LTQYIDGQGR.P    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATR.LTQYIDGQGR.P    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LTTLELLEVR.R    
A6692HSD17B10, ERAB, HADH23-hydroxyacyl-CoA dehydrogenase type 2HCD2_RATR.LVGQGATAVLLDVPNSEGETEAK.K    
A9645RPS27, MPS140S ribosomal protein S27RS27_RATR.LVQSPNSYFM#DVK.C    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LVSDGNINSDR.I    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.LVSQDNFGFDLPAVEAATK.K    
A0016DLG3Discs, large homolog 3SP02_RATR.LVTPHGESEQIGVIPSK.K    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.LVTQDNFGYDLAAVEAAK.K    
A0290L1CAM, CAML1, MIC5Neural cell adhesion molecule L1 precursorCAML_RATR.LVVFPTDDISLK.C    
A874CBTBD17BTB/POZ domain-containing protein 17 R.LVVTPASSGGDAAGVSFQK.T    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATR.LWGDSGIQECFNR.S    
A0510PPP1R9ANeurabin-INEB1_RATR.LYDSVSSTDGEDSLER.K    
A3879ERC2, CAST1, CASTERC protein 2 R.M#AEAESQVSHLEVILDQK.E    
A2344ACTN4Alpha-actinin 4AAC4_RATR.M#APYQGPDAAPGALDYK.S    
A9652RPS6, PNAS-2040S ribosomal protein S6RS6_HUMANR.M#ATEVAADALGEEWK.G    
A0043GNAO1Guanine nucleotide-binding protein G(O), alpha subunit 1GB01_RATR.M#EDTEPFSAELLSAM#M#R.L    
A3518SEPT5, CDCrel-1, PNUTL1Septin 5 R.M#ESPIPILPLPTPDSETEK.L    
A3580CYFIP2, PIR121P53 inducible protein R.M#ESVFNQAIR.N    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 R.M#GDFLIEVNGQNVVK.V    
A0424GLUL, GLNS, PIG43Glutamine synthetaseGLNA_RATR.M#GDHLWVAR.F    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSER.M#GPSSSPIPSPSPSPTDSK.R    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.M#HTTFEHDIQALGTQVR.Q    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.M#LCAVLEPALNVK.G    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.M#LCAVLEPALNVK.G    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.M#LEITVWDQPR.V    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.M#NEVISLWK.K    
A0757CNTN1Contactin-1 precursor R.M#NNGDVDLTNDR.Y    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.M#QLLAASYDLHR.Y    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSER.M#VNHFIAEFK.R    
A0296GRIA1, GLUR1, GLUH1Glutamate receptor 1 precursorGLR1_RATR.M#VSPIESAEDLAK.Q    
A0299GRIA3, GLUR3, GLURCGlutamate receptor 3 precursorGLR3_RATR.M#VSPIESAEDLAK.Q    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATR.M#VSPIESAEDLSK.Q    
A0352PLP1, PLPMyelin proteolipid proteinMYPR_HUMANR.M#YGVLPWNAFPGK.V    
A0757CNTN1Contactin-1 precursor R.MNNGDVDLTNDR.Y    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.MQHNLEQQIQAR.N    
A0296GRIA1, GLUR1, GLUH1Glutamate receptor 1 precursorGLR1_RATR.MVSPIESAEDLAK.Q    
A0299GRIA3, GLUR3, GLURCGlutamate receptor 3 precursorGLR3_RATR.MVSPIESAEDLAK.Q    
A0352PLP1, PLPMyelin proteolipid proteinMYPR_HUMANR.MYGVLPWNAFPGK.V    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 R.NAFVTGIAR.Y    
A3580CYFIP2, PIR121P53 inducible protein R.NAFVTGIAR.Y    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.NAGALTTLLDLGASPDYK.D    
A0510PPP1R9ANeurabin-INEB1_RATR.NDDVDPVAASAEYELEK.R    
A0757CNTN1Contactin-1 precursor R.NDGGIYTCFAENNR.G    
A3905SYT7, PCANAP7Synaptotagmin-7 R.NDPIGEVSIPLNK.V    
A9035RTN4, NOGOC, NOGOReticulon 4 R.NEDASFPSTPEPVK.D    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATR.NEGVATYAAAVLFR.M    
A1926PFK-P, PFKP, PFKF6-phosphofructokinase, type CK6PP_RATR.NENCSVNYTTDFIYQLYSEEGK.G    
A8662ANKS1B, EB-1Cajalin 2 R.NENYFDDIPR.S    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.NEPTTPSWLAEIPPWVPK.D    
A3563NDUFA9, NDUFS2LNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial precursor R.NFDFEDVFVNIPR.A    
A0757CNTN1Contactin-1 precursor R.NFM#LDANGELLIR.N    
