CKDdb-logoCKDdb - Extended molecular information by molecule

Molecule reference

A6825Ak4Adenylate kinase isoenzyme 4, mitochondrial

StudySpeciesDiseaseTissue / SourceSubcellAnalysis methodSequence
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMMSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSDAAKPVIELYK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSSAQHWLLDGFPR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMmSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSYKDAAKPVIELYK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSGLLVPDHVITR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSAVILGPPGSGK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAAR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMMSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSSAQHWLLDGFPR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMmSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSGLLVPDHVITR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSAVILGPPGSGK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSAVILGPPGSGK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMMSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSDAAKPVIELYK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSGWQASPR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSSAQHWLLDGFPR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLMmSELETR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSYKDAAKPVIELYK
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSGLLVPDHVITR
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAAR

Compile date 08-10-2018© iMODE-CKD consortium