CKDdb-logoCKDdb - Extended molecular information by molecule

Molecule reference

A5894Adam6aA disintegrin and metallopeptidase domain 6

StudySpeciesDiseaseTissue / SourceSubcellAnalysis methodSequence
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSVFYAHFRPDAGAIINKNSPGDDAVNPAER
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLTPGSIcDK

Compile date 08-10-2018© iMODE-CKD consortium