A3773SLC25A22, GC1Mitochondrial glutamate carrier 1 R.NHGIAGLYK.G    
A1551S100A9, CAGB, CFAGProtein S100-A9S109_HUMANR.NIETIINTFHQYSVK.L    
A0130NRXN1Neurexin 1-alpha precursor R.NIIADPVTFK.T    
A3891NRXN3Neurexin 3-alpha precursor R.NIIADPVTFK.T    
A8662ANKS1B, EB-1Cajalin 2 R.NISCAAQDPEDLSTFAYITK.D    
A0104HOMER1, SYN47Homer protein homolog 1 R.NKDLEGQLSELEQR.L    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATR.NLHQSGFSLSGAQIDDNIPR.R    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATR.NLITDICTEQCTLSDQLLPK.H    
A3905SYT7, PCANAP7Synaptotagmin-7 R.NLNPIFNESFAFDIPTEK.L    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATR.NLQNLLILTAIK.A    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATR.NNLAGAEELFAR.K    
A0545NCKAP1, HEM2, NAP1Nck-associated protein 1MEM2_RATR.NNNQQLAQLQK.E    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.NQSIIVSGESGAGK.T    
A177CMYO5C, HSPC089Unconventional myosin-VcMY5C_HUMANR.NQSIIVSGESGAGK.T    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.NSPAFLSTDLGDEDVGLGPPAPR.M    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.NSWNTISFR.T    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA R.NTGESASQLLDAETAER.L    
A0862TRAF3, CAP1, CRAF1TNF receptor associated factor 3TRA3_MOUSER.NTGLLESQLSR.H    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.NTTGVTEEALK.E    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.NVFYELEDVR.D    
A874CBTBD17BTB/POZ domain-containing protein 17 R.NYLAPAWGAPWVINNPAR.D    
A0568PCLO, ACZProtein piccolo R.NYVLIDDIGDITK.G    
A0285BSN, ZNF231Bassoon protein R.NYVM#IDDISELTK.D    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.PAPSGPGGGSGGGSGGGGGGQPPPLQR.G    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.PAPSGPGGGSGGGSGGGGGGQPPPLQR.G    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.PDNFVFGQSGAGNNWAK.G    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.PDNFVFGQSGAGNNWAK.G    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.PDNFVFGQSGAGNNWAK.G    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.PGGLDYSSGEGLGLTFGGPSPGPVK.E    
A0259PRKCG, PKCGProtein kinase C, gamma typeKPCG_MOUSER.PHFLTQLHSTFQTPDR.L    
A0417CAPZA2F-actin capping protein alpha-2 subunitCAZ2_MOUSER.PYEAENAIESWR.T    
A3893HAPLN1, CRTL1Hyaluronan and proteoglycan link protein 1PLK_RATR.QACLDQDAVIASFDQLYDAWR.G    
A0285BSN, ZNF231Bassoon protein R.QAQFALQR.E    
A8860PPFIA2Liprin-alpha2 R.QAQSPSGVSSEVEVLK.A    
A3964MAJN, MYO18A, MYSPDZMyosin XVIIIA R.QDQSIVLLGSSGSGK.T    
A0002NR2A, GRIN2A, NMDAR2AGlutamate [NMDA] receptor subunit epsilon 1 precursorNME1_RATR.QDSLNQNPVSQR.D    
A5150SPTA1, SPTASpectrin alpha chain, erythrocyte R.QEAFLENEDLGNSVGSVEALLQK.H    
A3516SEPT3, SEP3Neuronal-specific septin-3 R.QESM#PFAVVGSDK.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.QFQDAGHFDAENIK.K    
A0342ATP1A3Sodium/potassium-transporting ATPase alpha-3 chainATN3_RATR.QGAIVAVTGDGVNDSPALK.K    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATR.QGAIVAVTGDGVNDSPALK.K    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.QGIAVM#TPTVPGSPK.G    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.QGIAVMTPTVPGSPK.G    
A3975CRTAC1, ASPIC1, CEP68ASPIC precursor R.QGNAIGVTACDIDGDGR.E    
A0161SYN1Synapsin ISYN1_RATR.QGPPLQQRPPPQGQQHLSGLGPPAGSPLPQR.L    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.QGSPTQSPPADTSFGSR.R    
A0201K-ras, K-RAS, KRASGTPase KRASRASL_RATR.QGVDDAFYTLVR.E    
A3904syn2, SYN2Synapsin-2SYN2_RATR.QHAFGMAENEDFR.H    
A0469CTNND2, NPRAPCatenin delta-2 R.QIVASQLER.C    
A5083PKP4, ps1ly2h-25, PS1LY2H-25Plakophilin-4 R.QIVASQLER.C    
A1941PLEC1, PLECPlectinPLEC_RATR.QLAEEDLAQQR.A    
A1941PLEC1, PLECPlectinPLEC_RATR.QLLEEELAR.L    
