CKDdb-logoCKDdb - Extended molecular information by molecule

Molecule reference

A0419GsnGelsolin

StudySpeciesDiseaseTissue / SourceSubcellAnalysis methodSequenceMass spectrometry
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSDGGQTAPASIR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSSGALNSNDAFVLK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSTGAQELLK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSNWRDPDQTDGPGLGYLSSHIANVER 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSSEDcFILDHGR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSVPFDAATLHTSTAMAAQHGMDDDGTGQK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSTPITVVR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSEPAHLMSLFGGKPmIIYK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSYIETDPANRDR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSKMDAHPPR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSHVVPNEVVVQR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSLFAcSNR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSYIETDPANR 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSDSQEEEKTEALTSAK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSTASDFISK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSEVQGFESSTFSGYFK 
Exp24172336Mus musculusAKIkidneycortexLC-MS/MSQTQVSVLPEGGETPLFK 
Exp20411046Homo sapiensPolycystic_Kidney_Diseasekidneycyst fluid  peptide count: 22
Exp20411046Homo sapiensPolycystic_Kidney_Diseasekidneycyst fluid  peptide count: 6
Exp20411046Homo sapiensPolycystic_Kidney_Diseasekidneycyst fluid  peptide count: 2
Exp20411046Homo sapiensPolycystic_Kidney_Diseasekidneycyst fluid  peptide count: 6
Exp20411046Homo sapiensPolycystic_Kidney_Diseasekidneycyst fluid  peptide count: 6
Exp20940332Mus musculusVasopressine_inducedkidneycollecting duct cells  peptide count: 22

Compile date 08-10-2018© iMODE-CKD consortium