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALFA_RATR.QLLLTADDR.V    
A3961MYH10, SmembMyosin-10MYHA_RATR.QLLQANPILESFGNAK.T    
A0214KALRN, DUET, DUOKalirinHAPP_RATR.QM#NDFNTEDLTLAEQR.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.QNLLSQSHAYQQFLR.D    
A3503MINK, MINK1, MAP4K6Misshapen-like kinase 1 R.QNS*DPTSEGPGPSPNPPSWVRPDNEAPPK.V   modifications: phosphorylated
A1941PLEC1, PLECPlectinPLEC_RATR.QQNLASYDYVR.R    
A0603GABBR1, GPRC3AGamma-aminobutyric acid type B receptor, subunit 1 precursorGBR1_RATR.QSFFSDPAVPVK.N    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATR.QSSAPASPAASAAGLAGQAAK.S    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.QTFTGHESDINAICFFPNGNAFATGSDDATCR.L    
A0419GSNGelsolin precursor, plasmaGELS_MOUSER.QTQVSVLPEGGETPLFK.Q    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.QTTAPATM#STAASGTTM#GLVEQAK.S    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.QTTAPATM#STAASGTTMGLVEQAK.S    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.QTTAPATMSTAASGTTM#GLVEQAK.S    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATR.QTTAPATMSTAASGTTMGLVEQAK.S    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.QVDEGVWPPPNNLLNQSPK.K    
A0568PCLO, ACZProtein piccolo R.QVISGVGISTPQYSTAR.L    
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alpha R.QYGDESTLAFQQAR.Y    
A3520SEPT7, CDC10Septin-7SEP7_RATR.QYPWGVAEVENGEHCDFTILR.N    
A3680GLUD1, GLUDGlutamate dehydrogenase 1, mitochondrial precursorDHE3_RATR.RDDGSWEVIEGYR.A    
A0016DLG3Discs, large homolog 3SP02_RATR.RDNEVDGQDYHFVVSR.E    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.REFDEIELAYR.R    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.RESSVYDISEHR.R    
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHS7C_MOUSER.RFDDAVVQSDMK.H    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.RHSDVALPHTEAAAAAPAEATAGK.R    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 R.RKDFVSEAYLITLGK.F    
A1941PLEC1, PLECPlectinPLEC_RATR.RPELEDSTLR.Y    
A0038LPHN1, LEC2Latrophilin-1 R.RPPAPNLHVSPELFCEPR.E    
A3904syn2, SYN2Synapsin-2SYN2_RATR.RPPPAQAPAPQPAPQPAPTPSVGSSF.F    
A3904syn2, SYN2Synapsin-2SYN2_RATR.RPPPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVK.Q    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.RQDLEDSLQAQQY.F    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.RQDLEDSLQAQQYFADANEAESWM#R.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.RQDLEDSLQAQQYFADANEAESWMR.E    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.RVHSDSETDDIGFIPSK.R    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.RVYAQNLIDDK.Q    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.S*PPLIGSESAYEDFLSADDK.A   modifications: phosphorylated
A0219CDH2, CDHN, NCADNeural-cadherin precursorCAD2_RATR.SAAPHPGDIGDFINEGLK.A    
A0109SORBS2, ARGBP2, ARGBP2ASorbin and SH3 domain-containing protein 2 R.SAHNAPGFLK.M    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.SASGDTVFWGEHFEFNNLPAVR.A    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.SASGDTVFWGEHFEFNNLPAVR.A    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.SAYSGLQSSSYLM#SAR.A    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.SAYSGLQSSSYLMSAR.A    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.SAYSSYSAPVSSSLSVR.R    
A0109SORBS2, ARGBP2, ARGBP2ASorbin and SH3 domain-containing protein 2 R.SCDDLLNDDCGSFPDPK.T    
A374ETANC2Protein TANC2 R.SCDELSPVSPTQGGYPSEPTR.S    
A0493GJA1, GJALGap junction alpha-1 proteinCXA1_RATR.SDPYHATTGPLSPSK.D    
A1941PLEC1, PLECPlectinPLEC_RATR.SDQLTGLSLLPLSEK.A    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.SDVLETVVLINPSDEAVSTEVR.L    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.SDVSDISTHTVTYGNIEGN.A    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.SDVSDISTHTVTYGNIEGNAAK.R    
A3904syn2, SYN2Synapsin-2SYN2_RATR.SFRPDFVLIR.Q    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATR.SGAPSVLPH.-    
A3873ANK2Ankyrin 2ANK2_HUMANR.SGHDQVVELLLER.G    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.SGHFEQAIK.E    
A5190TUBB2BTubulin beta-2B chainTBB1_RATR.SGPFGQIFRPDNFVFGQSGAGNNWAK.G    
A5193TUBB4, TUBB4A, TUBB5Tubulin beta-4 chain R.SGPFGQIFRPDNFVFGQSGAGNNWAK.G    
A5195TUBB, TUBB5, XTP3TPATP1Tubulin beta-5 chainTBB5_MOUSER.SGPFGQIFRPDNFVFGQSGAGNNWAK.G    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.SGSIEQASLVVEER.T    
A2141CORO1BCoronin 1BCO1B_RATR.SGVSTATAITDIPSGNLAGSGEAGK.L    
A0285BSN, ZNF231Bassoon protein R.SHGPLLPTIEDSSEEEELR.E    
A0568PCLO, ACZProtein piccolo R.SHGPLLPTIEDSSEEEELR.E    
A3497FLOT2, ESA1, M17S1Flotillin-2FLT2_CARAUR.SILGTLTVEQIYQDR.D    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.SILTEQLETIPK.E    
A1941PLEC1, PLECPlectinPLEC_RATR.SIQEELQHLR.Q    
A5183TUBA4A, TUBA1, TUBA4Tubulin alpha-4A chainTBA4_HUMANR.SIQFVDWCPTGFK.V    
A0442DPYSL2, CRMP2, ULIP2Dihydropyrimidinase related protein-2DPY2_RATR.SITIANQTNCPLYVTK.V    
A2344ACTN4Alpha-actinin 4AAC4_RATR.SIVDYKPNLDLLEQQHQLIQEALIFDNK.H    
A4616CDH13, CDHHCadherin-13 precursorCADD_MOUSER.SIVVSPILIPENQR.Q    
A3514AGAP2, CENTG1ARF-GAP with GTPase, ANK repeat and PH domain-containing protein 2Y167_HUMANR.SLDLDDWPR.E    
A0109SORBS2, ARGBP2, ARGBP2ASorbin and SH3 domain-containing protein 2 R.SLDSAETYSQHAQSLDGTM#GSSIPLYR.S    
A0107DLGAP1, DAP1, GKAPDisks large-associated protein 1 R.SLDSLDPAGLLTSPK.F    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.SLENVLEINK.R    
A3590OMG, OMGPOligodendrocyte-myelin glycoprotein precursorOMGP_MOUSER.SLEVLNLSSNK.L    
A0297GRIA2, GLUR2Glutamate receptor 2 precursorGLR2_RATR.SLFQDLELK.K    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.SLGEEPVGGLGSLLDPAK.K    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANR.SLGQNPTEAELQDM#INEVDAD.G    
A0161SYN1Synapsin ISYN1_RATR.SLKPDFVLIR.Q    
A3965TPM1, TMSATropomyosin 1 alpha chainTPMY_RATR.SLQEQADAAEER.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.SLQQLAEER.S    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.SLSTYSAAALQSDLEDSLYK.A    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.SLVGFGPPVPAK.D    
A3876ADD1, ADDAAlpha adducinADDA_RATR.SLVQGELVTASK.A    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.SM#CAPLPVAAQSTTLPSLSGR.Q    
A0101MLLT4, AF6AF-6 protein R.SM#DAETYVDGQR.I    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.SM#IILQDSAPEVGDVPR.P    
A0376NEFM, NEF3, NFMNeurofilament triplet M proteinNFM_RATR.SNHEEEVADLLAQIQASHITVER.K    
A0292INA, NEF5Alpha-internexinAINX_RATR.SNVASTAACSSASSLGLGLAYR.R    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.SPAPQAAFR.T    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.SPAWIPVPAR.R    
A1016ATN1, D12S755E, DRPLAAtrophin-1ATN1_RATR.SPDFTNENPLETR.N    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.SPGVLFLQFGEETR.R    
A0112CTNNB1, CTNNB, PRO2286Beta-cateninCTNB_RATR.SPQMVSAIVR.T    
A0438DBN1, D0S117EDrebrinDREB_RATR.SPSDSSTASTPITEQIER.A    
A0074SHANK3, PSAP2, PROSAP2SH3 and multiple ankyrin repeat domains protein 3 R.SPSPSPLPSPSPGSGPSAGPR.R    
A0137CNKSR2, CNK2, KSR2Connector enhancer of KSR2A R.SPTSSVATPSSTISTPTK.R    
A0285BSN, ZNF231Bassoon protein R.SQASEEESPVSPLGR.P    
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_RATR.SQFSLTNGM#YPHK.L    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.SQLLGSAHEVQR.F    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.SQNIITDSSSLNAEAIR.Q    
A1941PLEC1, PLECPlectinPLEC_RATR.SQVEEELFSVR.V    
A1218THY1Thy-1 membrane glycoprotein precursorTHY1_RATR.SRVNLFSDR.F    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.SSGATPVSGPPPPAVSSTPAGQPTAVSR.L    
A3580CYFIP2, PIR121P53 inducible protein R.SSLDGPIVLAIEDFHK.Q    
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2 R.SSLEDTYGAGDGLK.R    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.SSLSSAQADFNQLAELDR.Q    
A1074TNRTenascin-R R.SSLTSTIFTTGGR.V    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.SSPAYCTSSSDITEPEQK.M    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.SSPAYCTSSSDITEPEQK.M    
A0075SHANK1SH3 and multiple ankyrin repeat domains protein 1 R.SSPTGGAGGSTDPFAPVFVPPHPGISGGLGGALSGASR.S    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta R.SSQEIETSSCLESLSSK.G    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.SSRPDTLLSSEQPLRPGK.S    
A0148WASF1, SCAR1, WAVE1Wiskott-Aldrich syndrome protein family member 1 R.SSTIQDQQLFDR.K    
A5083PKP4, ps1ly2h-25, PS1LY2H-25Plakophilin-4 R.SSYASQHSQLGQDLR.S    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.SSYYVVSGNDPAAEEPSR.A    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATR.SSYYVVSGNDPAAEEPSR.A    
A0285BSN, ZNF231Bassoon protein R.STAPAASHPAGKPQPGPTTAPGPQPAGLPR.A    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.STGLGSDYYELSDSR.G    
A0418CAPZBCapping protein (actin filament) muscle Z-line, betaCAPB_MOUSER.STLNEIYFGK.T    
A243DCTTNBP2, CORTBP2Cortactin-binding protein 2 R.SVACQTDVVTESTDPVK.K    
A0038LPHN1, LEC2Latrophilin-1 R.SVYVDDDSEAAGNR.V    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.SWDTNLIECNLDQELK.L    
A3580CYFIP2, PIR121P53 inducible protein R.SYLQDPIWR.G    
A0375NEFL, NF68, NFLNeurofilament triplet L proteinNFL_RATR.SYSSSSGSLM#PSLENLDLSQVAAISNDLK.S    
A0662hANK1, ANK1, ANKAnkyrin 1ANK1_MOUSER.TAAVLLQNDPNPDVLSK.T    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.TAENVAIESR.V    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSER.TALVANTSNMPVAAR.E    
A0285BSN, ZNF231Bassoon protein R.TAVKPTPIILTDQGM#DLTSL.A    
A0285BSN, ZNF231Bassoon protein R.TAVKPTPIILTDQGMDLTSL.A    
A3514AGAP2, CENTG1ARF-GAP with GTPase, ANK repeat and PH domain-containing protein 2Y167_HUMANR.TDSQSEAVAIQAIR.N    
A3463LPHN3, LEC3Latrophilin-3 precursor R.TDTLTEYSSK.D    
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GBB2_RATR.TFVSGACDASIK.L    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATR.TGAIVDVPVGDELLGR.V    
A0081SHANK2, CORTBP1, PROSAP1SH3 and multiple ankyrin repeat domains protein 2 R.TGDFLIEVNNENVVK.V    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.TIAMDGTEGLVR.G    
A2341ACTN1Alpha-actinin 1AAC1_RATR.TINEVENQILTR.D    
A2344ACTN4Alpha-actinin 4AAC4_RATR.TINEVENQILTR.D    
A5178TUBA1A, TUBA3Tubulin alpha-1A chainTBA1_MOUSER.TIQFVDWCPTGFK.V    
A3876ADD1, ADDAAlpha adducinADDA_RATR.TLASAGGPDNLVLLDPGK.Y    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.TLAVDENFLPELPR.E    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.TLEELYLDANQIEELPK.Q    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.TLETPAAQM#EGFLNR.K    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.TLETPAAQMEGFLNR.K    
A9634RPS1640S ribosomal protein S16RS16_HUMANR.TLLVADPR.R    
A1168SIPA1L1, E6TP1High-risk human papilloma viruses E6 oncoproteins targeted protein E6TP1 alpha/beta R.TLSDESIYSSQR.E    
A3990CASKIN1Cask-interacting protein 1 R.TLSGPVTGLLATAR.R    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.TLVEEER.L    
A0333SNAP25, SNAPSynaptosomal-associated protein 25SN25_HUMANR.TLVM#LDEQGEQLER.I    
A4474KCNMA1, KCNMA, SLOCalcium activated potassium channel alpha subunit 1 R.TLVTGGATPELEALIAEENALR.G    
A0276CIT, CRIK, STK21Citron protein R.TLYLLAPSFPDK.Q    
A0454DSPDesmoplakin R.TM#IQSPSGVILQEAADVHAR.Y    
A3579CYFIP1Cytoplasmic FMR1 interacting protein 1 R.TM#LESLIADK.S    
A3580CYFIP2, PIR121P53 inducible protein R.TM#LESLIADK.S    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANR.TM#NNFLDREQYGQYALAVR.G    
A3904syn2, SYN2Synapsin-2SYN2_RATR.TPALSPQRPLTTQQPQSGTLK.E    
A0625MAP1BMicrotubule-associated protein 1BMAPB_MOUSER.TPEVSGYTYEK.T    
A0625MAP1BMicrotubule-associated protein 1BNERX_RATR.TPEVSGYTYEK.T    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATR.TPNGVVLAPVQLGK.W    
A3873ANK2Ankyrin 2ANK2_HUMANR.TPTEEGTPTSEQNPFLFQEGK.L    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform R.TPVSEDMLGR.V    
A0130NRXN1Neurexin 1-alpha precursor R.TPYTAPGESEILDLDDELYLGGLPENK.A    
A0101MLLT4, AF6AF-6 protein R.TQDAAGPELM#LPASIEFR.E    
A0350MBPMyelin basic protein R.TQDENPVVHFFK.N    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.TQTAIASEDM#PNTLTEAEK.L    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.TQTAIASEDMPNTLTEAEK.L    
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_RATR.TQYEAVATSNM#QETEEWYR.S    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.TRHDEYLEVTK.A    
A3530ARHGAP39Hypothetical protein R.TSENQWWELFDPNTSR.F    
A0143AKAP5, AKAP79A-kinase anchor protein 5AK15_RATR.TSEQYETLLIETASSLVK.N    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATR.TSIDAYDNFDNISLAQR.L    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.TSSIADEGTYTLDSILR.Q    
A0469CTNND2, NPRAPCatenin delta-2 R.TSTAPSSPGVDSVPLQR.T    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.TTGIVM#DSGDGVTHTVPIYEGYALPH.A    
A4552ACTG1, ACTGActin, cytoplasmic 2 R.TTGIVM#DSGDGVTHTVPIYEGYALPH.A    
A0350MBPMyelin basic protein R.TTHYGSLPQK.S    
A0757CNTN1Contactin-1 precursor R.TTKPYPADIVVQFK.D    
A0560UNC13AProtein unc-13 homolog A R.TVGLAVLQLR.E    
A5083PKP4, ps1ly2h-25, PS1LY2H-25Plakophilin-4 R.TVHDMEQFGQQQYDIYER.M    
A3519SEPT6, SEP2Septin 6 R.TVPLAGHVGFDSLPDQLVNK.S    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.TWDLTGLLLFSR.L    
A0378ATP5B, ATPMB, ATPSBATP synthase beta chain, mitochondrial precursorATPB_RATR.VALTGLTVAEYFR.D    
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANR.VAPEEHPVLLTEAPLNPK.A    
A4552ACTG1, ACTGActin, cytoplasmic 2 R.VAPEEHPVLLTEAPLNPK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.VASNPYTWFTM#EALEETWR.N    
A0658DCTN1Dynactin 1DYNA_RATR.VDELTTDLEILK.A    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.VDHGAEIITQSPSR.S    
A0083CTTN, EMS1CortactinSRC8_MOUSER.VDQSAVGFEYQGK.T    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.VEEQVNLR.K    
A0150LRRC7, LAP1Leucine-rich repeat-containing protein 7 R.VENANPTANTEQTVK.E    
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF11_CRIGRR.VETGVLKPGMVVTFAPVNVTTEVK.S    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANR.VFDKDGNGYISAAELR.H    
A2342MACF1, ABP620, ACF7Microtubule-actin crosslinking factor 1, isoforms 1/2/3/4/5ACF7_MOUSER.VGGGWM#ALDEFLVK.N    
A3555VCAN, CSPG2Versican core protein precursor R.VGHDYQWIGLNDK.M    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSER.VGHSELVGEIIR.L    
A3874ANK3Ankyrin 3 R.VGLQAQPVPEETVK.K    
A0035RIMS1, RAB3IP2, RIM1Regulating synaptic membrane exocytosis protein 1 R.VGPDSQFSDFLDGLGPAQLVGR.Q    
A0397ATP6V1A, ATP6A1, ATP6V1A1Vacuolar ATP synthase catalytic subunit A, ubiquitous isoformVATA_MOUSER.VGSHITGGDIYGIVNENSLIK.H    
A2341ACTN1Alpha-actinin 1AAC1_RATR.VGWEQLLTTIAR.T    
A2344ACTN4Alpha-actinin 4AAC4_RATR.VGWEQLLTTIAR.T    
A3990CASKIN1Cask-interacting protein 1 R.VGYFPSSLGEAIVK.R    
A3990CASKIN1Cask-interacting protein 1 R.VGYFPSSLGEAIVK.R    
A3887HNT, NTM, IGLON2Neurotrimin precursorNTRI_RATR.VHLIVQVSPK.I    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.VHSDSETDDIGFIPSK.R    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.VIEDLSGPYIWVPAR.E    
A3509SBF1, MTMR5SET binding factor 1 R.VIFTGM#PTDPLVGEQVVVR.S    
A0757CNTN1Contactin-1 precursor R.VIIECKPK.A    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATR.VIISAPSADAPM#FVM#GVNHEK.Y    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATR.VIISAPSADAPM#FVMGVNHEK.Y    
A0014DLG2Disks large homolog 2SP93_RATR.VILDGDSEEM#GVIPSK.R    
A1218THY1Thy-1 membrane glycoprotein precursorTHY1_RATR.VISLTACLVNQNLR.L    
A0323RAP1A, KREV1Ras-related protein Rap-1ARAPA_HUMANR.VKDTEDVPM#ILVGNK.C    
A0203RALA, RALRas-related protein Ral-ARALA_MOUSER.VKEDENVPFLLVGNK.S    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.VKEYEEEIHSLK.E    
A0117NSFVesicle-fusing ATPase R.VLDDGELLVQQTK.N    
A0161SYN1Synapsin ISYN1_RATR.VLLVIDEPHTDWAK.Y    
A3553CNP2',3'-cyclic nucleotide 3'-phosphodiesteraseCN37_RATR.VLVLDDTNHER.E    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.VM#ETGVIDPEIQR.Y    
A0016DLG3Discs, large homolog 3SP02_RATR.VNDDLISEFPHK.F    
A0013DLG4, PSD95, TIP15Presynaptic density protein 95SP90_RATR.VNDSILFVNEVDVR.E    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.VNDVCTNGQDLIK.K    
A0014DLG2Disks large homolog 2SP93_RATR.VNEVDVSEVSHSK.A    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.VNEVNQFAAK.L    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.VNNYCVDCEETSK.W    
A0587ADD2, ADDBBeta adducinADDL_RATR.VNVADEVQR.N    
A0085MAP1A, MAP1L, M1LPMicrotubule-associated protein 1AMAPA_RATR.VPSAPGQESPVPDTESTAPM#R.N    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATR.VPTPNVSVVDLTCR.L    
A1941PLEC1, PLECPlectinPLEC_RATR.VPVDVAYQR.G    
A0133DYNC1H1, Dnchc1, DHC1Dynein heavy chain, cytosolicDYHC_RATR.VQVALEELQDLK.G    
A0757CNTN1Contactin-1 precursor R.VQVTSQEYSAR.L    
A8860PPFIA2Liprin-alpha2 R.VSALEEELAAANQEIVALR.E    
A0069GNB1Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1GBB1_RATR.VSCLGVTDDGM#AVATGSWDSFLK.I    
A0070GNB2Guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2GBB2_RATR.VSCLGVTDDGM#AVATGSWDSFLK.I    
A3879ERC2, CAST1, CASTERC protein 2 R.VSHEENQHLQLTIQALQDELR.T    
A0758CNTNAP1, CASPR, NRXN4Contactin associated protein 1 precursor R.VSYPLLIR.T    
A0134MAP2, 4R-MAP2Microtubule-associated protein 2MAP2_RATR.VTEGSQPFAPVFFQSDDK.M    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 R.VTQSNFAVGYK.T    
A0757CNTN1Contactin-1 precursor R.VVATNTLGTGEPSIPSNR.I    
A0377ATP5A1, ATP5A, ATP5AL2ATP synthase alpha chain, mitochondrial precursorATPA_RATR.VVDALGNAIDGK.G    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATR.VVDLM#AYM#ASK.E    
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_RATR.VVDLMAYM#ASK.E    
A4012PRNP, PRIP, PRPMajor prion protein precursorPRIO_CRIMIR.VVEQM#CVTQYQK.E    
A4012PRNP, PRIP, PRPMajor prion protein precursorPRIO_CRIMIR.VVEQMCVTQYQK.E    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.VVFQAEEER.N    
A3887HNT, NTM, IGLON2Neurotrimin precursorNTRI_RATR.VVLLSNTQTQY.S    
A3888NEGR1, IGLON4, UNQ2433/PRO4993Neuronal growth regulator 1KILO_RATR.VVVNFAPTIQEIK.S    
A0431NDUFV2NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursorNUHM_RATR.VYEVATFYTM#YNR.K    
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPCO_MOUSER.WDVDDWDNENSSAR.L    
A0757CNTN1Contactin-1 precursor R.WLLNEFPVFITMDK.R    
A0212RPH3ARabphilin-3ARP3A_RATR.WM#YPGDGPLQSNDK.E    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.WQAFQAVVSEQR.E    
A1941PLEC1, PLECPlectinPLEC_RATR.WQAVLAQTDVR.Q    
A0425VDAC1, VDAC, VDAC4Voltage-dependent anion-selective channel protein 1 R.WTEYGLTFTEK.W    
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brain R.WTQLLANSATR.K    
A0276CIT, CRIK, STK21Citron protein R.WVTALESVVAGGR.V    
A0400ATP6V1B2, ATP6B2, VPP3Vacuolar ATP synthase subunit B, brain isoform R.YAEIVHLTLPDGTK.R    
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevican R.YAFSFAGAQEACAR.I    
A0999CFL1, CFLCofilin, non-muscle isoformCOF1_RATR.YALYDATYETK.E    
A3556BCAN, BEHAB, CSPG7Chondroitin sulfate proteoglycan BEHAB/brevican R.YAVDTVLR.Y    
A3555VCAN, CSPG2Versican core protein precursor R.YEINSLIR.Y    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.YFATVSGSASEANVEEK.V    
A0395SLC25A4, ANT1ADP,ATP carrier protein, heart/skeletal muscle isoform T1ADT1_RATR.YFPTQALNFAFK.D    
A0396SLC25A5, ANT2ADP/ATP translocase 2ADT2_RATR.YFPTQALNFAFK.D    
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPCB_MOUSER.YFYTGTEILGLIDEK.H    
A0251AP2A1, ADTAA, CLAPA1Adapter-related protein complex 2 alpha 1 subunitADAA_MOUSER.YLETADYAIR.E    
A0443SLC25A12, ARALAR1Calcium-binding mitochondrial carrier protein Aralar1CMC1_HUMANR.YLGLYNDPNSNPK.I    
A0285BSN, ZNF231Bassoon protein R.YLGQGLQYGSFTDLR.H    
A3903SRCIN1, SNIP, P140SRC kinase signaling inhibitor 1 R.YLNDEELITQQLNDLEK.S    
A0285BSN, ZNF231Bassoon protein R.YNLPNQVTPLAR.R    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.YNVSQLEEWLR.D    
A3506DCAMKL1, DCLK1, DCDC3ASerine/threonine-protein kinase DCAMKL1 R.YQDDFLLDESECR.V    
A0149MYO5A, MYH12Unconventional myosin-VaMY5A_RATR.YQNLLNEFSR.L    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.YQTM#SILPMELYK.E    
A0024SYNGAP1Ras GTPase-activating protein SynGAP R.YQTM#SILPMELYK.E    
A1941PLEC1, PLECPlectinPLEC_RATR.YSELTTLTSQYIK.F    
A0003GRIN2B, NMDAR2BGlutamate [NMDA] receptor subunit epsilon 2 precursorNME2_RATR.YSGHDDLIR.S    
A0757CNTN1Contactin-1 precursor R.YSMVGGNLVINNPDK.Q    
A3658PI4KA, PIK4, PIK4CAPhosphatidylinositol 4-kinase alpha R.YSNSEESLLSK.L    
A3580CYFIP2, PIR121P53 inducible protein R.YSNSEVVTGSGLDSQK.S    
A8478RGS6, S914Regulator of G-protein signaling 6RGS6_RATR.YTFEDAQEHIYK.L    
A9580RPLP2, D11S2243E, RPP260S acidic ribosomal protein P2RLA2_RATR.YVASYLLAALGGNSNPSAK.D    
A0130NRXN1Neurexin 1-alpha precursor R.YVCDCSGTGYLGR.S    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANR.YVM#GNNPADLLAVDSR.T    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANR.YVMGNNPADLLAVDSR.T    
A0663NFASCNeurofascin precursor R.YVVGQTPVYVPYEIR.V    
A3810RPL6, TXREB1, TAXREB10760S ribosomal protein L6RL6_RATR.YYPTEDVPR.K    
A8662ANKS1B, EB-1Cajalin 2 R.YYPVDGYSLLK.R    
A0008CALM1, CALM2, CALM3CalmodulinCALM_HUMANS.LFDKDGDGTITTK.E    
A3606DPYSL4, CRMP3, ULIP4Dihydropyrimidinase related protein-4DPY4_HUMANT.GVSLLAAYERWR.E    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATT.TAPATM#STAASGTTMGLVEQAK.S    
A0161SYN1Synapsin ISYN1_RATV.DNQHDFQDIASVVALTK.T    
A9635RPS17, RPS17L40S ribosomal protein S17RS17_RATV.PEVSALDQEIIEVDPDTKEM#LK.L    
A0011CAMK2A, CAMKACalcium/calmodulin-dependent protein kinase type II alpha chainKCCA_RATW.FGFAGTPGYLSPEVLR.K    
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCCB_RATW.FGFAGTPGYLSPEVLR.K    
A1852CAMK2G, CAMK, CAMK-IICalcium/calmodulin-dependent protein kinase type II gamma chainKCCG_RATW.FGFAGTPGYLSPEVLR.K    
A1853CAMK2D, CAMKDCalcium/calmodulin-dependent protein kinase type II delta chainKCCD_RATW.FGFAGTPGYLSPEVLR.K    
A0568PCLO, ACZProtein piccolo Y.IAPPGILSTVSEIPLTDVVVK.E    
A0119CLTC, CLH17, CLTCL2Clathrin heavy chain 1CLH_RATY.ITNVLQNPDLALR.M    
A1015BAIAP2, IRSP53Brain-specific angiogenesis inhibitor 1-associated protein 2 Y.SVAVPAFSQGLDDYGAR.S    
A0291DSG1, CDHF4Desmoglein-1DSG1_HUMANY.VM#GNNPADLLAVDSR.T    

Compile date 12-23-2014© PADB initiative